RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus Liberibacter asiaticus str. psy62] (317 letters) >gnl|CDD|35718 KOG0497, KOG0497, KOG0497, Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism]. Length = 760 Score = 29.5 bits (66), Expect = 1.3 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQN 255 RI D L + +D K++ F S++ D + Q LL + L +F++ L K+ + Sbjct: 396 RIPDF----LWIAEDGMKMQGFNSQLWDTAFA-LQALLAAGLVDEFRSTLVKAYD 445 >gnl|CDD|35787 KOG0567, KOG0567, KOG0567, HEAT repeat-containing protein [General function prediction only]. Length = 289 Score = 28.8 bits (64), Expect = 1.9 Identities = 24/118 (20%), Positives = 51/118 (43%), Gaps = 10/118 (8%) Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN 259 K +++ E ++ + + ++K A+ +S+ A S +H LL +++ Sbjct: 114 KEVRETCELAIKRLEWKDIIDKIANSSPYISVDPAPPANLSSVHELRAELLDETKPLFE- 172 Query: 260 PYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYV-KKLRSNAIIHY 316 Y A+ R++G E A+ A + + + +HE +V +L+S A I Sbjct: 173 --------RYRAMFYLRNIGTEEAINALIDGLADDSALFRHEVAFVFGQLQSPAAIPS 222 >gnl|CDD|35340 KOG0117, KOG0117, KOG0117, Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]. Length = 506 Score = 27.6 bits (61), Expect = 4.1 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 8/41 (19%) Query: 163 IPANKQK------MKNITVREYLIRTVLFSIPDNKLQNQGF 197 IP K+K MK +T E ++ +++ PD+K +N+GF Sbjct: 172 IPKTKKKEEILEEMKKVT--EGVVDVIVYPSPDDKTKNRGF 210 >gnl|CDD|32897 COG3083, COG3083, Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only]. Length = 600 Score = 27.6 bits (61), Expect = 4.2 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 122 SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV 175 SFL+K G+ D + ++ PD ++ L+ L + PA+ + ITV Sbjct: 216 SFLEKHGLLDAQEYRRRLVEQGNPDASSLNYPLR--PLTISDPAHGPNILLITV 267 >gnl|CDD|33326 COG3523, IcmF, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 1188 Score = 27.2 bits (60), Expect = 5.6 Identities = 12/35 (34%), Positives = 14/35 (40%), Gaps = 5/35 (14%) Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150 S DF F G+ D+ F Q LA P V Sbjct: 988 SLADFERFFGPDGVLDSFFAQNLA-----PFVDTA 1017 >gnl|CDD|33749 COG3968, COG3968, Uncharacterized protein related to glutamine synthetase [General function prediction only]. Length = 724 Score = 27.3 bits (60), Expect = 6.0 Identities = 20/96 (20%), Positives = 39/96 (40%), Gaps = 13/96 (13%) Query: 40 SRIRTTINGEVITDGDISKRIALLKLQKIN-----GELEKIAVQELIVETLKKQEIEKSG 94 RI V + R+ + + GE ++V + + + +K+ +EK Sbjct: 26 ERIEKMFAENVFNLAVMKARLTKPTFKALKKTIDKGESLDVSVADEVAKAMKEWAMEKGA 85 Query: 95 ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130 + ++F TGL+AE +F+D +G G Sbjct: 86 THY----THWFQPL----TGLTAEKHDAFIDPEGDG 113 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0716 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,621,642 Number of extensions: 185416 Number of successful extensions: 491 Number of sequences better than 10.0: 1 Number of HSP's gapped: 491 Number of HSP's successfully gapped: 14 Length of query: 317 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 223 Effective length of database: 4,232,491 Effective search space: 943845493 Effective search space used: 943845493 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (25.8 bits)