HHsearch alignment for GI: 254780380 and conserved domain: PRK12803

>PRK12803 flagellin; Provisional.
Probab=90.64  E-value=0.5  Score=24.72  Aligned_cols=41  Identities=20%  Similarity=0.231  Sum_probs=38.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             56109999999999999999999999999999999999646
Q gi|254780380|r   93 PNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLR  133 (134)
Q Consensus        93 snVd~~~Em~~m~~a~r~yean~~~~~~~~~m~~~~l~i~r  133 (134)
T Consensus       295 ~DaD~A~E~~~ltk~qil~Qa~~amLaQAN~~pq~vL~LLq  335 (335)
T PRK12803        295 KDATMTDEVVASTTNSILTQSAMAMIAQANQVPQYVLSLLR  335 (335)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCC
T ss_conf             63059999999999999999999999997617689998409