RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780384|ref|YP_003064797.1| serralysin [Candidatus Liberibacter asiaticus str. psy62] (665 letters) >gnl|CDD|58577 cd04277, ZnMc_serralysin_like, Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.. Length = 186 Score = 94.4 bits (234), Expect = 9e-20 Identities = 59/171 (34%), Positives = 79/171 (46%), Gaps = 14/171 (8%) Query: 36 TTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHS--DIKFISSNN------- 86 + + L+ Q AR AL W V D+ F E S +S DI+F +S++ Sbjct: 20 GREEDTTNTAALSAAQQAAARDALEAWEDVADIDFVEVSDNSGADIRFGNSSDPDGNTAG 79 Query: 87 -GYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYP 145 Y + Y +I F+ + G+ +HEIGHALGL HPG YNGG P Sbjct: 80 YAYYPGSGSGTAYGGDIWFNSSYDTNSD-SPGSYGYQTIIHEIGHALGLEHPGDYNGGDP 138 Query: 146 VYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYG 196 V Y DS +VMSY + A GY TPM+ DI A+Q +YG Sbjct: 139 V---PPTYALDSREYTVMSYNSGYGNGASAGGGYPQTPMLLDIAALQYLYG 186 >gnl|CDD|58578 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).. Length = 157 Score = 52.9 bits (127), Expect = 3e-07 Identities = 40/154 (25%), Positives = 51/154 (33%), Gaps = 41/154 (26%) Query: 58 ALGEWSKVVDLTFEETSIHSD----IKFISSN----------NGYVCTPRYDSRYFMEIN 103 A WS V LTF E + + I F N G + + +I+ Sbjct: 30 AFRVWSDVTPLTFREVTSGQEADIRISFARGNHGDGYPFDGPGGTLAHAFFPGGIGGDIH 89 Query: 104 FDKADVWRYG-IGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSV 162 FD + W G GT L A HEIGHALGL H + S+ Sbjct: 90 FDDDEQWTLGSDSGGTDLFSVAAHEIGHALGLGHSSDPD-------------------SI 130 Query: 163 MSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYG 196 M P F DI +Q +YG Sbjct: 131 MY---PYYQGPVPKF----KLSQDDIRGIQALYG 157 >gnl|CDD|144126 pfam00413, Peptidase_M10, Matrixin. The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis. Length = 158 Score = 50.3 bits (121), Expect = 2e-06 Identities = 51/181 (28%), Positives = 70/181 (38%), Gaps = 51/181 (28%) Query: 37 THRLSFDITELNPNAQ-EVARWALGEWSKVVDLTFEETSI-HSDIK--FISSNNGYVCTP 92 T+R+ +L + R A WS+V LTF E +DI F +G P Sbjct: 8 TYRIVNYTPDLPRDEVRRAIRRAFKVWSEVTPLTFTEVPEGTADIMIGFGRGEHGD-GYP 66 Query: 93 RYDSRY------FM------EINFDKADVWRYGIG--KGTILSHNALHEIGHALGLMHPG 138 +D F +I+FD + W G +GT L A HEIGHALGL H Sbjct: 67 -FDGPGGVLAHAFFPGPIGGDIHFDDDEQWTVGNESPEGTNLFLVAAHEIGHALGLGH-- 123 Query: 139 SYNGG---YPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIY 195 S + YP Y + Y++ F + QD DI +Q +Y Sbjct: 124 SSDPDAIMYPYY---SPYKDPVFR-------LDQD----------------DIKGIQSLY 157 Query: 196 G 196 G Sbjct: 158 G 158 >gnl|CDD|36778 KOG1565, KOG1565, KOG1565, Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones, Extracellular structures]. Length = 469 Score = 49.7 bits (118), Expect = 3e-06 Identities = 45/193 (23%), Positives = 67/193 (34%), Gaps = 57/193 (29%) Query: 29 RYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSD----IKFISS 84 ++ + LT ++ + A WS V LTF+E + I F Sbjct: 105 KWNKEHLTYRIKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPG 164 Query: 85 NNGYVCTPRYDSRYF------------------MEINFDKADVWRYGIGKGTILSHNALH 126 ++G D F +++FDK + W YG G L A H Sbjct: 165 DHG-------DGFPFDGPGGVLAHAFFPGPGIGGDLHFDKDETWTYGDSNGVDLFLVAAH 