254780386

254780386

Type I secretion membrane fusion protein, HlyD

GeneID in NCBI database:8209371Locus tag:CLIBASIA_01355
Protein GI in NCBI database:254780386Protein Accession:YP_003064799.1
Gene range:+(284258, 285580)Protein Length:440aa
Gene description:Type I secretion membrane fusion protein, HlyD
COG prediction:[M] Membrane-fusion protein
KEGG prediction:type I secretion membrane fusion protein, HlyD; K02022
SEED prediction:Alkaline protease secretion protein AprE
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccEEEEEcccccEEEEEEcccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEcccccEEEEEEEcccccccccccEEEEEEEcccEEEEEEEEcHHHHHHcccccEEEEEEEccccccccEEEEEEEEEEccccccccccccccEEEEEEEEccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHcc
cccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccEEEEcccEEEEEcccccEEEEEEEEcccEEccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEEEEEccccEEcccccEEEEEcccccEEEEEEEcHcHHHHccccccEEEEEEEccccccccEEEEEEEEcccccccccccccccEEEEEEEEcHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHcc
mhhfmwknlkrnhpaslKRMTLLSIIGIIGLITWSILLPIEisvsssgeilnednvveikspfsGIIKKFQVengsqilqgtplltfediettdlidLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKnavsqndlnqqeRIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREqktilspiagtivynqsfsssnyaqqsqplmkivphskltyirakvtpkqiqhvkkgytatvrfphyaDIREKKFKAIIEKIDPiisqqdnnlqtQEYYEVILKITdlafsdnnielrngfpaevlFTAKNTTLAQEIIhpitdnwpkifer
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRChidteksaldflNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKnavsqndlnqqERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAkvtpkqiqhvkkgytatvrfphyaDIREKKFKAIIEKIdpiisqqdnnlQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTlaqeiihpitdnwpkifer
MHHFMWKNLKRNHPASLKRMtllsiigiiglitwsillPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
*************PASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESR****LDFL*KYHSTCS*V**********************************************LTMMKNLFEKNAVSQNDLNQQ*******************************************************************REQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKI**********ELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENxxxxxxxxxxxxxxxxxxxxxFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER
MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTTLAQEIIHPITDNWPKIFER

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
315122201441 Type I secretion membrane fusion protein, HlyD [Candida 1 1e-174
307544060449 mandelate racemase [Halomonas elongata DSM 2581] Length 1 2e-17
152991144428 type I secretion system membrane fusion protein [Nitrat 1 2e-16
87198270446 Type I secretion membrane fusion protein, HlyD [Novosph 1 3e-15
300113968455 HlyD family type I secretion membrane fusion protein [N 1 1e-14
326388175449 Type I secretion membrane fusion protein, HlyD [Novosph 1 5e-14
104783706446 heme acquisition transporter, membrane fusion protein H 1 9e-14
330445560439 type I secretion membrane fusion, HlyD family protein [ 1 1e-13
190890292481 protein secretion protein, HlyD family [Rhizobium etli 1 7e-13
327191612481 putative protein secretion protein, HlyD family [Rhizob 1 8e-13
>gi|315122201|ref|YP_004062690.1| Type I secretion membrane fusion protein, HlyD [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 441 Back     alignment and organism information
 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 306/441 (69%), Positives = 363/441 (82%), Gaps = 1/441 (0%)

Query: 1   MHHFMWKNLKRNHPASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIK 60
           M++  WKN K++H  +L +  +LS IGI+GLI WSILLPIEI VSS GEIL ++++VEIK
Sbjct: 1   MYNIFWKNFKKHHLTTLAKTIILSTIGIVGLIIWSILLPIEIRVSSLGEILYDNDIVEIK 60

Query: 61  SPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFL 120
           SPFSGII KFQV NG+Q+LQG PLLTFED ET DL++LKK SI +L+C IDT  SAL+FL
Sbjct: 61  SPFSGIINKFQVNNGAQVLQGDPLLTFEDTETNDLLNLKKSSITDLKCRIDTANSALNFL 120

Query: 121 NNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLD 180
           N+KYDV+++AF+ R+EQLLDFL  Y  TCSKVFNY IS +YRSLK+KLTR  ++Y N LD
Sbjct: 121 NSKYDVIKRAFDIRDEQLLDFLRNYPPTCSKVFNYEISKLYRSLKLKLTRTHNLYSNYLD 180

