BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] (134 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] Length = 134 Score = 279 bits (713), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 134/134 (100%), Positives = 134/134 (100%) Query: 1 MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGG 60 MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGG Sbjct: 1 MDYLIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGG 60 Query: 61 VRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQ 120 VRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQ Sbjct: 61 VRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQ 120 Query: 121 SHDMMTTTLDLLRD 134 SHDMMTTTLDLLRD Sbjct: 121 SHDMMTTTLDLLRD 134 >gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str. psy62] Length = 421 Score = 35.8 bits (81), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 19/124 (15%) Query: 4 LIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVM-------H 56 ++ S A SG+ QS R+ +S+NIAN T G Y+R I+F ++ + Sbjct: 3 ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVG-------YKRTAIAFSSLVFPSTSNSY 55 Query: 57 GSGGVRV--KKIGVDQSTFVEEFDPGHPVANASG--IVK-YPNVNVLVETADMRETNRLY 111 SGG+ + K + +Q + + G IVK NVN L D N + Sbjct: 56 VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGF 115 Query: 112 MANL 115 + N+ Sbjct: 116 LENV 119 Score = 26.6 bits (57), Expect = 0.17, Method: Compositional matrix adjust. Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Query: 79 PGHPVANA--SGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMTTTLDLLR 133 PGH SG ++ NV++ E ++ E R Y N + + D M + L R Sbjct: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421 >gi|254780381|ref|YP_003064794.1| flagellar basal body rod protein FlgB [Candidatus Liberibacter asiaticus str. psy62] Length = 130 Score = 28.5 bits (62), Expect = 0.044, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 8/38 (21%) Query: 19 SARMQIISENIANARTTGDTPGSDPYRRKTI-SFEEVM 55 S R +I+SENIANA TP YR K I SFE ++ Sbjct: 18 SERQKIVSENIANA----STPN---YRAKDISSFETIL 48 >gi|254780129|ref|YP_003064542.1| hypothetical protein CLIBASIA_00040 [Candidatus Liberibacter asiaticus str. psy62] Length = 220 Score = 23.5 bits (49), Expect = 1.7, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 64 KKIGVDQSTFVEEFDPGHPVANASGIVKY-PNVN 96 K++G+ +FVE + V ++ G VK+ P +N Sbjct: 183 KRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKIN 216 >gi|254780378|ref|YP_003064791.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 22.3 bits (46), Expect = 3.7, Method: Compositional matrix adjust. Identities = 10/37 (27%), Positives = 20/37 (54%) Query: 88 GIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDM 124 G ++ NV+ + E ++M R Y N + I+ + +M Sbjct: 218 GYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.130 0.359 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,969 Number of Sequences: 1233 Number of extensions: 2703 Number of successful extensions: 11 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 10 length of query: 134 length of database: 328,796 effective HSP length: 65 effective length of query: 69 effective length of database: 248,651 effective search space: 17156919 effective search space used: 17156919 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 34 (17.7 bits)