217 Query: 127 EIGHALGLMHPGSYNGG-YPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMV 185 EIGHALGL H + YP Y D+ ++ + QD Sbjct: 218 EIGHALGLGHSSDPDAIMYPFYQPDSG-----------NFDLSQD--------------- 251 Query: 186 SDIVAVQKIYGAP 198 D+ +Q +YG P Sbjct: 252 -DVRGIQHLYGGP 263 >gnl|CDD|58569 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.. Length = 165 Score = 44.3 bits (104), Expect = 1e-04 Identities = 30/161 (18%), Positives = 55/161 (34%), Gaps = 15/161 (9%) Query: 45 TELNPNAQEVARWALGEWSKVVDLTFEETSIHS--DIKFISSNNGYVCTPRYDSRYFMEI 102 + + A+ W+K + F+ + DI+ S S ++ Sbjct: 10 DSVPDKLRAAILDAIEAWNKAFAIGFKNANDVDPADIR-YSVIRWIPYNDGTWSYGPSQV 68 Query: 103 NFDKADVWRYGIGKGT--------ILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYE 154 + ++ + + L + A HE+GHALGL H + + + Sbjct: 69 DPLTGEILLARVYLYSSFVEYSGARLRNTAEHELGHALGLRHNFAASDRDDNV---DLLA 125 Query: 155 NDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIY 195 +SVM Y S+ T DI A++K+Y Sbjct: 126 EKGDTSSVMDYAPSNFSIQLGDGQK-YTIGPYDIAAIKKLY 165 >gnl|CDD|58576 cd04276, ZnMc_MMP_like_2, Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.. Length = 197 Score = 43.7 bits (103), Expect = 2e-04 Identities = 25/106 (23%), Positives = 36/106 (33%), Gaps = 4/106 (3%) Query: 95 DSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMH--PGSYNGGYPVYGVDND 152 + + F + D Y L + HE+GH LGL H S +G Sbjct: 91 KADVILYSGFLRQDQLWYEDLLAASLRYLLAHEVGHTLGLRHNFKASSDGSNEELEDPLG 150 Query: 153 YENDSFLTSVMSYFMPQDSMMDASFG--YCATPMVSDIVAVQKIYG 196 + +SVM Y P + G Y T D A++ Y Sbjct: 151 TKEKGATSSVMDYPPPNVAAQGEDQGDYYPPTIGPYDKWAIEYGYT 196 >gnl|CDD|38918 KOG3714, KOG3714, KOG3714, Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones]. Length = 411 Score = 38.3 bits (88), Expect = 0.006 Identities = 22/117 (18%), Positives = 36/117 (30%), Gaps = 22/117 (18%) Query: 21 QYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEE-TSIHSDI 79 + W N I Y D + + + R A+ E + F E T+ D Sbjct: 80 RRWPNGVIPYYID-----------GSFTSSQRALIRQAMREIENHTCIRFVERTTPDKDY 128 Query: 80 KFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMH 136 + + G ++ R+G +HE+ HALG H Sbjct: 129 LIVFTGGGCYSYVGRRGGGQQLLSLGD-GCDRFGT---------IVHELMHALGFWH 175 >gnl|CDD|58567 cd00203, ZnMc, Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.. Length = 167 Score = 38.2 bits (88), Expect = 0.008 Identities = 31/152 (20%), Positives = 50/152 (32%), Gaps = 12/152 (7%) Query: 50 NAQEVARWALGEWSKVVDLTF---EETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDK 106 Q + A+ W +++ F +DI + + + + + + Sbjct: 22 QIQSLILIAMQIWRDYLNIRFVLVGVEIDKADIAILVTRQDFDGGTGGWAYLGRVCDSLR 81 Query: 107 ADVWRYGIGKGTILSHNAL-HEIGHALGLMHPGSYN--GGYPVYGVDNDYENDSFLTSVM 163 GT + HE+GHALG H YP + E+D + SVM Sbjct: 82 GVGVLQDNQSGTKEGAQTIAHELGHALGFYHDHDRKDRDDYPTIDDTLNAEDDDYY-SVM 140 Query: 164 SYFMPQDSMMDASFGYCATPMVSDIVAVQKIY 195 SY S G DI + K+Y Sbjct: 141 SYTKGSFSD-----GQRKDFSQCDIDQINKLY 167 >gnl|CDD|32755 COG2931, COG2931, RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 510 Score = 36.5 bits (83), Expect = 0.023 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 3/91 (3%) Query: 