Query: 181 LENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNM 240
           LE+K SL   LL SH+KDLT+ KNLF+ N VS+N+LNQQER+V+KS LEL  +++ QK M
Sbjct: 181 LEDKISLSNMLLLSHKKDLTITKNLFKDNVVSKNELNQQERVVHKSALELTTDLNAQKAM 240

Query: 241 LRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTI 300
           LRHINELYDEAN+EFANYLK+ISRDL+ NQRT  DE+SK TILEK   Q TILSPI GTI
Sbjct: 241 LRHINELYDEANVEFANYLKDISRDLDHNQRTLIDEISKATILEKKISQHTILSPIMGTI 300

Query: 301 VYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIRE 360
           VYNQSFSSSNY Q+SQ LMKIVP   LT+IRAKV P+QIQ VK G  ATVRFPHY DIRE
Sbjct: 301 VYNQSFSSSNYIQESQLLMKIVPRCDLTHIRAKVAPQQIQSVKNGQIATVRFPHYPDIRE 360

Query: 361 KKFKAIIEKIDPIISQQDNN-LQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKN 419
           KKFKAIIE I+PIISQ++N+  QTQ YYEVILKI D A+ DN IELRNG+ AE+LFTA+ 
Sbjct: 361 KKFKAIIETINPIISQRNNDSSQTQNYYEVILKIIDPAYFDNKIELRNGYLAEILFTAEY 420

