RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780381|ref|YP_003064794.1| flagellar basal body rod protein FlgB [Candidatus Liberibacter asiaticus str. psy62] (130 letters) >d2es9a1 a.247.1.1 (A:11-107) Hypothetical protein YoaC {Salmonella typhimurium [TaxId: 90371]} Length = 97 Score = 24.2 bits (52), Expect = 3.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 76 VIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYEL 112 IE LD G+ S + +E G +KYL++L Sbjct: 2 AIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDL 38 >d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Score = 23.7 bits (51), Expect = 5.8 Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Query: 86 GVQVSGNTVGITNELYKSGHIKYLYELNTKLIK 118 V +SG +V +T L ++K +E N + + Sbjct: 9 KVSISGTSVELTCPLDSDENLK--WEKNGQELP 39 >d1n45a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Score = 23.1 bits (49), Expect = 8.4 Identities = 6/20 (30%), Positives = 12/20 (60%) Query: 107 KYLYELNTKLIKKLNSMVMH 126 K + LN +L ++L ++ H Sbjct: 195 KTAFLLNIQLFEELQELLTH 214 >d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Length = 345 Score = 23.0 bits (49), Expect = 9.3 Identities = 4/18 (22%), Positives = 8/18 (44%) Query: 109 LYELNTKLIKKLNSMVMH 126 + L++K+ V H Sbjct: 328 CWNHKMNLLEKVRKDVKH 345 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.128 0.365 Gapped Lambda K H 0.267 0.0568 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 435,074 Number of extensions: 16312 Number of successful extensions: 45 Number of sequences better than 10.0: 1 Number of HSP's gapped: 45 Number of HSP's successfully gapped: 12 Length of query: 130 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 54 Effective length of database: 1,364,116 Effective search space: 73662264 Effective search space used: 73662264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (22.6 bits)