RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780386|ref|YP_003064799.1| Type I secretion membrane fusion protein, HlyD [Candidatus Liberibacter asiaticus str. psy62] (440 letters) >gnl|CDD|31754 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms]. Length = 352 Score = 50.7 bits (121), Expect = 8e-07 Identities = 42/190 (22%), Positives = 74/190 (38%), Gaps = 17/190 (8%) Query: 188 LRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINEL 247 LRA L+S Q + + A QN+L ++ + + + E + + Sbjct: 110 LRAQLASAQALIAQAEAQDLDQA--QNELERRAELAQRGVVSREELDRARAALQAA---- 163 Query: 248 YDEANLEFANYLKEISRDLEQNQRTFADEM--SKLTILEKTR---EQKTILSPIAGTIVY 302 EA L A ++ + L +++ + A S L++ + E+ I +P+ G + Sbjct: 164 --EAALAAAQAAQKQNLALLESEVSGAQAQVASAEAALDQAKLDLERTVIRAPVDGYVT- 220 Query: 303 NQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKK 362 N S Y PLM +VP Y+ A Q+ V+ G A + A Sbjct: 221 NLSVRVGQYVSAGTPLMALVPLDSF-YVVANFKETQLARVRPGQPAEITL--DAYPGNGV 277 Query: 363 FKAIIEKIDP 372 + I+E I P Sbjct: 278 VEGIVEGIAP 287 Score = 34.2 bits (78), Expect = 0.082 Identities = 11/51 (21%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLI-DLKKVSIKNLR 107 I++P G + V G + GTPL+ +++ ++ + K+ + +R Sbjct: 210 VIRAPVDGYVTNLSVRVGQYVSAGTPLMALVPLDSFYVVANFKETQLARVR 260 Score = 31.5 bits (71), Expect = 0.52 Identities = 21/133 (15%), Positives = 47/133 (35%), Gaps = 13/133 (9%) Query: 13 HPASLKR----MTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIK 68 A KR +TLL ++ + + + S+ + +VV I SG + Sbjct: 8 AKAKRKRFKLPLTLLVVLAAVLYGGL--IWLYYRNHPSTDDAYVRADVVPIAPQVSGRVT 65 Query: 69 KFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLE 128 + V++ + +G L + + + +++ + ++ L L + + Sbjct: 66 EVNVKDNQLVKKGDVLFRIDPRDY-------RAALEQAEAALAAAEAQLRNLRAQLASAQ 118 Query: 129 KAFESREEQLLDF 141 E Q LD Sbjct: 119 ALIAQAEAQDLDQ 131 >gnl|CDD|109580 pfam00529, HlyD, HlyD family secretion protein. Length = 304 Score = 42.5 bits (100), Expect = 3e-04 Identities = 47/304 (15%), Positives = 86/304 (28%), Gaps = 77/304 (25%) Query: 55 NVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEK 114 V E++ SGI+ + V+ G ++ G L+ + +D + + + Sbjct: 1 RVAEVQPQVSGIVIRILVKEGDRVKAGDVLVRLDPTPYQAALDRAEAELAAAQ-----AD 55 Query: 115 SALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMR-S 173 + + D L+ Q +L+ L R + Sbjct: 56 AQARLARAERDRLQALVAQAAIQSEQEADAAR---------------AALREALAASRGA 100 Query: 174 IYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTL-ELRE 232 +L+ R L S L +S + ++TL L Sbjct: 101 ASKAQLE------AARDNLRSALALLP----------ISLGRIGAS-----QATLGALLN 139 Query: 233 NIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTI 292 N+ Q L L E L Q I Sbjct: 140 NLQAQG--------------LAARAQLDEAYLQLAQTAAELLR---------------LI 170 Query: 293 LSPIAGTIVYNQSFSSS----NYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTA 348 +P G V +++ S PLM +VP + + + A + Q++ V+ G A Sbjct: 171 RAPAQGERVQSEAQLRSVQVGEEVGVGSPLMGVVPFNDV-EVDANLGETQLRLVRPGPRA 229 Query: 349 TVRF 352 + Sbjct: 230 PLTG 233 >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase. This domain functions in transferring CO2 from one subsite to another, allowing carboxylation, decarboxylation, or transcarboxylation. During this process, biotin is covalently attached to a specific lysine. Length = 67 Score = 37.0 bits (87), Expect = 0.010 Identities = 9/30 (30%), Positives = 18/30 (60%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTF 87 E+ +P +G++K+ V+ G Q+ G L+ Sbjct: 38 EVTAPVAGVVKEILVKEGDQVEAGQLLVVI 67 Score = 30.8 bits (71), Expect = 0.79 Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 E+ +P G + K V+ G ++ G PL E Sbjct: 1 EVTAPMPGTVVKVLVKEGDKVEAGQPLAVLE 31 >gnl|CDD|30854 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion]. Length = 404 Score = 34.2 bits (78), Expect = 0.075 Identities = 10/45 (22%), Positives = 21/45 (46%) Query: 49 EILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETT 93 E+ + +E+ +P +G++ K VE G + G + E+ Sbjct: 38 EVETDKATMEVPAPDAGVLAKILVEEGDTVPVGAVIARIEEEGAD 82 >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid dehydrogenase (BCDH), contain at least three different enzymes, 2-oxo acid dehydrogenase (E1), dihydrolipoyl acyltransferase (E2) and dihydrolipoamide dehydrogenase (E3) and play a key role in redox regulation. E2, the central component of the complex, catalyzes the transfer of the acyl group of CoA from E1 to E3 via reductive acetylation of a lipoyl group covalently attached to a lysine residue. Length = 74 Score = 33.9 bits (79), Expect = 0.086 Identities = 9/32 (28%), Positives = 17/32 (53%) Query: 56 VVEIKSPFSGIIKKFQVENGSQILQGTPLLTF 87 VE+++P +G++ K VE G + G + Sbjct: 43 TVEVEAPAAGVLAKILVEEGDTVPVGQVIAVI 74 >gnl|CDD|144088 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme. This family covers two Prosite entries, the conserved lysine residue binds biotin in one group and lipoic acid in the other. Note that the model may not recognize the Glycine cleavage system H proteins. Length = 73 Score = 33.7 bits (78), Expect = 0.11 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 56 VVEIKSPFSGIIKKFQVENGSQILQGTPLLTF 87 +EI +P +G++K+ V+ G + G PL Sbjct: 42 EMEIPAPVAGVVKEILVKEGDTVEVGDPLAKI 73 >gnl|CDD|34842 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton]. Length = 3164 Score = 33.5 bits (76), Expect = 0.12 Identities = 15/81 (18%), Positives = 36/81 (44%), Gaps = 6/81 (7%) Query: 336 PKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPIISQQDNNLQTQEYYEVILKITD 395 + ++ + + P + I + +AI EKID ++ Q++++ Q+ Y+ L+ Sbjct: 1706 TRSLRAIFGYAETRIDTPDVSLIIDWYCEAIREKIDRLVQQKESSTSRQDLYDFGLRAI- 1764 Query: 396 LAFSDNNIELRNGFPAEVLFT 416 + + AE+ F+ Sbjct: 1765 -----REMIAGHIGEAEITFS 1780 >gnl|CDD|34383 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism]. Length = 645 Score = 33.3 bits (76), Expect = 0.15 Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 59 IKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 +++P G++ K V G Q+ GT L+ FE+ Sbjct: 615 LRAPRDGVVAKLAVAEGDQVAVGTVLVEFEE 645 >gnl|CDD|30857 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism]. Length = 140 Score = 33.1 bits (75), Expect = 0.15 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 EI++P G++K+ V+NG + G PL E Sbjct: 109 EIEAPADGVVKEILVKNGDPVEYGDPLAVIE 139 >gnl|CDD|35779 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion]. Length = 457 Score = 32.7 bits (74), Expect = 0.24 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 10/51 (19%) Query: 48 GEILNEDNVV----------EIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 G+ +NED V E+ SP SG+I + V++G + G L Sbjct: 97 GDRVNEDEAVAEIETDKTTVEVPSPASGVITELLVKDGDTVTPGQKLAKIS 147 >gnl|CDD|164623 MTH00052, COX3, cytochrome c oxidase subunit III; Provisional. Length = 262 