Query: 420 TTLAQEIIHPITDNWPKIFER 440
           TTLA+EII PIT+NWPKIFER
Sbjct: 421 TTLAKEIIRPITNNWPKIFER 441



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307544060|ref|YP_003896539.1| mandelate racemase [Halomonas elongata DSM 2581] Length = 449 Back     alignment and organism information
>gi|152991144|ref|YP_001356866.1| type I secretion system membrane fusion protein [Nitratiruptor sp. SB155-2] Length = 428 Back     alignment and organism information
>gi|87198270|ref|YP_495527.1| Type I secretion membrane fusion protein, HlyD [Novosphingobium aromaticivorans DSM 12444] Length = 446 Back     alignment and organism information
>gi|300113968|ref|YP_003760543.1| HlyD family type I secretion membrane fusion protein [Nitrosococcus watsonii C-113] Length = 455 Back     alignment and organism information
>gi|326388175|ref|ZP_08209778.1| Type I secretion membrane fusion protein, HlyD [Novosphingobium nitrogenifigens DSM 19370] Length = 449 Back     alignment and organism information
>gi|104783706|ref|YP_610204.1| heme acquisition transporter, membrane fusion protein HasE [Pseudomonas entomophila L48] Length = 446 Back     alignment and organism information
>gi|330445560|ref|ZP_08309212.1| type I secretion membrane fusion, HlyD family protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 439 Back     alignment and organism information
>gi|190890292|ref|YP_001976834.1| protein secretion protein, HlyD family [Rhizobium etli CIAT 652] Length = 481 Back     alignment and organism information
>gi|327191612|gb|EGE58624.1| putative protein secretion protein, HlyD family [Rhizobium etli CNPAF512] Length = 481 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
TIGR01843423 TIGR01843, type_I_hlyD, type I secretion membrane fusio 2e-25
TIGR01730322 TIGR01730, RND_mfp, RND family efflux transporter, MFP 5e-05
COG1566352 COG1566, EmrA, Multidrug resistance efflux pump [Defens 8e-07
TIGR03794421 TIGR03794, NHPM_micro_HlyD, NHPM bacteriocin system sec 2e-04
pfam00529304 pfam00529, HlyD, HlyD family secretion protein 3e-04
TIGR02971327 TIGR02971, heterocyst_DevB, ABC exporter membrane fusio 0.001
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|162505 TIGR01730, RND_mfp, RND family efflux transporter, MFP subunit Back     alignment and domain information
>gnl|CDD|31754 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163506 TIGR03794, NHPM_micro_HlyD, NHPM bacteriocin system secretion protein Back     alignment and domain information
>gnl|CDD|109580 pfam00529, HlyD, HlyD family secretion protein Back     alignment and domain information
>gnl|CDD|132016 TIGR02971, heterocyst_DevB, ABC exporter membrane fusion protein, DevB family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 440 Type I secretion membrane fusion protein, HlyD [Candida
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 100.0
PRK03598331 hypothetical protein; Provisional 100.0
TIGR01000476 bacteriocin_acc bacteriocin secretion accessory protein 100.0
PRK10476348 multidrug resistance protein MdtN; Provisional 100.0
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 100.0
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 100.0
PRK11556415 multidrug efflux system subunit MdtA; Provisional 99.98
PRK11578347 macrolide transporter subunit MacA; Provisional 99.97
COG1566352 EmrA Multidrug resistance efflux pump [Defense mechanis 100.0
PRK09859385 multidrug efflux system protein MdtE; Provisional 99.95
PRK09578385 periplasmic multidrug efflux lipoprotein precursor; Rev 99.95
TIGR02971363 heterocyst_DevB ABC exporter membrane fusion protein, D 99.95
TIGR01730333 RND_mfp efflux transporter, RND family, MFP subunit; In 99.38
PRK09783407 copper/silver efflux system membrane fusion protein Cus 99.93
TIGR00999284 8a0102 Membrane Fusion Protein cluster 2 protein; Inter 99.75
pfam00529304 HlyD HlyD family secretion protein. 95.92
COG0845372 AcrA Membrane-fusion protein [Cell envelope biogenesis, 95.1
TIGR00717 534 rpsA ribosomal protein S1; InterPro: IPR000110 Ribosome 90.04
COG0845372 AcrA Membrane-fusion protein [Cell envelope biogenesis, 99.74
pfam00529304 HlyD HlyD family secretion protein. 99.59
PRK0705180 hypothetical protein; Validated 97.26
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 97.09
pfam06898383 YqfD Putative stage IV sporulation protein YqfD. This f 96.93
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 96.88
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 96.86
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 96.85
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 96.83
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 96.83
KOG0559457 consensus 96.79
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 96.51
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 96.43
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.42
TIGR02876406 spore_yqfD sporulation protein YqfD; InterPro: IPR01069 96.28
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 96.25
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 96.18
PRK05704406 dihydrolipoamide succinyltransferase; Validated 96.18
TIGR01347435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 96.17
PRK11855 549 dihydrolipoamide acetyltransferase; Reviewed 96.05
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 96.03
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 95.99
PRK11854 630 aceF dihydrolipoamide acetyltransferase; Validated 95.58
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 95.52
PRK09783407 copper/silver efflux system membrane fusion protein Cus 95.49
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 95.1
PRK11854630 aceF dihydrolipoamide acetyltransferase; Validated 95.07
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 94.96
PRK03598331 hypothetical protein; Provisional 94.63
TIGR00830129 PTBA PTS system, glucose subfamily, IIA component; Inte 93.97
PRK11637404 hypothetical protein; Provisional 97.53
COG0539541 RpsA Ribosomal protein S1 [Translation, ribosomal struc 90.61
PRK10476348 multidrug resistance protein MdtN; Provisional 97.51
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 95.11
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 97.32
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 97.0
PRK129991147 pyruvate carboxylase; Reviewed 96.99
PRK09282580 pyruvate carboxylase subunit B; Validated 96.98
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.96
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.88
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 96.86
PRK09824625 beta-glucoside-specific PTS system components IIABC; Pr 96.84
