>pfam05698 Trigger_C Bacterial trigger factor protein (TF) C-terminus. In the E. coli cytosol, a fraction of the newly synthesized proteins requires the activity of molecular chaperones for folding to the native state. The major chaperones implicated in this folding process are the ribosome-associated Trigger Factor (TF), and the DnaK and GroEL chaperones with their respective co-chaperones. Trigger Factor is an ATP-independent chaperone and displays chaperone and peptidyl-prolyl-cis-trans-isomerase (PPIase) activities in vitro. It is composed of at least three domains, an N-terminal domain which mediates association with the large ribosomal subunit, a central substrate binding and PPIase domain with homology to FKBP proteins, and a C-terminal domain of unknown function. The positioning of TF at the peptide exit channel, together with its ability to interact with nascent chains as short as 57 residues renders TF a prime candidate for being the first chaperone that binds to the nascent p

Probab=96.15 E-value=0.067 Score=30.83 Aligned_cols=100 Identities=13% Similarity=0.101 Sum_probs=54.8 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHC----CCCCHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHH Q ss_conf 99999999999864200122344456689999999731----3430356777765311245546999999----899999 Q gi|254780396|r 76 AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT----GLSAEDFSSFLDKQGIGDNHFKQYLAIQ----SIWPDV 147 (317) Q Consensus 76 ~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~~~~~~----~~~~~~~~~~l~~~g~t~~~~~~~i~~~----l~~~~~ 147 (317) T Consensus 20 ~~~~~~~~~i~~~L~~~~~~evP~~~v~~e~~~~~~~~~~~~~~~g~~~e~~~~~~~~~~e~~~~~~~~~A~~~vk~~li 99 (162) T pfam05698 20 ATAEELKEAILDKLVENAEIELPESLVEEEIDRLLRQFLQQLQGQGLDLEEYLSLSGSSEEELREEFKEEAEKRVKLGLI 99 (162) T ss_pred HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999987889999999999999999999999876699888887652564788878889999999999999 Q ss_pred HHHHH-HHHCCCCHHHHHHHHHHHHHHCC Q ss_conf 99984-32035558999864432111001 Q gi|254780396|r 148 VKNDF-MLKYGNLEMEIPANKQKMKNITV 175 (317) Q Consensus 148 ~~~~~-~~~i~~~~~e~~~~~~~~~~~~~ 175 (317) T Consensus 100 l~~Ia~~e~i~vs~eev~~~i~~~a~~~~ 128 (162) T pfam05698 100 LEEIAKEEKIEVTDEEIKEEIEELASQYG 128 (162) T ss_pred HHHHHHHCCCCCCHHHHHHHHHHHHHHCC T ss_conf 99999880899899999999999998869

HHsearch alignment for GI: 254780396 and conserved domain: pfam05698