221 TIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVV 280 TIY G+D LD + G N TI+ + ++++G +GND + Sbjct: 323 TIYGGAGNDTLDGGAGNDTLAGNAGALALLNGGDG---NDTISGNDGNDTLIGGAGNDTL 379 Query: 281 IGNSANNVFFESSGNDVFDGSSGLDTFFYYA 311 G + ++ GND G +G DTF + Sbjct: 380 SGGAGSDTLVGGGGNDTLTGGAGADTFVFGG 410 Score = 29.9 bits (66), Expect = 2.5 Identities = 21/102 (20%), Positives = 37/102 (36%) Query: 215 DSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGS 274 D D + + + L+T + G + T+ +++ G Sbjct: 42 DLTDGNDTVDVDSAAGGTAADVAALSALVILDTAGDDVLNGTNGSDTLRGGAGNDALTGG 101 Query: 275 SGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLY 316 +GND + G + N+ F GND G +G DT A + Sbjct: 102 AGNDYLDGGAGNDTLFGGDGNDALVGGAGNDTLDGGAGANDT 143 Score = 29.2 bits (64), Expect = 3.4 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 4/92 (4%) Query: 221 TIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVV 280 + + G +L L N + +G N T+ ++++G +GND + Sbjct: 240 GVVFADGTTWANLFLQALAIVGGAGNDFT---VGIGNLNDTLKGGAGNDTLLGGAGNDTL 296 Query: 281 I-GNSANNVFFESSGNDVFDGSSGLDTFFYYA 311 G N+ +GND D S G DT + A Sbjct: 297 TIGGGGNDTLDGGAGNDTLDFSGGDDTIYGGA 328 >gnl|CDD|58579 cd04279, ZnMc_MMP_like_1, Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.. Length = 156 Score = 33.9 bits (77), Expect = 0.16 Identities = 27/112 (24%), Positives = 36/112 (32%), Gaps = 15/112 (13%) Query: 58 ALGEWSKVVDLTFEET---SIHSDIKFISSNNGYVC---TPRYDSRYFMEINFDKADVWR 111 A EW V L F +DI V + + + + ++ R Sbjct: 29 AAAEWENVGPLKFVYNPEEDNDADIVIFFDRPPPVGGAGGGLARAGFPLISDGNRKLFNR 88 Query: 112 YGIGKGTILSHN-------ALHEIGHALGLMH--PGSYNGGYPVYGVDNDYE 154 I G ALHE+GHALGL H + YP G D Sbjct: 89 TDINLGPGQPRGAENLQAIALHELGHALGLWHHSDRPEDAMYPSQGQGPDGN 140 >gnl|CDD|58584 cd04327, ZnMc_MMP_like_3, Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.. Length = 198 Score = 32.6 bits (74), Expect = 0.40 Identities = 26/86 (30%), Positives = 33/86 (38%), Gaps = 18/86 (20%) Query: 61 EWSKVVDLTFEE-TSIHSDIKFISSNNG-----YVCTPRYDSRYFME----INFDKADVW 110 EW +L F+ T +DI+ IS G YV T D+ +N W Sbjct: 31 EWLPYANLKFKFVTDADADIR-ISFTPGDGYWSYVGT---DALLIGADAPTMNLG----W 82 Query: 111 RYGIGKGTILSHNALHEIGHALGLMH 136 S LHE GHALG +H Sbjct: 83 FTDDTPDPEFSRVVLHEFGHALGFIH 108 >gnl|CDD|58580 cd04280, ZnMc_astacin_like, Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.. Length = 180 Score = 31.4 bits (71), Expect = 0.93 Identities = 19/98 (19%), Positives = 31/98 (31%), Gaps = 23/98 (23%) Query: 45 TELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINF 104 + + + + A+ E + F + D I +G C Sbjct: 10 GSFDESDRSLILRAMREIESNTCIRFVPRTTEKDYIRIVKGSG--C-------------- 53 Query: 105 DKADVWRYG------IGKGTILSHNALHEIGHALGLMH 136 + V R G +G G +HE+ HALG H Sbjct: 54 -WSYVGRVGGRQVVSLGSGCFSLGTIVHELMHALGFYH 90 >gnl|CDD|144843 pfam01400, Astacin, Astacin (Peptidase family M12A). The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis. Members of this family contain two conserved disulphide bridges, these are joined 1-4 and 2-3. Members of this family have an amino terminal propeptide which is cleaved to give the active protease domain. All other linked domains are found to the