COG4942420 Membrane-bound metallopeptidase [Cell division and chro 96.83
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 96.8
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 96.6
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier protein 96.55
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 96.48
TIGR012351169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 96.15
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 96.07
PRK10255648 N-acetyl glucosamine specific PTS system components IIA 96.0
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 95.98
COG10381149 PycA Pyruvate carboxylase [Energy production and conver 95.95
PRK09439169 glucose-specific PTS system component; Provisional 95.86
TIGR01995660 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIA 95.12
COG3608331 Predicted deacylase [General function prediction only] 95.03
KOG0238670 consensus 94.71
KOG03691176 consensus 94.66
pfam00358133 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphot 94.56
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the Succ 94.34
PRK0705180 hypothetical protein; Validated 93.64
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 92.85
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterized sub 92.41
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterized sub 92.14
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterized sub 91.95
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterized sub 91.62
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterized sub 90.97
TIGR03007510 pepcterm_ChnLen polysaccharide chain length determinant 96.69
PRK09510402 tolA cell envelope integrity inner membrane protein Tol 94.98
TIGR021691202 SMC_prok_A chromosome segregation protein SMC; InterPro 96.07
PRK11637404 hypothetical protein; Provisional 94.95
TIGR02063 755 RNase_R ribonuclease R; InterPro: IPR011805 This family 91.58
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 95.45
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 95.41
PRK05704406 dihydrolipoamide succinyltransferase; Validated 95.29
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 95.14
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 94.91
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 94.81
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 94.81
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specif 94.7
TIGR01349 584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 94.62
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 94.55
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 92.18
pfam05896257 NQRA Na(+)-translocating NADH-quinone reductase subunit 91.83
COG2190156 NagE Phosphotransferase system IIA components [Carbohyd 91.6
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 91.54
TIGR01347435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 90.37
TIGR02168 1191 SMC_prok_B chromosome segregation protein SMC; InterPro 94.13
KOG0161 1930 consensus 91.01
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 94.07
pfam07888546 CALCOCO1 Calcium binding and coiled-coil domain (CALCOC 90.49
PRK09039343 hypothetical protein; Validated 94.05
pfam09726680 Macoilin Transmembrane protein. This entry is a highly 91.55
PRK09039343 hypothetical protein; Validated 90.26
COG1566352 EmrA Multidrug resistance efflux pump [Defense mechanis 91.98
KOG1029 1118 consensus 91.24
PRK11642813 exoribonuclease R; Provisional 90.98
pfam0155196 Peptidase_M23 Peptidase family M23. Members of this fam 90.02
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein; InterPro: IPR005696 Bacteriocins are antibacterial proteinaceous compounds produced by bacteria Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family; InterPro: IPR014315 Members of this protein are found mostly in the Cyanobacteria, but also in the Planctomycetes Back     alignment and domain information
>TIGR01730 RND_mfp efflux transporter, RND family, MFP subunit; InterPro: IPR006143 Gram-negative bacteria produce a number of proteins which are secreted into the growth medium by a mechanism that does not require a cleaved N-terminal signal sequence Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 protein; InterPro: IPR005695 Gram-negative bacteria have evolved transport complexes that export macromolecules and toxic substances such as heavy metals across the two membranes of the cell envelope in a single energy coupled step Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00717 rpsA ribosomal protein S1; InterPro: IPR000110 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>pfam06898 YqfD Putative stage IV sporulation protein YqfD Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK09824 beta-glucoside-specific PTS system components IIABC; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK10255 N-acetyl glucosamine specific PTS system components IIABC; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK09439 glucose-specific PTS system component; Provisional Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component; InterPro: IPR011297 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) , is a major carbohydrate transport system in bacteria Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>pfam00358 PTS_EIIA_1 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345 Members of this entry belong to the family of polysaccharide chain length determinant proteins Back     alignment and domain information
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02063 RNase_R ribonuclease R; InterPro: IPR011805 This family consists of an exoribonuclease, ribonuclease R, also called VacB Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>KOG0161 consensus Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>pfam07888 CALCOCO1 Calcium binding and coiled-coil domain (CALCOCO1) like Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>pfam09726 Macoilin Transmembrane protein Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>KOG1029 consensus Back     alignment and domain information
>PRK11642 exoribonuclease R; Provisional Back     alignment and domain information
>pfam01551 Peptidase_M23 Peptidase family M23 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
3lnn_A359 Crystal Structure Of Zneb From Cupriavidus Metallid 1e-06
3fpp_A341 Crystal Structure Of E.Coli Maca Length = 341 4e-04
>gi|299856759|pdb|3LNN|A Chain A, Crystal Structure Of Zneb From Cupriavidus Metallidurans Length = 359 Back     alignment and structure 
 Score = 59.0 bits (140), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 35/104 (33%), Gaps = 15/104 (14%)

