HHsearch alignment for GI: 254780378 and conserved domain: TIGR02492

>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway . The amino acid sequences of the hook protein and of the three hook-associated proteins of Salmonella typhimurium have been deduced from the DNA sequences of their structural genes (flgE, flgK, flgL and fliD respectively). These sequences have been compared with each other and with those for the filament protein (flagellin) and four rod proteins. The hook protein was found to be most similar to the distal rod protein (FlgG) and the proximal hook-associated protein (HAP1), which are thought to be attached to the proximal and distal ends of the hook, the similarities being most pronounced near the N- and C-termini. It is thought that the axial proteins may adopt amphipathic alpha-helical conformations at their N- and C-termini. These regions of the filament and hook are believed to be responsible for quaternary interactions between subunits. Interaction between N- and C-terminal alpha-helices may be important in the formation of the axial structures of the flagellum. Although consensus sequences have been noted, no consensus extends to the entire set of axial proteins. Thus the basis for recognition of a protein for export by the flagellum-specific pathway remains to be identified.; GO: 0005198 structural molecule activity, 0009296 flagellum biogenesis, 0009424 flagellin-based flagellum hook.
Probab=98.80  E-value=2.6e-09  Score=76.05  Aligned_cols=76  Identities=37%  Similarity=0.489  Sum_probs=55.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCC
Q ss_conf             48999999999999659997754217773400002229999987640256766555665456663114420211232233
Q gi|254780378|r    3 AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVY   82 (262)
Q Consensus         3 ~ly~a~sgm~a~~~~l~~isnNlAN~nT~GfK~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~gv~~~~~~~~~   82 (262)
T Consensus         2 ~l~~a~~gL~a~q~al~~~~~NIANant~GY~Rq~a~~~~~~~---------~~~~~-~~~~~~~~~G~GV~v~~i~R~~   71 (495)
T TIGR02492         2 LLNIAKSGLSASQIALSVTSNNIANANTPGYSRQRAELTASPA---------GGQGL-NATEGGLQIGTGVKVTSIRRIQ   71 (495)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCC---------CCCCC-CCCCCCCCCCCCEEEEEEEEHH
T ss_conf             4789999999999999987436224679896046677503334---------32111-0001466555646986554415


Q ss_pred             CCCCCC
Q ss_conf             578733
Q gi|254780378|r   83 TQGEVV   88 (262)
Q Consensus        83 ~qG~l~   88 (262)
T Consensus        72 d~~l~~   77 (495)
T TIGR02492        72 DQFLDN   77 (495)
T ss_pred             HHHHHH
T ss_conf             489999