BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780390|ref|YP_003064803.1| nucleoside diphosphate kinase [Candidatus Liberibacter asiaticus str. psy62] (140 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780390|ref|YP_003064803.1| nucleoside diphosphate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 140 Score = 290 bits (742), Expect = 7e-81, Method: Compositional matrix adjust. Identities = 140/140 (100%), Positives = 140/140 (100%) Query: 1 MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60 MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF Sbjct: 1 MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60 Query: 61 PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120 PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD Sbjct: 61 PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120 Query: 121 SLKTALEEISYWFARNEIIG 140 SLKTALEEISYWFARNEIIG Sbjct: 121 SLKTALEEISYWFARNEIIG 140 >gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 22.7 bits (47), Expect = 2.8, Method: Compositional matrix adjust. Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 9/53 (16%) Query: 89 VMGDTDPKKALKGTIRNKYGISIGENSIHGS---------DSLKTALEEISYW 132 +M ++ KA+ T NK IS+G +++G D KT + +++ W Sbjct: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASW 443 >gi|254781026|ref|YP_003065439.1| hypothetical protein CLIBASIA_04640 [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 22.7 bits (47), Expect = 2.8, Method: Compositional matrix adjust. Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Query: 51 YLIHKDRPFFPE----LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPK 96 Y ++RPF + A+I G LQVL GE++++ N + D P+ Sbjct: 45 YSFIQNRPFRSPHHSVTIAALIGG--GLQVLPGEDSLAHNGVLFLDEIPE 92 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.137 0.402 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,074 Number of Sequences: 1233 Number of extensions: 3319 Number of successful extensions: 5 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 4 length of query: 140 length of database: 328,796 effective HSP length: 66 effective length of query: 74 effective length of database: 247,418 effective search space: 18308932 effective search space used: 18308932 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 34 (17.7 bits)