Query: 311 YAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKI 370
           Y   +   +  V      ++ A    K + HV  G +ATV+F  Y D +       +  +
Sbjct: 191 YWNDTTASLMTVADLSHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQ----PGKVRYV 246

Query: 371 DPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVL 414
             I+       + +  +            + +  LR G  A+  
Sbjct: 247 GQILDADTRTTKVRMVF-----------DNPDGRLRPGMFAQAT 279
>gi|228312097|pdb|3FPP|A Chain A, Crystal Structure Of E.Coli Maca Length = 341 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target440 Type I secretion membrane fusion protein, HlyD [Candida
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 3e-05
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric assem 2e-04
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, beta 3e-04
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 6e-04
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 7e-04
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Length = 359 Back     alignment and structure
 Score = 45.2 bits (106), Expect = 3e-05
 Identities = 12/62 (19%), Positives = 24/62 (38%), Gaps = 4/62 (6%)

Query: 39 PIEISVSSSGEI-LNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLID 97
           +    +    I  +   +V++  P +G I     + G ++  G  L T   I++ DL  
Sbjct: 39 TVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVLFT---IDSADLAQ 95

Query: 98 LK 99
            
Sbjct: 96 AN 97
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Length = 341 Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Length = 369 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli} Length = 277 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target440 Type I secretion membrane fusion protein, HlyD [Candida
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric assem 99.92
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 99.91
3h9i_A407 Cation efflux system protein CUSB; three-helix bundle, 99.92
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 99.92
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, beta 99.68
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 97.24
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 97.21
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 97.14
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 97.08
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 97.05
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 96.99
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 96.79
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 96.78
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 96.75
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 96.68
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 96.65
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 96.27
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 96.19
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 96.06
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 95.54
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 95.48
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 95.42
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 95.37
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 93.72
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 93.48
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 93.18
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 93.03
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 91.29
3h9i_A407 Cation efflux system protein CUSB; three-helix bundle, 90.15
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 90.03
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 99.4
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 97.07
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 97.03
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 96.94
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 96.94
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 96.91
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 96.89
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 96.8
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 96.68
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 96.44
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 96.42
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 96.4
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 95.68
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 95.57
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 94.74
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 94.64
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 94.6
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 94.11
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 93.87
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 93.55
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 92.85
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, myosi 97.35
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome inacti 97.02
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 96.41
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 96.35
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 96.26
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 93.08
2gpr_A154 Glucose-permease IIA component; phosphotransferase, enz 95.69
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phosphotrans 95.38
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransferase 94.22
3c9i_A242 Tail needle protein GP26; xenon, coiled-coil, protein f 90.41
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 94.94
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 94.88
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich fold 94.46
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clotting; 94.01
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rings, f 93.73
1m1j_B464 Fibrinogen beta chain; coiled coils, disulfide rings, f 93.27
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich fold 93.08
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 94.77
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 94.71
1zy8_K229 Pyruvate dehydrogenase protein X component, mitochondri 93.8
1m1j_A491 Fibrinogen alpha subunit; coiled coils, disulfide rings 94.64
1m1j_A491 Fibrinogen alpha subunit; coiled coils, disulfide rings 92.72
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin 92.55
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
Probab=99.92  E-value=2.7e-24  Score=178.97  Aligned_cols=259  Identities=15%  Similarity=0.236  Sum_probs=164.2

Q ss_pred             EEEEEEEEEEEEEEEECCCEEEEECCCCCEEEEEECCCCCEEECCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             06712589997999953873898468886899998578989336978999964899888999874343323321001233
Q gi|254780386|r   37 LLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSA  116 (440)
Q Consensus        37 ~~~~~~~v~~~G~i~~~~~~~~I~s~~~G~V~~i~VkeGd~VkkGq~L~~ld~~~~~~~l~~~~~~l~~l~~~l~~~~~~  116 (440)
                      -..+..++.++|+|.|.... .|.++.+|+|.+++|++||.|++||+|++||+.+....+.+.+..+..++++++..+..
T Consensus        13 ~g~i~~tv~~~G~v~~~~~~-~v~a~~~G~V~~v~v~~G~~V~~G~~L~~id~~~~~~~~~~~~a~~~~~~~~l~~a~~~   91 (341)
T 3fpp_A           13 PGDLQQSVLATGKLDALRKV-DVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAE   91 (341)
T ss_dssp             CCCCCCEEEEEEEEEESSEE-ECCCSSCEEEEEECCCTTCEECTTCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEEEEEEEEEEEE-EEECCCCEEEEEEECCCCCEECCCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98724999999999980899-99844778999999899199889998999881999999999999898876548999878


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             33222114555422356888877655467886543336554200112221122100223210112232222221023333
Q gi|254780386|r  117 LDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQ  196 (440)
Q Consensus       117 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~  196 (440)
                      ++.                                                                           .+
T Consensus        92 l~~---------------------------------------------------------------------------a~   96 (341)
T 3fpp_A           92 LKL---------------------------------------------------------------------------AR   96 (341)
T ss_dssp             HHH---------------------------------------------------------------------------HT
T ss_pred             HHH---------------------------------------------------------------------------HH
T ss_conf             887---------------------------------------------------------------------------44


