BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780377|ref|YP_003064790.1| flagellar basal body P-ring biosynthesis protein FlgA [Candidatus Liberibacter asiaticus str. psy62] (152 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780377|ref|YP_003064790.1| flagellar basal body P-ring biosynthesis protein FlgA [Candidatus Liberibacter asiaticus str. psy62] Length = 152 Score = 299 bits (765), Expect = 2e-83, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNY 60 MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNY Sbjct: 1 MDCVRFLLFFSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNY 60 Query: 61 AHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDA 120 AHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDA Sbjct: 61 AHSIKDVVGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRIILTQGNMTISTAGIALSDA 120 Query: 121 SIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK 152 SIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK Sbjct: 121 SIGDVIAVKNIDTGVMVSGSVVDTGTVRVVVK 152 >gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Candidatus Liberibacter asiaticus str. psy62] Length = 95 Score = 28.1 bits (61), Expect = 0.072, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 81 VIPLSVLHRPYVISRGAKVRIILTQG 106 V+P+ ++HRP V+ G KV IL+ Sbjct: 55 VVPMKMVHRPDVVCDGDKVESILSNA 80 >gi|254780489|ref|YP_003064902.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 325 Score = 25.8 bits (55), Expect = 0.37, Method: Compositional matrix adjust. Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 19/74 (25%) Query: 27 HAVVPSVVINAGEVLNESRLKEMQVTNSNIRGNYAHSIKDVVGLVTRRVLLPDHVIPLS- 85 H + + I AG++ + N+NI+ KD + L PDH++P S Sbjct: 51 HETLTDIAIQAGDI---------ALRNANIK-------KDSISLTLLATSTPDHLLPPSS 94 Query: 86 --VLHRPYVISRGA 97 + HR ++ GA Sbjct: 95 PLITHRLGLMQSGA 108 >gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str. psy62] Length = 781 Score = 22.3 bits (46), Expect = 3.5, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Query: 62 HSIKDV---VGLVTRRVLLPDHVIPLSVLHRPYVISRGAKVRI--ILTQGNMTISTA 113 H+IK +G + V + H I + L+ YVI G K +I I GN S A Sbjct: 154 HNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHA 210 >gi|254780575|ref|YP_003064988.1| hypothetical protein CLIBASIA_02310 [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 21.6 bits (44), Expect = 6.0, Method: Compositional matrix adjust. Identities = 11/41 (26%), Positives = 18/41 (43%) Query: 10 FSLYVLSLDSLFASVIGHAVVPSVVINAGEVLNESRLKEMQ 50 F +Y L F + + V P + + G V + RL +Q Sbjct: 107 FFIYALLTRQGFLTSFSYFVTPVISVFLGSVFLKERLNHLQ 147 >gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 21.6 bits (44), Expect = 6.6, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 55 NIRGNYAHSIKDVVGLVTRRVLL 77 N+ G Y +IKD+ G +R LL Sbjct: 115 NLIGKYNRNIKDLSGGEFQRALL 137 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.138 0.379 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,560 Number of Sequences: 1233 Number of extensions: 3511 Number of successful extensions: 14 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 12 length of query: 152 length of database: 328,796 effective HSP length: 67 effective length of query: 85 effective length of database: 246,185 effective search space: 20925725 effective search space used: 20925725 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 34 (17.7 bits)