Score = 30.5 bits (69), Expect = 0.99 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query: 348 ATVRFPHYADIREKKFKAIIE-KIDPIISQQDNNLQTQEYYEVILKITD 395 ATV + H+ I K+ +AII + + LQ EYYE I+D Sbjct: 143 ATVTWAHHGIISGKRKEAIIGLALTVALGLLFTGLQAMEYYEAPFTISD 191 >gnl|CDD|36212 KOG0994, KOG0994, KOG0994, Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]. Length = 1758 Score = 29.7 bits (66), Expect = 1.5 Identities = 22/100 (22%), Positives = 43/100 (43%), Gaps = 6/100 (6%) Query: 207 EKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLR-HINELYDEANLEFANYLKEISRD 265 + + Q +R++ K + E+ LR +L +AN E + LK++ + Sbjct: 1661 QGLEILQKYYELVDRLLEKRMEG-SQAARERAEQLRTEAEKLLGQAN-EKLDRLKDLELE 1718 Query: 266 LEQNQRTFADEMSKLTILEKTREQKTILSPIAG-TIVYNQ 304 +N++ D+ ++L LEK E +L I + Y Sbjct: 1719 YLRNEQALEDKAAELAGLEKRVES--VLDHINERVLYYAT 1756 >gnl|CDD|30431 COG0082, AroC, Chorismate synthase [Amino acid transport and metabolism]. Length = 369 Score = 29.4 bits (66), Expect = 2.0 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 17/88 (19%) Query: 251 ANLEFANYLKEISRDLEQNQ------RTFADEMSKLTILEKTREQKTILSPIAGTIVYNQ 304 A LE + ++I ++L++ + T E ++ IL E KT +PIA ++ N Sbjct: 31 AGLELS--EEDIQKELDRRRPGYSRGTTMRKEKDEVEILSGVFEGKTTGTPIA-LLIENT 87 Query: 305 SFSSSNYAQQSQPLMKIVP---HSKLTY 329 S +Y+ +K P H+ TY Sbjct: 88 DQRSKDYSM-----IKDPPRPGHADYTY 110 >gnl|CDD|36180 KOG0962, KOG0962, KOG0962, DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]. Length = 1294 Score = 29.1 bits (65), Expect = 2.6 Identities = 36/283 (12%), Positives = 95/283 (33%), Gaps = 20/283 (7%) Query: 101 VSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSV 160 ++ LR ++ +LD L + + L+K +E ++ + + + I Sbjct: 819 RTVDELRKEKSKKQESLDKLRKEIECLQKEVIEQEREISRLINLRNELKEEKQK--IERS 876 Query: 161 YRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQE 220 L+ + + L++K L + + +L ++ E+ +N+ N E Sbjct: 877 LARLQQLEEDIEELSEEITRLDSKVKELLERIQPLKVELEEAQSEKEE---LKNERNTSE 933 Query: 221 RIVYKSTLELRENIHEQKNMLRHINELYDEANLEFAN--------YLKEISRDLEQNQRT 272 ++ K ++ E + + + + +L+E ++ + ++ Sbjct: 934 KLAQKKRNDINEKVSLLHQIYKLNECFEQYGFDDLRIAQLSESEEHLEERDNEVNEIKQK 993 Query: 273 FADEMSK-------LTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHS 325 ++ + LT+ R+ K + ++ + ++ L + Sbjct: 994 IRNQYQRERNLKDNLTLRNLERKLKELERELSELDKQILEADIKSVKEERVKLEEEREKL 1053 Query: 326 KLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIE 368 KQ + K +R + D + KA+IE Sbjct: 1054 SSEKNLLLGEMKQYESQIKKLKQELREKDFKDAEKNYRKALIE 1096 >gnl|CDD|36217 KOG0999, KOG0999, KOG0999, Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]. Length = 772 Score = 28.9 bits (64), Expect = 3.0 Identities = 38/176 (21%), Positives = 71/176 (40%), Gaps = 8/176 (4%) Query: 113 EKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMR 172 EK L + + + +Q + LG+Y S KV G L+ + Sbjct: 44 EKEDLKQQLEELEAEYDLARTELDQTKEALGQYRSQHKKVARDGEEREESLLQESAAKEE 103 Query: 173 SIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRE 232 L+LEN+ LR L++ Q++ ++ + S + Q R + EL+E Sbjct: 104 YYLQKILELENELKQLRQELTNVQEENERLEKVHSDLKESNAAVEDQRR---RLRDELKE 160 Query: 233 NIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTRE 288 + +L +EL +E N+ L++ +L Q+Q + ++ LE+ E Sbjct: 161 YKFREARLLSEYSEL-EEENIS----LQKQVSNLRQSQVEYEGLKHEIKRLEEETE 211 >gnl|CDD|58071 cd03705, EF1_alpha_III, Domain III of EF-1. Eukaryotic elongation factor 1 (EF-1) is responsible for the GTP-dependent binding of aminoacyl-tRNAs to ribosomes. EF-1 is composed of four subunits: the alpha chain, which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains. This family is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF-1 alpha) and eukaryotes (eEF-1 alpha).. Length = 104 Score = 28.6 bits (64), Expect = 3.2 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 9/61 (14%) Query: 336 PKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDP----IISQQDNNLQTQEYYEVIL 391 P QI K GYT V H A + +F I+ KIDP + + L++ + V + Sbjct: 16 PGQI---KPGYTP-VLDCHTAHV-ACRFAEILSKIDPRTGKKLEENPKFLKSGDAAIVKI 70 Query: 392 K 392 Sbjct: 71 V 71 >gnl|CDD|35778 KOG0558, KOG0558, KOG0558, Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion]. Length = 474 Score = 28.5 bits (63), Expect = 3.9 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Query: 49 EILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLID 97 E+ ++ V I S + G +KK G PL+ D+E D D Sbjct: 100 EVQSDKASVTITSRYDGKVKKIYHSPDDIAKVGKPLV---DLEVEDSQD 145 >gnl|CDD|163665 cd07422, MPP_ApaH, Escherichia coli ApaH and related proteins, metallophosphatase domain. ApaH (also known as symmetrically cleaving Ap4A hydrolase and bis(5'nucleosyl)-tetraphosphatase) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases that hydrolyzes the nucleotide-signaling molecule diadenosine tetraphosphate (Ap(4)A) into two ADP and also hydrolyzes Ap(5)A, Gp(4)G, and other extending compounds. Null mutations in apaH result in high intracellular levels of Ap(4)A which correlate with multiple phenotypes, including a decreased expression of catabolite-repressible genes, a reduction in the expression of flagellar operons, and an increased sensitivity to UV and heat. Ap4A hydrolase is important in responding to heat shock and oxidative stress via regulating the concentration of Ap4A in bacteria. Ap4A hydrolase is also thought to play a role in siderophore production, but the mechanism by which ApaH interacts with siderophore pathways in unknown. The PPP (phosphoprotein phosphatase) family, to which ApaH belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, and PrpA/PrpB. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 257 Score = 28.2 bits (64), Expect = 4.0 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 1/21 (4%) Query: 168 LTRMRSIYLN-RLDLENKSSL 187 TRMR + RLD +K + Sbjct: 178 FTRMRFCTPDGRLDFSSKGAP 198 >gnl|CDD|28921 cd00040, CSF2, Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is a member of the large family of polypeptide growth factors called cytokines. It stimulates a wide variety of hematopoietic and nonhematopoietic cell types via binding to members of the cytokine receptor family, mainly the GM-CSF receptor.. Length = 121 Score = 28.0 bits (62), Expect = 5.8 Identities = 23/77 (29%), Positives = 31/77 (40%), Gaps = 17/77 (22%) Query: 109 HIDTEKSALDFLNNKYD----------VLEKAFESREEQLLDFLGKYHSTCSKVFNYGIS 158 H+D K AL LNN D V+ + F+ +E L T K++ G+ Sbjct: 15 HVDAIKEALSLLNNSNDTAAVMNETVEVVSEMFDPQEPTCL-------QTRLKLYKQGLR 67 Query: 159 SVYRSLKMKLTRMRSIY 175 LK LT M S Y Sbjct: 68 GSLTKLKGPLTMMASHY 84 >gnl|CDD|34333 COG4717, COG4717, Uncharacterized conserved protein [Function unknown]. Length = 984 Score = 27.7 bits (61), Expect = 6.2 Identities = 40/194 (20%), Positives = 71/194 (36%), Gaps = 18/194 (9%) Query: 106 LRCHIDTEKSALDFLNNKYDVLEKAFESRE----------EQLLDFLGKYHSTCSKVFNY 155 +R H + ALD L Y+ LE F + E E+ LD LG S Sbjct: 555 IRQHWQQLRKALDQLEAAYEALEGRFAAAEAAMAEWQSEWEEALDELG-LSRELSPEQQL 613 Query: 156 GISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQND 215 I S + LK + + +L ++ + LR ++ ++ + + + E + + Sbjct: 614 DILSTMKDLKKLMQ-------KKAELTHQVARLREEQAAFEERVEGLLAVLEAQFIDLST 666 Query: 216 LNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFAD 275 L +R+ + L+ E + + EL DE E + KEI + D Sbjct: 667 LFCVQRLRVAAELQKEEARLALEGNIERTKELNDELRAELELHRKEILDLFDCGTADTED 726 Query: 276 EMSKLTILEKTREQ 289 + E+ Q Sbjct: 727 AFREAAREEQQLTQ 740 >gnl|CDD|35383 KOG0161, KOG0161, KOG0161, Myosin class II heavy chain [Cytoskeleton]. Length = 1930 Score = 27.5 bits (61), Expect = 6.9 Identities = 36/201 (17%), Positives = 78/201 (38%), Gaps = 21/201 (10%) Query: 103 IKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHS---TCSKVFNYGISS 159 +KNL I++ + L+ + LE+ ++ L K S +K + Sbjct: 966 LKNLEEEINSLDENISKLSKEKKELEERIRELQDDLQAEEEKAKSLNKAKAK-----LEQ 1020 Query: 160 VYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQ----ND 215 L++ L R + I R++LE L L Q+ + +K E+ ++ Sbjct: 1021 QLDDLEVTLEREKRI---RMELEKAKRKLEGELKDLQESIEELKKQKEELDNQLKKKESE 1077 Query: 216 LNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFA------NYLKEISRDLEQN 269 L+Q + + E+ + + K + I EL +E E A +++S +LE+ Sbjct: 1078 LSQLQSKLEDEQAEVAQLQKQIKELEARIKELEEELEAERASRAKAERQRRDLSEELEEL 1137 Query: 270 QRTFADEMSKLTILEKTREQK 290 + ++ + +++ Sbjct: 1138 KEELEEQGGTTAAQLELNKKR 1158 >gnl|CDD|164597 MTH00024, COX3, cytochrome c oxidase subunit III; Validated. Length = 261 Score = 27.4 bits (61), Expect = 7.2 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 348 ATVRFPHYADIREKKFKAIIE-KIDPIISQQDNNLQTQEYYEVILKITD 395 ATV + H+A I K+ +AI+ + + LQ EYYE I+D Sbjct: 142 ATVTWAHHAIISGKRKEAILGLFLTVFLGVLFTGLQAIEYYEAPFAISD 190 >gnl|CDD|35589 KOG0368, KOG0368, KOG0368, Acetyl-CoA carboxylase [Lipid transport and metabolism]. Length = 2196 Score = 27.6 bits (61), Expect = 7.6 Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 52 NEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 E++ ++SP G + ++ VE+G + G P E Sbjct: 681 KENDPTVLRSPSPGKLLQYLVEDGEHVEAGQPYAEIE 717 >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS). These domains transport CO2, acyl, or methylamine, respectively, between components of the complex/protein via a biotinyl or lipoyl group, which is covalently attached to a highly conserved lysine residue. Length = 73 Score = 27.4 bits (61), Expect = 8.3 Identities = 10/32 (31%), Positives = 20/32 (62%) Query: 56 VVEIKSPFSGIIKKFQVENGSQILQGTPLLTF 87 ++++P SG +KK V+ G+++ TPL+ Sbjct: 42 TSDVEAPKSGTVKKVLVKEGTKVEGDTPLVKI 73 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.133 0.368 Gapped Lambda K H 0.267 0.0669 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,049,850 Number of extensions: 263261 Number of successful extensions: 850 Number of sequences better than 10.0: 1 Number of HSP's gapped: 846 Number of HSP's successfully gapped: 62 Length of query: 440 Length of database: 6,263,737 Length adjustment: 97 Effective length of query: 343 Effective length of database: 4,167,664 Effective search space: 1429508752 Effective search space used: 1429508752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 59 (26.6 bits)