carboxyl terminus of this domain. This family includes: Astacin, a digestive enzyme from Crayfish. Meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain. Proteins involved in morphogenesis, and Tolloid from drosophila. Length = 192 Score = 30.7 bits (70), Expect = 1.3 Identities = 21/100 (21%), Positives = 36/100 (36%), Gaps = 25/100 (25%) Query: 45 TELNPNAQEVARWALGEWSKVVDLTFEE--TSIHSDIKFISSNNGYVCTPRYDSRYFMEI 102 + A+ + R A+ W + + F ++ ++ F +G C Sbjct: 14 SSFTGLARALIRQAMRHWEQKTCIRFVPRTSAPDNNYLFFFKGDG--CY----------- 60 Query: 103 NFDKADVWRYG------IGKGTILSHNALHEIGHALGLMH 136 + V R G +G G +HE+GHALG H Sbjct: 61 ----SYVGRNGGAQPVSLGNGCDKFGIIVHELGHALGFWH 96 >gnl|CDD|32437 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]. Length = 436 Score = 30.6 bits (69), Expect = 1.6 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 15/91 (16%) Query: 492 YDDLRNVFGSDRGA---AARHYITHGVKEGRNPDAFKALEYIA------SHEDLINAFAD 542 YD + + S RG+ AA +Y+ ++ G +P YIA + ED+ A + Sbjct: 250 YDLISALHKSVRGSDPDAALYYLARMIEAGEDP------LYIARRLVRIASEDIGLADPN 303 Query: 543 APDLVQAGKDHFSNFGYEEGRSITFNPDLYL 573 A + A D G E R +YL Sbjct: 304 ALQVAVAALDAVERLGSPEARIALAQAVVYL 334 >gnl|CDD|58574 cd04273, ZnMc_ADAMTS_like, Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.. Length = 207 Score = 29.8 bits (67), Expect = 2.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 126 HEIGHALGLMHPGSYNG 142 HE+GH LG+ H G N Sbjct: 146 HELGHVLGMPHDGDGNS 162 >gnl|CDD|38905 KOG3701, KOG3701, KOG3701, TGFbeta receptor signaling protein SMAD and related proteins [Signal transduction mechanisms, Transcription]. Length = 411 Score = 29.6 bits (66), Expect = 3.1 Identities = 15/65 (23%), Positives = 25/65 (38%) Query: 273 GSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANE 332 DV + N ++ F S N + LDT P Y K++ FE A + + + Sbjct: 291 SYENGDVWLYNLSDYPIFVQSPNLNYPNGRTLDTVHKVPPGYSIKVFDFEFAQQLPTSAD 350 Query: 333 HKQDF 337 + Sbjct: 351 PGFES 355 >gnl|CDD|35898 KOG0679, KOG0679, KOG0679, Actin-related protein - Arp4p/Act3p [Cytoskeleton]. Length = 426 Score = 28.7 bits (64), Expect = 5.0 Identities = 11/54 (20%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 336 DFLSDVERLRFADQCIDSV---NVKQRSILEYTASYEDLIQVIGQDVFESMKHF 386 DFL+D R + I+ + N+ + + +++V D+ ES ++ Sbjct: 189 DFLNDQCRQLLEPKNIEIIPMYNIASKEPVREGYPANAVLRVSIPDLTESYHNY 242 >gnl|CDD|35324 KOG0101, KOG0101, KOG0101, Molecular chaperones HSP70/HSC70, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones]. Length = 620 Score = 28.5 bits (63), Expect = 5.8 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 8/72 (11%) Query: 243 IDLNTESWSSIGGYEKN------MTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGND 296 IDL T ++S +G Y+ T SVV + + +IG++A N + N Sbjct: 12 IDLGT-TYSCVGVYQSGKVEIIANDQGNRT-TPSVVAFTDTERLIGDAAKNQVARNPDNT 69 Query: 297 VFDGSSGLDTFF 308 VFD + FF Sbjct: 70 VFDAKRLIGRFF 81 >gnl|CDD|38147 KOG2936, KOG2936, KOG2936, Uncharacterized conserved protein [Function unknown]. Length = 301 Score = 28.4 bits (63), Expect = 6.9 Identities = 11/45 (24%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Query: 45 TELNPNAQEVARWALGEWSK----VVDLTFEETSIHSDIKFISSN 