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22210122222211100001110024666531012233222222222221000122333211233222122222222122
Q gi|254780386|r  197 KDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADE  276 (440)
Q Consensus       197 ~el~~~~~l~~~~~~~~~~l~~~~~~~~~~~~el~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~~~~l~e~~~~l~~~  276 (440)
                      .++...+.+...+..++.++.............+..                                    ....+...
T Consensus        97 ~~~~r~~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~------------------------------------~~~~l~~~  140 (341)
T 3fpp_A           97 VTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGT------------------------------------IDAQIKRN  140 (341)
T ss_dssp             HHHHHHHHHHHTSSSTTHHHHHHHHHHHHTHHHHHH------------------------------------HHHHHHHT
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHCCHHHHHHHH------------------------------------HHHHHHHH
T ss_conf             332012344203765266665554321023567888------------------------------------77799876


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEECCEEECCCCCCCC---CCCCCCCCCCCCCEEEEEEECHHHHHHCCCCCCEEEEEE
Q ss_conf             23322122222123455541168731212012221244---455421033556504775326223110158983179998
Q gi|254780386|r  277 MSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQ---SQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFP  353 (440)
Q Consensus       277 ~~~l~~l~~~l~~~~I~AP~~G~V~~l~~~~~G~~v~~---G~~l~~Ivp~~~~l~v~~~v~~~di~~i~~Gq~v~i~~~  353 (440)
                      ..........+.+..+.||++|.+..... ..|..+.+   +.++++|. +.+.+++.+.+++.++.++++|+.|.++++
T Consensus       141 ~~~~~~~~~~~~~~~i~a~~~~~~~~~~~-~~G~~v~~~~~~~~~~~i~-~~~~~~~~~~v~e~~~~~v~~g~~v~i~~~  218 (341)
T 3fpp_A          141 QASLDTAKTNLDYTRIVAPMAGEVTQITT-LQGQTVIAAQQAPNILTLA-DMSAMLVKAQVSEADVIHLKPGQKAWFTVL  218 (341)
T ss_dssp             HHHHTTTTTTTTSSEEECSSSEEEEEESS-CTTCEECCTTSCCCCEEEE-CCSEEEEEEECCGGGSTTCCTTCCCEECCS
T ss_pred             HHHHHHHHHCCCCEEEECCCCCEEEEEEE-CCCCEEECCCCCCEEEEEE-CCCCEEEEEEECHHHHHHHHCCCEEEEEEE
T ss_conf             66555555113550684686762778982-5798883378761478992-388537998658999997314753789870


Q ss_pred             ECCCCCCCEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEECHHHCCCCCCEECCCCEEEEEEEECEEE
Q ss_conf             12887544399999997133444677765511899999935011256785152377569999922054
Q gi|254780386|r  354 HYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAKNTT  421 (440)
Q Consensus       354 a~~~~~~~~~~G~V~~Is~~~~~~~~~~~~~~~y~v~i~~~~~~~~~~~~~L~~Gm~~~~~I~~~~~~  421 (440)
                      .++..   .+.|+|..|+|.+.....    ...|.+.+.++.     .+..++|||++++.|.++.+.
T Consensus       219 ~~~~~---~~~g~v~~i~~~~~~~~~----~~~~~~~~~~~~-----~~~~~~~G~~v~v~i~~~~~~  274 (341)
T 3fpp_A          219 GDQLT---RYEGQIKDVLPTPEKVND----AIFYYARFEVPN-----PNGLLRLDMTAQVHIQLTDVK  274 (341)
T ss_dssp             SSSSS---CBCCCEEEECSSCCBSSS----CBCCEEEEEEEC-----SSSCCCTTCEEEEEEESCCCC
T ss_pred             CCCEE---EEEEEEEEEECCEEECCC----EEEEEEEEEECC-----CCCCCCCCEEEEEEEEECCCC
T ss_conf             22101---211599999632230576----199999997259-----765555533899999935758
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.5A {Homo sapiens} Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.5A {Homo sapiens} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3dtp_B 3dtp_A Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>3c9i_A Tail needle protein GP26; xenon, coiled-coil, protein fiber, coiled coil, late protein, viral protein; 1.95A {Bacteriophage P22} PDB: 2poh_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, merlin, actin binding, masking, regulation, SELF-inhibition cell adhesion; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

