RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780384|ref|YP_003064797.1| serralysin [Candidatus Liberibacter asiaticus str. psy62] (665 letters) >gnl|CDD|117125 pfam08548, Peptidase_M10_C, Peptidase M10 serralysin C terminal. Serralysins are peptidases related to mammalian matrix metallopeptidases (MMPs). The peptidase unit is found at the N terminal while this domain at the C terminal forms a corkscrew and is thought to be important for secretion of the protein through the bacterial cell wall. This domain contains the calcium ion binding domain pfam00353. Length = 220 Score = 71.2 bits (175), Expect = 7e-13 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 12/108 (11%) Query: 216 SPFIQTIYDSGGDDLLDLTLIGGVKNY-IDLNTESWSSIGGYEKNMTIAQHTVIESVVGS 274 I +++D+GG+D D + G +N I+LN S+S +GG + N++IA IE+ +G Sbjct: 30 DKLIFSVWDAGGNDTFDFS--GFSQNQRINLNEGSFSDVGGLKGNVSIAAGVTIENAIGG 87 Query: 275 SGNDVVIGNSANNVFFESSGNDV---------FDGSSGLDTFFYYAPS 313 SGND++IGN A N+ +GND+ G +G DTF Y A S Sbjct: 88 SGNDLLIGNDAANILKGGAGNDIIYGGGGADQLWGGAGKDTFVYGAAS 135 >gnl|CDD|128531 smart00235, ZnMc, Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site. Length = 140 Score = 50.0 bits (120), Expect = 2e-06 Identities = 35/121 (28%), Positives = 50/121 (41%), Gaps = 20/121 (16%) Query: 23 WSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIK-- 80 W + Y V+ + LS + +E A EWS V L F E + +DI Sbjct: 5 WPKGTVPY---VIDSSSLSPE------EVREAIARAFAEWSDVTCLRFVERTSTADIYIS 55 Query: 81 FISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSY 140 F + CT + R + +F +G G I + A HE+GHALGL H S Sbjct: 56 FGKGDGSG-CTLSHAGRPGGDQHFS--------LGNGCINTGVAAHELGHALGLYHEQSR 106 Query: 141 N 141 + Sbjct: 107 S 107 >gnl|CDD|152431 pfam11996, DUF3491, Protein of unknown function (DUF3491). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 286 to 3225 amino acids in length. This protein is found associated with pfam04488. This protein is found associated with pfam04488. Length = 934 Score = 31.6 bits (72), Expect = 0.63 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Query: 255 GYE-KNMTIAQHTVIESVVGSS-GNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAP 312 G E K + I Q ++VGSS G D + GN + F+ SSG SG +Y+ P Sbjct: 117 GTEIKVLKITQ-KGFNTIVGSSEGYDTLTGNK-DTKFYLSSGGGTI--YSGGGKNWYHIP 172 Query: 313 S 313 Sbjct: 173 K 173 >gnl|CDD|152479 pfam12044, Metallopep, Putative peptidase family. This family of proteins is functionally uncharacterized. However, it does contain an HEXXH motif characteristic of metallopeptidases. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 625 to 773 amino acids in length. Length = 419 Score = 31.2 bits (71), Expect = 0.80 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Query: 125 LHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLT 160 LHEIGH GL H +G + D N SF T Sbjct: 318 LHEIGHLFGLPH--QEDG---IMLRGYDTLNRSFTT 348 >gnl|CDD|185272 PRK15374, PRK15374, pathogenicity island 1 effector protein SipB; Provisional. Length = 593 Score = 31.1 bits (70), Expect = 0.94 Identities = 27/117 (23%), Positives = 47/117 (40%), Gaps = 13/117 (11%) Query: 181 ATPMVSDIVAVQKIYGAPKGSLGNNIYKI--EVQQKDSPFIQTIYDSGGDDLLDLTLIGG 238 A MV+ IV V + LGN + K+ E +K P + G L G Sbjct: 416 AIAMVAVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKL----FTQG 471 Query: 239 VKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGN 295 ++ + S +G M + + + + +VG++ N V +G N +S+G Sbjct: 472 MQR---IT----SGLGNVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGG 521 >gnl|CDD|171440 PRK12365, PRK12365, ribonucleotide-diphosphate reductase subunit alpha; Provisional. Length = 1046 Score = 30.7 bits (69), Expect = 1.2 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 4/72 (5%) Query: 519 RNPD-AFKALEYIAS--HEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTS 575 + PD AF A E + +++ + DL +A KDHF + EG + NP+L Sbjct: 304 KEPDYAFVAAELLLDVVYKEALGKSKYDEDLEEAHKDHFKRY-ILEGDTYRLNPELKHYD 362 Query: 576 YDDLWNVFGSDR 587 D L R Sbjct: 363 LDALAEALDLSR 374 >gnl|CDD|179643 PRK03759, PRK03759, isopentenyl-diphosphate delta-isomerase; Provisional. Length = 184 Score = 29.2 bits (66), Expect = 3.4 Identities = 5/24 (20%), Positives = 11/24 (45%) Query: 45 TELNPNAQEVARWALGEWSKVVDL 68 + L PN EV + + + ++ Sbjct: 129 SALQPNPDEVMDYQWVDPADLLRA 152 >gnl|CDD|132281 TIGR03237, dnd_assoc_2, dnd system-associated protein 2. cereus E33L, Hahella chejuensis KCTC 2396, and Pseudoalteromonas haloplanktis TAC12. Length = 1256 Score = 29.1 bits (65), Expect = 4.1 Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 476 EEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAAR 508 EEG+ FD++ + SYDD + F ++GAA + Sbjct: 778 EEGQDTAFDNFARMASYDDFKTKFNLNKGAAQQ 810 Score = 28.3 bits (63), Expect = 5.9 Identities = 13/32 (40%), Positives = 21/32 (65%) Query: 393 EGRDITFDSYLYLGSYDDLRNVFGSDRGAAAR 424 EG+D FD++ + SYDD + F ++GAA + Sbjct: 779 EGQDTAFDNFARMASYDDFKTKFNLNKGAAQQ 810 >gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed. Length = 421 Score = 28.5 bits (63), Expect = 4.9 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Query: 580 WNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKA 626 W + +A+ + + G+ EG+ L + GM S M L E++ D Sbjct: 210 WELSADRANASRRELLAGGLDEGKILRVVGM--ASTMRLKEQASDDP 254 >gnl|CDD|177898 PLN02256, PLN02256, arogenate dehydrogenase. Length = 304 Score = 28.5 bits (64), Expect = 5.4 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Query: 586 DRSAAAQHYITHGMKEGRALGISGMQ--------FKSVMNLSEK-SRDKADL 628 DR AA +ITH + GR LG ++ +++++ L E S D DL Sbjct: 208 DRYAAGSQFITHTV--GRILGKMELESTPINTKGYETLLRLVENTSSDSFDL 257 >gnl|CDD|184622 PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional. Length = 444 Score = 28.6 bits (65), Expect = 5.9 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 12/36 (33%) Query: 529 YIASH-----EDLINAFADAPDL-------VQAGKD 552 Y SH +DLI A+AD P L VQ+G D Sbjct: 236 YTTSHPRDFTDDLIEAYADLPKLVPFLHLPVQSGSD 271 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.137 0.412 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 11,288,225 Number of extensions: 756174 Number of successful extensions: 1328 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1323 Number of HSP's successfully gapped: 22 Length of query: 665 Length of database: 5,994,473 Length adjustment: 100 Effective length of query: 565 Effective length of database: 3,833,673 Effective search space: 2166025245 Effective search space used: 2166025245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 60 (27.2 bits)