BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780391|ref|YP_003064804.1| DNA polymerase III subunit chi [Candidatus Liberibacter asiaticus str. psy62] (141 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780391|ref|YP_003064804.1| DNA polymerase III subunit chi [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 291 bits (746), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 141/141 (100%), Positives = 141/141 (100%) Query: 1 MRTLLFYRFKNDWEYNLLVLLQDEYEKGKRVSVQCGSERVRDSLNEYLWTWKKDGFLPHG 60 MRTLLFYRFKNDWEYNLLVLLQDEYEKGKRVSVQCGSERVRDSLNEYLWTWKKDGFLPHG Sbjct: 1 MRTLLFYRFKNDWEYNLLVLLQDEYEKGKRVSVQCGSERVRDSLNEYLWTWKKDGFLPHG 60 Query: 61 VDVGDEGDFSSFQPVLLTISSLNANTSTIRFLVDEASMHIGDVDYYEKVVFIINTDDQGS 120 VDVGDEGDFSSFQPVLLTISSLNANTSTIRFLVDEASMHIGDVDYYEKVVFIINTDDQGS Sbjct: 61 VDVGDEGDFSSFQPVLLTISSLNANTSTIRFLVDEASMHIGDVDYYEKVVFIINTDDQGS 120 Query: 121 LEWGRAHWRSLKNSGYAPDVI 141 LEWGRAHWRSLKNSGYAPDVI Sbjct: 121 LEWGRAHWRSLKNSGYAPDVI 141 >gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Score = 24.3 bits (51), Expect = 0.94, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 6/58 (10%) Query: 84 ANTSTIR-FLVDEASMHIGDVDYY-----EKVVFIINTDDQGSLEWGRAHWRSLKNSG 135 AN T++ FL D+ + V Y + V IINT+D G + +G A R+L G Sbjct: 78 ANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIG 135 >gi|254781074|ref|YP_003065487.1| uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 21.9 bits (45), Expect = 4.7, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 2 RTLLFYRFKNDWEYNLLVLLQDEYEKGKRV 31 ++LL F+++ NL L E KGKR+ Sbjct: 11 KSLLENHFQSEHMRNLKEFLLSEKRKGKRI 40 >gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Score = 21.2 bits (43), Expect = 7.5, Method: Compositional matrix adjust. Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 41 RDSLNEYLWTWKKDG 55 RD+ E +W WKK+ Sbjct: 111 RDAFIEKVWEWKKES 125 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.138 0.431 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,937 Number of Sequences: 1233 Number of extensions: 3776 Number of successful extensions: 7 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 4 length of query: 141 length of database: 328,796 effective HSP length: 66 effective length of query: 75 effective length of database: 247,418 effective search space: 18556350 effective search space used: 18556350 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 34 (17.7 bits)