RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780386|ref|YP_003064799.1| Type I secretion membrane fusion protein, HlyD [Candidatus Liberibacter asiaticus str. psy62] (440 letters) >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. Length = 423 Score = 112 bits (282), Expect = 2e-25 Identities = 79/432 (18%), Positives = 169/432 (39%), Gaps = 29/432 (6%) Query: 14 PASLKRMTLLSIIGIIGLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVE 73 + +T L ++ W+ P+++ +++G+++ NV ++ GI+++ V Sbjct: 1 SRFARLITWLIAGLVVIFFLWAYFAPLDVVATATGKVVPSGNVKVVQHLEGGIVREILVR 60 Query: 74 NGSQILQGTPLLTFEDIET---TDLIDLKKVSIKNLRCHIDTEKSALDF-------LNNK 123 G ++ G L+ + + ++ + + ++ + E + L+ + Sbjct: 61 EGDRVKAGQVLVELDATDVEADAAELESQVLRLEAEVARLRAEADSQAAIEFPDDLLSAE 120 Query: 124 YDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGISSVYRSLKMKLTRMRSIYLNRLDLEN 183 + + + ++ + I + + L+ +L +++ L+ Sbjct: 121 DPAVPELIKGQQSLFESRKSTLRAQL-----ELILAQIKQLEAELAGLQA------QLQA 169 Query: 184 KSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRH 243 L + ++L + L EK VS+ +L + ER ++ EL E + + R Sbjct: 170 LRQQLEVI----SEELEARRKLKEKGLVSRLELLELERERAEAQGELGRLEAELEVLKRQ 225 Query: 244 INELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIVYN 303 I+EL E + +E+ +L + Q A+ +L ++ I SP+ GT+ Sbjct: 226 IDELQLERQQIEQTFREEVLEELTEAQARLAELRERLNKARDRLQRLIIRSPVDGTVQSL 285 Query: 304 QSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHYADIREKKF 363 + + Q + LM+IVP I AK++PK I V G A ++F + R Sbjct: 286 KVHTVGGVVQPGETLMEIVPEDDPLEIEAKLSPKDIGFVHVGQPAEIKFSAFPYRRYGIL 345 Query: 364 KAIIEKIDPIISQQDNNLQTQEYYEVILKITDLAFSDN--NIELRNGFPAEVLFTAKNTT 421 ++ I P + YY V + I +EL G P T Sbjct: 346 NGKVKSISPDTFTDERGGGP--YYRVRISIDQNTLGIGPKGLELSPGMPVTADIKTGERT 403 Query: 422 LAQEIIHPITDN 433 + + ++ PITD+ Sbjct: 404 VIEYLLKPITDS 415 >gnl|CDD|162505 TIGR01730, RND_mfp, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. Length = 322 Score = 44.6 bits (106), Expect = 5e-05 Identities = 33/163 (20%), Positives = 56/163 (34%), Gaps = 16/163 (9%) Query: 213 QNDLNQQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISR-DLEQNQR 271 Q L Q ++ LEL + E+ L + A+ + ++ +E Q Sbjct: 67 QAALAQLAAA--EAQLELAQRSFER------AERLVKRNAVSQADL--DDAKAAVEAAQA 116 Query: 272 TFADEMSKLTILEKTREQKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIR 331 + L + I +P GTI + Y Q L IV L Sbjct: 117 DLEAAKASLASAQLNLRYTEIRAPFDGTIG-RRLVEVGAYVTAGQTLATIVDLDPL-EAD 174 Query: 332 AKVTPKQIQHVKKGYTATVRFPHYADIREKKFKAIIEKIDPII 374 V + + +++G T TV ++FK + IDP + Sbjct: 175 FSVPERDLPQLRRGQTLTVELDALPG---EEFKGKLRFIDPRV 214 Score = 35.0 bits (81), Expect = 0.040 Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTD 94 EI++PF G I + VE G+ + G L T D++ + Sbjct: 136 EIRAPFDGTIGRRLVEVGAYVTAGQTLATIVDLDPLE 172 Score = 30.7 bits (70), Expect = 0.73 Identities = 15/100 (15%), Positives = 31/100 (31%), Gaps = 22/100 (22%) Query: 39 PIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLIDL 98 + +++ G L + ++ + +G I K V G ++ +G L +D Sbjct: 10 TLANTLTFPGS-LEAVDEADLAAEVAGKITKISVREGQKVKKGQVLARLDD--------- 59 Query: 99 KKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQL 138 D + AL + E E + Sbjct: 60 ------------DDYQLALQAALAQLAAAEAQLELAQRSF 87 >gnl|CDD|163506 TIGR03794, NHPM_micro_HlyD, NHPM bacteriocin system secretion protein. Members of this protein family are homologs of the HlyD membrane fusion protein of type I secretion