>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A

Probab=90.92 E-value=1 Score=22.88 Aligned_cols=102 Identities=12% Similarity=0.110 Sum_probs=68.5 Q ss_pred CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHH-CCCEEEEEEECCCCCC Q ss_conf 777776458899999862366665444456677750699999606688885408999999998-7968999994378874 Q gi|254780388|r 333 EMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKS-QGIRIMTIAFSVNKTQ 411 (458) Q Consensus 333 ~~g~T~~~~gl~~g~~~Ls~~~~~~~~~~~~~~~~~K~iil~TDG~n~~~~~~~~~~C~~~K~-~gI~IytI~f~~~~~~ 411 (458) T Consensus 87 C~sGD~Tlea~~~Ai~~l~a~~----------d~De~fVivlSDANL~RYgI~p~~l~~~l~~~p~V~a~~IfIgslg~e 156 (191) T cd01455 87 CWSGDHTVEATEFAIKELAAKE----------DFDEAIVIVLSDANLERYGIQPKKLADALAREPNVNAFVIFIGSLSDE 156 (191) T ss_pred EECCCCHHHHHHHHHHHHHHCC----------CCCCCEEEEECCCCHHHCCCCHHHHHHHHHCCCCCCEEEEEEECHHHH T ss_conf 0258844899999999875302----------677608999814764431889899999973387766899997351679 Q ss_pred CCHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHH Q ss_conf 3117899986068983788299899999999998758 Q gi|254780388|r 412 QEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNE 448 (458) Q Consensus 412 ~~~~~~~lk~CAs~~~yy~a~~~~eL~~aF~~~i~~~ 448 (458) T Consensus 157 ---A~-~l~~~lP~G~~fVc~dt~~lP~il~qIfts~ 189 (191) T cd01455 157 ---AD-QLQRELPAGKAFVCMDTSELPHIMQQIFTST 189 (191) T ss_pred ---HH-HHHHHCCCCCEEEECCHHHHHHHHHHHHHHH T ss_conf ---99-9997489974178536536789999998874

HHsearch alignment for GI: 254780388 and conserved domain: cd01455