RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus Liberibacter asiaticus str. psy62] (317 letters) >gnl|CDD|150092 pfam09312, SurA_N, SurA N-terminal domain. This domain is found at the N-terminus of the chaperone SurA. It is a helical domain of unknown function. The C-terminus of the SurA protein folds back and forms part of this domain also but is not included in the current alignment. Length = 118 Score = 44.2 bits (105), Expect = 4e-05 Identities = 23/104 (22%), Positives = 49/104 (47%), Gaps = 8/104 (7%) Query: 41 RIRTTINGEVITDGDISKRIALLK--LQKINGE------LEKIAVQELIVETLKKQEIEK 92 RI +N VI ++ +R+ +K L K + L + ++ LI+E ++ Q E+ Sbjct: 3 RIVAVVNDGVILQSELDRRVKTVKRQLAKQGTQLPPDAVLRRQVLERLILERIQLQMAER 62 Query: 93 SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136 +GI D +N + A+ ++ + + L G+ + F++ Sbjct: 63 TGIRVDDEQLNQAIARIAQQNNMTLDQLRAALAADGLSYDEFRE 106 >gnl|CDD|185599 PTZ00408, PTZ00408, NAD-dependent deacetylase; Provisional. Length = 242 Score = 29.0 bits (65), Expect = 1.5 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query: 114 GLSAED-FSSFLDKQGIGDNHFKQYLAIQSIW---PDVVK 149 G+SAE S+F D G+ +NH + +A + P +V+ Sbjct: 14 GISAESGISTFRDGNGLWENHRVEDVATPDAFLRNPALVQ 53 >gnl|CDD|148380 pfam06744, DUF1215, Protein of unknown function (DUF1215). This family represents a conserved region situated towards the C-terminal end of several hypothetical bacterial proteins of unknown function. A few members resemble the ImcF protein, which has been proposed to be involved in Vibrio cholerae cell surface reorganisation that results in increased adherence to epithelial cells line and increased conjugation frequency. Length = 125 Score = 29.2 bits (66), Expect = 1.6 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139 Y F + + +S DF+ F G+ D+ F LA Sbjct: 54 RYPFAPDSSSD-VSLADFARFFGPGGLLDSFFDTNLA 89 >gnl|CDD|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional. Length = 407 Score = 27.8 bits (61), Expect = 3.7 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 3/84 (3%) Query: 55 DISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG 114 D+ K+ LL++ EL A ++E K QE E S + + +N R Sbjct: 85 DLLKKEKLLEMLAAGAEL---AQSTPLLEERKTQEEELSAMRLELAALNRELAVKMREER 141 Query: 115 LSAEDFSSFLDKQGIGDNHFKQYL 138 DF FL +GI D + ++ Sbjct: 142 EQNSDFVKFLKGRGISDTYVADFM 165 >gnl|CDD|162042 TIGR00796, livcs, branched-chain amino acid uptake carrier. transmembrane helical spanners. Length = 378 Score = 27.3 bits (61), Expect = 5.0 Identities = 12/40 (30%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Query: 4 KVFTSLSDFIKLLTTYFVLIIFC------IVPIVSYKSWA 37 L + LTT L C +VP +SYK+W Sbjct: 270 SFLLGLIITLACLTTAVGLTTACSEYFHKLVPKLSYKTWV 309 >gnl|CDD|178080 PLN02461, PLN02461, Probable pyruvate kinase. Length = 511 Score = 26.9 bits (60), Expect = 7.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 6/31 (19%) Query: 146 DVVKND--FMLKYGNLEMEIPANK----QKM 170 D++ FM+ G+L MEIP K QKM Sbjct: 253 DILAESDAFMVARGDLGMEIPIEKIFLAQKM 283 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0729 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,978,839 Number of extensions: 312281 Number of successful extensions: 718 Number of sequences better than 10.0: 1 Number of HSP's gapped: 717 Number of HSP's successfully gapped: 22 Length of query: 317 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 224 Effective length of database: 3,984,929 Effective search space: 892624096 Effective search space used: 892624096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (25.7 bits)