HHsearch alignment for GI: 254780380 and conserved domain: PRK05841

>PRK05841 flgE flagellar hook protein FlgE; Validated.
Probab=99.58  E-value=6.3e-16  Score=101.66  Aligned_cols=49  Identities=18%  Similarity=0.213  Sum_probs=46.1

Q ss_pred             CHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             5023333056109999999999999999999999999999999999646
Q gi|254780380|r   85 NASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLR  133 (134)
Q Consensus        85 d~~G~v~~snVd~~~Em~~m~~a~r~yean~~~~~~~~~m~~~~l~i~r  133 (134)
T Consensus       557 I~~~aLE~SNVDLa~Eft~mIvtQR~yQANsKvITTsD~mLqelinLKR  605 (605)
T PRK05841        557 IRHKYLETSNVNAGNALTNLILMQRGYSMNARAFGAGDDMIKEAISLKK  605 (605)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHCHHHCEEEEEHHHHHHHHHHHCC
T ss_conf             6247620133058999999999876520541278768999999986259