systems. Their occurrence in prokaryotic genomes is associated with the occurrence of a novel class of microcin (small bacteriocins) with a propeptide region related to nitrile hydratase. We designate the class of bacteriocin as Nitrile Hydratase Propeptide Microcin, or NHPM. This family, therefore, is designated as NHPM bacteriocin system secretion protein. Some but not all NHPM-class putative microcins belong to the TOMM (thiazole/oxazole modified microcin) class as assessed by the presence of the scaffolding protein and/or cyclodehydratase in the same gene clusters. Length = 421 Score = 42.9 bits (101), Expect = 2e-04 Identities = 27/124 (21%), Positives = 55/124 (44%), Gaps = 4/124 (3%) Query: 22 LLSIIGII-GLITWSILLPIEISVSSSGEILNEDNVVEIKSPFSGIIKKFQVENGSQILQ 80 L ++ I+ + W I I I VS +G ++ V I+SP SG++ VE G Q+ + Sbjct: 23 LAALGVIVVAALAWGIFGSIPIRVSGNGILILSSGVDTIQSPGSGVVIDLDVEVGDQVKK 82 Query: 81 GTPLLTFEDIETTDLIDLKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLD 140 G + E + + + L+ + + ++ + E+ F+ +E L + Sbjct: 83 GQVVARLFQPELRERLQESYQKLTQLQ---EQLEEVRNYTGRLKEGRERHFQKSKEALEE 139 Query: 141 FLGK 144 +G+ Sbjct: 140 TIGR 143 >gnl|CDD|132016 TIGR02971, heterocyst_DevB, ABC exporter membrane fusion protein, DevB family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. DevB from Anabaena sp. strain PCC 7120 is partially characterized as a membrane fusion protein of the DevBCA ABC exporter, probably a glycolipid exporter, required for heterocyst formation. Most Cyanobacteria have one member only, but Nostoc sp. PCC 7120 has seven members. Length = 327 Score = 40.2 bits (94), Expect = 0.001 Identities = 45/210 (21%), Positives = 91/210 (43%), Gaps = 36/210 (17%) Query: 176 LNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELREN-- 233 LNRL+ E L + Q+++ ++LF AVS +DL+ + + + EL E Sbjct: 106 LNRLEAE---------LETAQREVDRYRSLFRDGAVSASDLDSKALKLRTAEEELEEALA 156 Query: 234 -----IHEQKNMLRHINELYDEANLEFANYLKEISRDLEQNQRTFADEMSKLTILEKTRE 288 I + L + E E +++ A E+ LE Q+ A+ + +LT ++ Sbjct: 157 SRSEQIDGARAALASLAEEVRETDVDLAQ--AEVKSALEAVQQ--AEALLELTYVK---- 208 Query: 289 QKTILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYTA 348 +PI G ++ + + S+ ++++ S++ Y A+V I V+ G A Sbjct: 209 -----APIDGRVL--KIHAREGEVIGSEGILEMGDTSQM-YAVAEVYETDINRVRVGQRA 260 Query: 349 TVRFPHYADIREKKFKAIIEKIDPIISQQD 378 T+ + + + +I +I++ D Sbjct: 261 TITSTALS----GPLRGTVRRIGSLIAKND 286 >gnl|CDD|183339 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed. Length = 411 Score = 36.7 bits (86), Expect = 0.011 Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 56 VVEIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 VEI SP +G + K VE G + G+ + E+ Sbjct: 45 TVEIPSPVAGTVAKLLVEEGDVVPVGSVIAVIEE 78 >gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed. Length = 547 Score = 35.2 bits (82), Expect = 0.033 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 11/60 (18%) Query: 40 IEISVSSSGEILNEDN----------VVEIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 IE V G+ + ED +EI SP +G++K+ +V+ G ++ G+ L+ E Sbjct: 136 IEWLVKV-GDTVEEDQSLITVETDKATMEIPSPVAGVVKEIKVKVGDKVSVGSLLVVIEV 194 Score = 35.2 bits (82), Expect = 0.035 Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 56 VVEIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 +EI SP +G++K+ +V+ G + G L E Sbjct: 44 TMEIPSPAAGVVKEIKVKVGDTVSVGGLLAVIEA 77 >gnl|CDD|117187 pfam08614, ATG16, Autophagy protein 16 (ATG16). Autophagy is a ubiquitous intracellular degradation system for eukaryotic cells. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. ATG16 (also known as Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate in the yeast autophagy pathway. Length = 194 Score = 34.8 bits (80), Expect = 0.046 Identities = 18/95 (18%), Positives = 37/95 (38%), Gaps = 8/95 (8%) Query: 188 LRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRHINEL 247 + L+ +++LT + + A LN + + E+++ + I L Sbjct: 72 MEQKLAKLREELTELHKKRGELAQRLLLLNDELE---QLRREIQQLEKTIAELRSEITSL 128 Query: 248 YDEANLEFANYLKEISRDLEQNQRTFADEMSKLTI 282 E L+E ++ E++ T DE+ L I Sbjct: 129 ETEIRD-----LREELQEKEKDNETLQDELISLNI 158 >gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional. Length = 418 Score = 34.3 bits (79), Expect = 0.068 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 10/49 (20%) Query: 48 GEILNEDNV----------VEIKSPFSGIIKKFQVENGSQILQGTPLLT 86 G+ + ED V V+I++P SG+I K E G + G PL Sbjct: 69 GDYVKEDEVICIIETDKVSVDIRAPASGVITKIFAEEGDTVEVGAPLSE 117 >gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model describes a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and per cent identity (UPGMA) trees. Members of this set include two or three copies of the lipoyl-binding domain. E. coli AceF is a member of this model, while mitochondrial and some other bacterial forms belong to a separate model. Length = 546 Score = 32.9 bits (75), Expect = 0.15 Identities = 11/38 (28%), Positives = 21/38 (55%) Query: 56 VVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETT 93 +E+ +P SG++K +V+ G + G +LT +T Sbjct: 158 SMEVPAPASGVVKSVKVKVGDSVPTGDLILTLSVAGST 195 Score = 29.8 bits (67), Expect = 1.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 56 VVEIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 +E+ S +GIIK+ +V+ G + G + T E Sbjct: 42 SMEVPSSAAGIIKEIKVKVGDTLPVGGVIATLE 74 >gnl|CDD|162152 TIGR00998, 8a0101, efflux pump membrane protein (multidrug resistance protein A). Length = 334 Score = 33.2 bits (76), Expect = 0.15 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDLI-DLKKVSIKNLR 107 I++PF G + + V+ G + G PL+ E + + K+ +KN+R Sbjct: 206 VIRAPFDGYVARRFVQVGQVVSPGQPLMAVVPAEQMYVEANFKETQLKNVR 256 >gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated. Length = 633 Score = 33.1 bits (76), Expect = 0.16 Identities = 10/32 (31%), Positives = 21/32 (65%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 E+ SP +G++K+ +V+ G ++ G ++ FE Sbjct: 45 EVPSPQAGVVKEIKVKVGDKVETGALIMIFES 76 Score = 29.6 bits (67), Expect = 1.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 E+ +PF+G +K+ +V G ++ G+ ++ FE Sbjct: 148 EVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEV 179 Score = 29.6 bits (67), Expect = 1.7 Identities = 10/32 (31%), Positives = 21/32 (65%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 E+ +PF+G +K+ +V G ++ G+ ++ FE Sbjct: 249 EVPAPFAGTVKEIKVNVGDKVKTGSLIMRFEV 280 >gnl|CDD|162058 TIGR00834, ae, anion exchange protein. They preferentially catalyze anion exchange (antiport) reactions, typically acting as HCO3-:Cl- antiporters, but also transporting a range of other inorganic and organic anions. Additionally, renal Na+:HCO3- cotransporters have been found to be members of the AE family. They catalyze the reabsorption of HCO3- in the renal proximal tubule. Length = 900 Score = 30.5 bits (69), Expect = 0.96 Identities = 19/76 (25%), Positives = 28/76 (36%), Gaps = 8/76 (10%) Query: 174 IYLNRLDLENKSSLLRALL--SSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELR 231 IY ++ E++ +LRALL SHQ D K A SQ+ + + Sbjct: 83 IYSGQIRPEDRDEVLRALLLKHSHQSDAK--KLGGLSRARSQSSIGKT----LSHDASEM 136 Query: 232 ENIHEQKNMLRHINEL 247 N +L H Sbjct: 137 PNPDNGAPLLPHQPLT 152 >gnl|CDD|162983 TIGR02712, urea_carbox, urea carboxylase. Members of this family are ATP-dependent urea carboxylase, including characterized members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae. The allophanate hydrolase domain of the yeast enzyme is not included in this model and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from Oleomonas sagaranensis was shown to be highly active on acetamide and formamide as well as urea. Length = 1201 Score = 29.6 bits (67), Expect = 1.6 Identities = 6/31 (19%), Positives = 13/31 (41%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 + +P +G + K + G + G + E Sbjct: 1171 PVSAPVAGKVTKILCQPGDMVDAGDIVAVLE 1201 >gnl|CDD|181754 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated. Length = 592 Score = 29.4 bits (67), Expect = 1.9 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 EI++P G +K+ V+ G ++ G L+ E Sbjct: 561 EIQAPVDGTVKEILVKEGDRVNPGDVLMEIE 591 >gnl|CDD|185090 PRK15136, PRK15136, multidrug efflux system protein EmrA; Provisional. Length = 390 Score = 29.3 bits (66), Expect = 1.9 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 3/70 (4%) Query: 289 QKT-ILSPIAGTIVYNQSFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVKKGYT 347 Q+T I+SP+ G V +S + PLM +VP + L ++ A Q+ +++ G Sbjct: 214 QRTKIVSPMTG-YVSRRSVQVGAQISPTTPLMAVVPATNL-WVDANFKETQLANMRIGQP 271 Query: 348 ATVRFPHYAD 357 AT+ Y D Sbjct: 272 ATITSDIYGD 281 Score = 28.5 bits (64), Expect = 3.9 Identities = 11/28 (39%), Positives = 18/28 (64%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLL 85 +I SP +G + + V+ G+QI TPL+ Sbjct: 217 KIVSPMTGYVSRRSVQVGAQISPTTPLM 244 >gnl|CDD|168146 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated. Length = 153 Score = 29.4 bits (66), Expect = 2.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLL 85 EI +P G++KK V+ G + G PL+ Sbjct: 123 EIPAPKDGVVKKILVKEGDTVDTGQPLI 150 >gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase. This enzyme plays a role in gluconeogensis but not glycolysis. Length = 1143 Score = 29.0 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Query: 59 IKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 I++P G IK+ V+ G QI LL E Sbjct: 1114 IQAPKDGTIKEVLVKAGEQIDAKDLLLVLE 1143 >gnl|CDD|178910 PRK00166, apaH, diadenosine tetraphosphatase; Reviewed. Length = 275 Score = 28.2 bits (64), Expect = 4.8 Identities = 8/21 (38%), Positives = 10/21 (47%), Gaps = 1/21 (4%) Query: 168 LTRMRSIYLN-RLDLENKSSL 187 TRMR + RLD + K Sbjct: 180 FTRMRFCTPDGRLDFKCKGPP 200 >gnl|CDD|178052 PLN02433, PLN02433, uroporphyrinogen decarboxylase. Length = 345 Score = 28.0 bits (63), Expect = 5.2 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 10/78 (12%) Query: 48 GEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIET-TDLIDLKKV----- 101 G IL D I +P + F + G + P+ + ED++ L +K+ Sbjct: 63 GVILFSD----ILTPLPAMGIPFDIVKGKGPVIPNPIRSEEDVKRLHPLDPEEKLPFVGE 118 Query: 102 SIKNLRCHIDTEKSALDF 119 ++K LR + E + L F Sbjct: 119 ALKILRKEVGNEAAVLGF 136 >gnl|CDD|162153 TIGR00999, 8a0102, Membrane