85 EL N + V +W L W + LTF E+ + ++ Sbjct: 228 LELEKNKKIVMKWRLKSWPDGHDATITLTFYESQGETKLQVKQKG 272 >gnl|CDD|111944 pfam03104, DNA_pol_B_exo, DNA polymerase family B, exonuclease domain. This domain has 3' to 5' exonuclease activity and adopts a ribonuclease H type fold. Length = 254 Score = 28.1 bits (63), Expect = 7.2 Identities = 10/39 (25%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Query: 7 VYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRL-SFDI 44 ++ +E+ LLR + + +Y PD++T + +FD Sbjct: 147 IFPSEK---ELLRR--FFEFIRQYDPDIITGYNGDNFDW 180 >gnl|CDD|145911 pfam03013, Pyr_excise, Pyrimidine dimer DNA glycosylase. Pyrimidine dimer DNA glycosylases excise pyrimidine dimers by hydrolysis of the glycosylic bond of the 5' pyrimidine, followed by the intra-pyrimidine phosphodiester bond. Pyrimidine dimers are the major UV-lesions of DNA. Length = 121 Score = 28.4 bits (64), Expect = 7.3 Identities = 6/17 (35%), Positives = 10/17 (58%) Query: 304 LDTFFYYAPSYLYKIYR 320 + FFYY YL++ + Sbjct: 42 VVYFFYYKLYYLFQRHL 58 >gnl|CDD|58575 cd04275, ZnMc_pappalysin_like, Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.. Length = 225 Score = 28.4 bits (63), Expect = 7.3 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Query: 120 LSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYEND 156 L A HE+GH LGL H ++ GG P DY D Sbjct: 137 LGDTATHEVGHWLGLYH--TFQGGSPCCT-TGDYVAD 170 >gnl|CDD|153372 cd07359, PCA_45_Doxase_B_like, Subunit B of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and simlar enzymes. This subfamily of class III extradiol dioxygenases consists of a number of proteins with known enzymatic activities: Protocatechuate (PCA) 4,5-dioxygenase (LigAB), 2,3-dihydroxyphenylpropionate 1,2-dioxygenase (MhpB), 3-O-Methylgallate Dioxygenase, 2-aminophenol 1,6-dioxygenase, as well as proteins without any known enzymatic activity. These proteins play essential roles in the degradation of aromatic compounds by catalyzing the incorporation of both atoms of molecular oxygen into their preferred substrates. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B. Length = 271 Score = 28.0 bits (63), Expect = 8.9 Identities = 26/83 (31%), Positives = 33/83 (39%), Gaps = 13/83 (15%) Query: 459 APD-LVQVGKDHFSNFGCEEGRFVTF-----DSYL--YLGSYDDLRNVFGSDRGAAARHY 510 PD +V VG DHF+NF F DSY G R D ARH Sbjct: 44 RPDVVVVVGNDHFTNFF--LDNMPAFAIGIADSYEGPDEGWLGIPRAPVPGDA-DLARHL 100 Query: 511 ITHGVKEGRNPDAFKALEYIASH 533 + V++G + AF + E H Sbjct: 101 LAGLVEDGFDV-AF-SYELRLDH 121 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.137 0.412 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 8,454,851 Number of extensions: 470110 Number of successful extensions: 1056 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1044 Number of HSP's successfully gapped: 38 Length of query: 665 Length of database: 6,263,737 Length adjustment: 100 Effective length of query: 565 Effective length of database: 4,102,837 Effective search space: 2318102905 Effective search space used: 2318102905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 61 (27.3 bits)