>TIGR00205 fliE flagellar hook-basal body complex protein (FliE); InterPro: IPR001624 Four genes from the major Bacillus subtilis chemotaxis locus have been shown to encode proteins that are similar to the Salmonella typhimurium FlgB, FlgC, FlgG and FliF proteins; a further gene product is similar to the Escherichia coli FliE protein . All of these proteins are thought to form part of the hook-basal body complex of the bacterial flagella . The FlgB, FlgC and FlgG proteins are components of the proximal and distal rods; FliF forms the M-ring that anchors the rod assembly to the membrane; but the role of FliE has not yet been determined . The similarity between the proteins in these two organisms suggests that the structures of the M-ring and the rod may be similar . Nevertheless, some differences in size and amino acid composition between some of the homologues suggest the basal body proteins may be organised slightly differently within B. subtilis . From gel electrophoresis and autoradiography of 35S-labelled S. typhimurium hook-basal body complexes and the deduced number of sulphur-containing residues in FliE, the stoichiometry of the protein in the hook-basal body complex has been estimated to be about nine subunits . FliE does not undergo cleavage of a signal peptide, nor does it show any similarity to the axial components like the rod or hook proteins, which are thought to be exported by the flagellum-specific export pathway . On this evidence, it has been suggested that FliE may be in the vicinity of the MS ring, perhaps acting as an adaptor protein between ring and rod substructures .; GO: 0003774 motor activity, 0005198 structural molecule activity, 0001539 ciliary or flagellar motility, 0009288 flagellin-based flagellum.

Probab=99.87  E-value=9.7e-22  Score=148.62  Aligned_cols=79  Identities=22%  Similarity=0.305  Sum_probs=72.4

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             7778888665999999999999999999999999998148--98999999999999999999999999999999996188
Q gi|254780379|r   30 NEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGK--TSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQ  107 (108)
Q Consensus        30 ~~~~~~~~~sF~~~L~~~i~~vn~~q~~a~~~~~~~~~G~--~dl~~vmia~~kA~lsl~~~vqVRnK~v~AYqeImrMq  107 (108)
T Consensus        34 ~~~~~~~~~~F~~~L~~Si~~~n~sQ~~~~~~~~~~~~g~~~~~l~~v~ia~~KA~~sl~~~~~vrnk~v~AYqei~~~q  113 (114)
T TIGR00205        34 SKAQDSDIKSFSDLLKNSIDELNESQLASDKVTEKLALGEKSVDLHDVMIAMQKASVSLKLLLEVRNKAVKAYQEIMRMQ  113 (114)
T ss_pred             HCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             04677752028999999999886889999999999861998867889999999886999999999999999999996205


Q ss_pred             C
Q ss_conf             9
Q gi|254780379|r  108 I  108 (108)
Q Consensus       108 V  108 (108)
T Consensus       114 ~  114 (114)
T TIGR00205       114 V  114 (114)
T ss_pred             C
T ss_conf             9