IdentityAlignment graphLength Definition E-value
Target 440 Type I secretion membrane fusion protein, HlyD [Candida
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetylt 0.002
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Lipoyl domain of dihydrolipoamide acetyltransferase
species: Bacillus stearothermophilus [TaxId: 1422]

 Score = 37.8 bits (88), Expect = 0.002
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 48 GEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88
           E+ N+  VVEI SP  G + +  V  G+    G  L+T +
Sbjct: 36 CEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLD 76

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

IdentityAlignment graphLength Definition Probability
Target440 Type I secretion membrane fusion protein, HlyD [Candida
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomonas a 99.86
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escherichia 97.17
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase (TC 97.03
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferase {Az 96.96
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 96.84
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Es 96.68
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain alpha 96.62
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferase {Ne 96.04
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Ba 95.85
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferase {Hu 95.43
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 95.05
d1ci3m262 Cytochrome f, small domain {Phormidium laminosum [TaxId 91.52
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase (TC 96.93
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia coli 95.86
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma capric 95.78
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escherichia 95.7
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferase {Az 95.6
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferase {Hu 94.93
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus subtilis 94.71
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Ba 94.66
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain alpha 94.41
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 94.38
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferase {Es 93.84
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferase {Ne 93.54
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase compl 90.89
d2ix0a190 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} 94.22
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomonas a 93.38
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: HlyD-like secretion proteins
superfamily: HlyD-like secretion proteins
family: HlyD-like secretion proteins
domain: Multidrug resistance protein MexA domain
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.86  E-value=2.4e-22  Score=164.47  Aligned_cols=221  Identities=13%  Similarity=0.171  Sum_probs=143.2

Q ss_pred             EEEEEEEEEECCCEEEEECCCCCEEEEEECCCCCEEECCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             89997999953873898468886899998578989336978999964899888999874343323321001233332221
Q gi|254780386|r   43 SVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNN  122 (440)
Q Consensus        43 ~v~~~G~i~~~~~~~~I~s~~~G~V~~i~VkeGd~VkkGq~L~~ld~~~~~~~l~~~~~~l~~l~~~l~~~~~~l~~~~~  122 (440)
                      ++..+|.|.|.. ...|.|+++|+|.+++|++||.|+|||+|++||+.+....+...+.++..++++++..+        
T Consensus         3 ~~~~~G~i~a~~-~~~V~s~v~G~V~~v~V~~G~~VkkGq~L~~ld~~~~~~~l~~a~a~~~~a~~~~~r~~--------   73 (237)
T d1vf7a_           3 NTELPGRTNAFR-IAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYK--------   73 (237)
T ss_dssp             EEEEEEECEESC-EEEECCSSCEEEEECCSCSSEEECTTSEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHH--------
T ss_pred             EEEEEEEEEEEE-EEEEEEECCEEEEEEECCCCCEECCCCEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHH--------
T ss_conf             799889999637-99998216789999987994998899999998238877665333233333222123454--------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             14555422356888877655467886543336554200112221122100223210112232222221023333222101
Q gi|254780386|r  123 KYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMM  202 (440)
Q Consensus       123 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~el~~~  202 (440)
                                                                                                      
T Consensus        74 --------------------------------------------------------------------------------   73 (237)
T d1vf7a_          74 --------------------------------------------------------------------------------   73 (237)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211100001110024666531012233222222222221000122333211233222122222222122233221
Q gi|254780386|r  203 KNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTI  282 (440)
Q Consensus       203 ~~l~~~~~~~~~~l~~~~~~~~~~~~el~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~~~~l~e~~~~l~~~~~~l~~  282 (440)
                       .+.......+.++.                                                  ..+..+.....++..
T Consensus        74 -~l~~~~~~~~~~~~--------------------------------------------------~~~~~~~~a~~~l~~  102 (237)
T d1vf7a_          74 -LLVADQAVSKQQYA--------------------------------------------------DANAAYLQSKAAVEQ  102 (237)
T ss_dssp             -HHHHTTSSCHHHHH--------------------------------------------------HHHHHHHHHHHHHHH
T ss_pred             -HHHHCCCCCCCHHH--------------------------------------------------HHHHHCCHHHHHHHH
T ss_conf             -44430543220012--------------------------------------------------222200126889999


