RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780381|ref|YP_003064794.1| flagellar basal body rod protein FlgB [Candidatus Liberibacter asiaticus str. psy62] (130 letters) >2es9_A Putative cytoplasmic protein; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Salmonella typhimurium LT2} (A:) Length = 115 Score = 25.3 bits (55), Expect = 2.6 Identities = 12/37 (32%), Positives = 17/37 (45%) Query: 76 VIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYEL 112 IE LD G S + +E G +KYL++L Sbjct: 12 AIEKALDFIGGXNTSASVPHSXDESTAKGILKYLHDL 48 >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin capping, actin-binding, alternative splicing, calcium; 2.30A {Homo sapiens} (A:31-149) Length = 119 Score = 24.1 bits (52), Expect = 6.6 Identities = 9/56 (16%), Positives = 22/56 (39%), Gaps = 9/56 (16%) Query: 6 FFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHETH 61 F + A + W+ E+ +I S+ KD ++ + L ++ + + Sbjct: 21 FQRDAEELEKWIQEKLQIASDEN---------YKDPTNLQGKLQKHQAFEAEVQAN 67 >3bhw_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein structure initiative; 1.50A {Magnetospirillum magneticum amb-1} (A:) Length = 209 Score = 24.0 bits (52), Expect = 6.6 Identities = 9/32 (28%), Positives = 12/32 (37%), Gaps = 1/32 (3%) Query: 12 QHANWLSERQKIVSENIANASTPNYRAKDISS 43 + R I EN+ +P AK SS Sbjct: 31 EGVTEDQWRHAIEVENVLQRRSPG-TAKRQSS 61 >1owa_A Spectrin alpha chain, erythrocyte; triple helical bundle, cytokine; NMR {Homo sapiens} (A:50-156) Length = 107 Score = 23.7 bits (51), Expect = 8.3 Identities = 5/25 (20%), Positives = 11/25 (44%) Query: 6 FFQIASQHANWLSERQKIVSENIAN 30 F + A W+ E+ I+++ Sbjct: 9 FKRDADDLGKWIMEKVNILTDKSYE 33 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.128 0.365 Gapped Lambda K H 0.267 0.0587 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 862,528 Number of extensions: 30278 Number of successful extensions: 74 Number of sequences better than 10.0: 1 Number of HSP's gapped: 74 Number of HSP's successfully gapped: 7 Length of query: 130 Length of database: 4,956,049 Length adjustment: 77 Effective length of query: 53 Effective length of database: 2,353,064 Effective search space: 124712392 Effective search space used: 124712392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)