Fusion Protein cluster 2 (function with RND porters). Length = 265 Score = 27.8 bits (62), Expect = 5.7 Identities = 11/38 (28%), Positives = 17/38 (44%) Query: 55 NVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIET 92 + VE++SPF G I + V G + L D+ Sbjct: 87 SYVEVRSPFDGYITQKSVTLGDYVAPQAELFRVADLGA 124 >gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional. Length = 793 Score = 27.7 bits (61), Expect = 6.4 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 6/70 (8%) Query: 202 MKNLFEKNAVSQNDLNQQERIVYKSTLELRENIHEQKNMLRH---INELYDEANLEFANY 258 M L + +++ N +ER ++ +ELR+ I EQ+ +L I + EA + + Sbjct: 259 MSELLQSEFINEPRENLEER---EAAMELRDRIEEQELLLEFLFLIQQRKQEAADKLQDT 315 Query: 259 LKEISRDLEQ 268 + +S D++Q Sbjct: 316 ISLLSSDIDQ 325 >gnl|CDD|133910 PHA00540, PHA00540, hypothetical protein. Length = 715 Score = 27.7 bits (61), Expect = 6.7 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 14/127 (11%) Query: 151 KVFNYGISSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNA 210 +VFN+ S+Y SL K + + + DL S L++ +S + ++ F +N Sbjct: 371 EVFNFN-GSIYSSLNSKDLKYYQQFSGQFDL---SKFLQSFFASALVPVFQNRSSFIENG 426 Query: 211 VSQNDLNQQERIVYKSTLELR--------ENIHEQKNMLRHINELYDEANLEFANYLKEI 262 N L +V L+L+ ENI+++ + +N ++ + + NYL+ I Sbjct: 427 YIDN-LQYDTVLVNFFALKLQNFNNILLSENINDKLQFDKLLNSMFKISQKFYTNYLRTI 485 Query: 263 SRDLEQN 269 DLE N Sbjct: 486 F-DLENN 491 >gnl|CDD|181450 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated. Length = 819 Score = 27.4 bits (61), Expect = 7.8 Identities = 11/45 (24%), Positives = 25/45 (55%) Query: 257 NYLKEISRDLEQNQRTFADEMSKLTILEKTREQKTILSPIAGTIV 301 + LK + R L+ ++F + M K +++QK+++ P+ G + Sbjct: 160 SALKTVPRGLDAPDKSFKESMPKDAYAVWSKKQKSLIGPVGGETL 204 >gnl|CDD|184472 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional. Length = 593 Score = 27.2 bits (61), Expect = 8.4 Identities = 9/29 (31%), Positives = 16/29 (55%) Query: 58 EIKSPFSGIIKKFQVENGSQILQGTPLLT 86 EI++ +G ++ V+ G + G LLT Sbjct: 563 EIRAAQAGTVRGIAVKEGDAVAVGDTLLT 591 >gnl|CDD|114855 pfam06160, EzrA, Septation ring formation regulator, EzrA. During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerizes into a ring structure that establishes the location of the nascent division site. EzrA modulates the frequency and position of FtsZ ring formation. Length = 559 Score = 27.1 bits (61), Expect = 9.4 Identities = 17/107 (15%), Positives = 38/107 (35%), Gaps = 10/107 (9%) Query: 176 LNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLNQQERIVYKSTLELRENIH 235 L LDL+ + ++ + + ++ EK ++ + + + RE Sbjct: 268 LEELDLDEAEEENEEI----EERIDTLYDILEKEVKAKKFVEKNIDKLTDFLEHAREQNK 323 Query: 236 EQKNMLRHINELY----DEANL--EFANYLKEISRDLEQNQRTFADE 276 + L + + Y DE E L+E+ +Q A++ Sbjct: 324 QLLLELDRLQQSYTLNEDELETVRELEKQLEELEAQYDQLVERIAEK 370 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.133 0.368 Gapped Lambda K H 0.267 0.0623 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,930,441 Number of extensions: 444410 Number of successful extensions: 1039 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1030 Number of HSP's successfully gapped: 83 Length of query: 440 Length of database: 5,994,473 Length adjustment: 96 Effective length of query: 344 Effective length of database: 3,920,105 Effective search space: 1348516120 Effective search space used: 1348516120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 59 (26.7 bits)