Q ss_pred             CCCCCCCCCCCCCCEEEEECCEEECCCCCCCCCCCCCCCC-CCCCCEEEEEEECHHHHHHCC-------------CCCCE
Q ss_conf             2222212345554116873121201222124445542103-355650477532622311015-------------89831
Q gi|254780386|r  283 LEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIV-PHSKLTYIRAKVTPKQIQHVK-------------KGYTA  348 (440)
Q Consensus       283 l~~~l~~~~I~AP~~G~V~~l~~~~~G~~v~~G~~l~~Iv-p~~~~l~v~~~v~~~di~~i~-------------~Gq~v  348 (440)
                      ++..+.++.|+||++|+|..... ..|.++.+|.....+. .+...+++.+..++.++..+.             .|..+
T Consensus       103 a~~~l~~~~i~ap~~G~v~~~~~-~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~v  181 (237)
T d1vf7a_         103 ARINLRYTKVLSPISGRIGRSAV-TEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKV  181 (237)
T ss_dssp             HHHHHHTTEEECSSSEEECCCSS-CBTCEECTTCSSCSEEEECCSEEECCEEEEHHHHHHHHHHHHHTSSCEEETTEEEC
T ss_pred             HHHHHCCCCCCCCHHCEEEEEEE-CCCCEECCCCCEEEEEEECCCCCEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCEE
T ss_conf             75322024210420001125772-04848737863245899338510244150388777776542134200025677347


Q ss_pred             EEEEEECCCCCCCEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEECHHHCCCCCCEECCCCEEEEEEEEC
Q ss_conf             7999812887544399999997133444677765511899999935011256785152377569999922
Q gi|254780386|r  349 TVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDNNIELRNGFPAEVLFTAK  418 (440)
Q Consensus       349 ~i~~~a~~~~~~~~~~G~V~~Is~~~~~~~~~~~~~~~y~v~i~~~~~~~~~~~~~L~~Gm~~~~~I~~~  418 (440)
                      .+.++..+   ...+.|+|..|++.....+      ..|.|++.+++     ++..|+|||.++|.|.+|
T Consensus       182 ~~~~~~~~---~~~~~g~v~~i~~~vd~~t------~t~~v~~~i~n-----~~~~L~pGm~v~v~i~~g  237 (237)
T d1vf7a_         182 SLKLEDGS---QYPLEGRLEFSEVSVDEGT------GSVTIRAVFPN-----PNNELLPGMFVHAQLQEG  237 (237)
T ss_dssp             CEECTTSC---EESSCCEEESSCSCCCSSS------SEEEECBEEEC-----SSSCCCTTCEEEEEEECC
T ss_pred             EEEECCCC---CCEEEEEEEEEECCCCCCC------CEEEEEEEEEC-----CCCCCCCCCEEEEEEECC
T ss_conf             88603788---7138899999846384888------48999999989-----999688999899999459
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against MMDB70 database

IdentityAlignment graphLength Definition E-value
Target 440 Type I secretion membrane fusion protein, HlyD [Ca
2ejm_A_99 (A:) Methylcrotonoyl-COA carboxylase subunit alpha 5e-05
2ejm_A_99 (A:) Methylcrotonoyl-COA carboxylase subunit alpha 0.002
1gjx_A_81 (A:) Pyruvate dehydrogenase; oxidoreductase, lipoy 1e-04
1k8m_A_93 (A:) E2 component of branched-chain ahpha-ketoacid 1e-04
2k7v_A_85 (A:) Dihydrolipoyllysine-residue acetyltransferase 1e-04
2qf7_A_1087-116579 (A:1087-1165) Pyruvate carboxylase protein; multi- 2e-04
1ghj_A_79 (A:) E2, E2, the dihydrolipoamide succinyltransfer 2e-04
1iyu_A_79 (A:) E2P, dihydrolipoamide acetyltransferase compo 2e-04
1z6h_A_72 (A:) Biotin/lipoyl attachment protein; solution st 2e-04
2jku_A_94 (A:) Propionyl-COA carboxylase alpha chain, mitoch 2e-04
3hbl_A_1069-115082 (A:1069-1150) Pyruvate carboxylase; TIM barrel, li 2e-04
3bg3_A_644-71875 (A:644-718) Pyruvate carboxylase, mitochondrial; T 3e-04
1pmr_A_80 (A:) Dihydrolipoyl succinyltransferase; 2-oxogluta 3e-04
1bdo_A_80 (A:) Acetyl-COA carboxylase; BCCPSC, carboxyl tran 4e-04
1qjo_A_80 (A:) Dihydrolipoamide acetyltransferase; lipoyl do 4e-04