Query         gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 71
No_of_seqs    109 out of 273
Neff          3.2 
Searched_HMMs 13730
Date          Wed Jun  1 03:24:50 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780400.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1qr0a1 d.150.1.1 (A:1-101) 4'  56.4     3.4 0.00024   21.2   2.5   17   18-34     85-101 (101)
  2 d1iwma_ b.125.1.2 (A:) Outer m  53.4     3.7 0.00027   21.0   2.3   44    4-47     58-110 (177)
  3 d1zvpa1 d.58.18.9 (A:2-67) Hyp  42.4     7.4 0.00054   19.1   2.4   16   20-35     15-30  (66)
  4 d1dzla_ b.121.6.1 (A:) Papillo  34.6     2.9 0.00021   21.6  -0.7   24   32-55    415-438 (455)
  5 d1bdfa2 d.181.1.1 (A:53-178) R  30.0       9 0.00066   18.6   1.2   25   15-40     65-89  (126)
  6 d1vpma_ d.38.1.1 (A:) Acyl-CoA  29.8      13 0.00097   17.6   2.1   44   15-58     99-144 (155)
  7 d1vetb_ d.110.7.1 (B:) Late en  29.2      21  0.0015   16.4   3.0   37    8-44     70-106 (118)
  8 d1bcoa1 b.48.1.1 (A:481-560) m  20.0     6.7 0.00049   19.4  -1.0   30   23-55     19-48  (80)
  9 g1pya.1 d.155.1.1 (A:,B:) Hist  19.7      21  0.0015   16.5   1.5   14   22-35    144-157 (310)
 10 d2oq1a1 d.93.1.1 (A:5-134) Tyr  18.6      36  0.0026   15.0   3.0   51   15-66     28-88  (130)

No 1  
>d1qr0a1 d.150.1.1 (A:1-101) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]}
Probab=56.40  E-value=3.4  Score=21.20  Aligned_cols=17  Identities=29%  Similarity=0.581  Sum_probs=15.4

Q ss_pred             CEEEEECCCEEEEEECC
Q ss_conf             80992079889984149
Q gi|254780400|r   18 TFEIIRPGTYVVCAITG   34 (71)
Q Consensus        18 ~F~ii~~G~yV~CAVsg   34 (71)
                      +|-|=-.|++|+||||-
T Consensus        85 ~FNiSHsg~~vv~avss  101 (101)
T d1qr0a1          85 HFNISHSGRWVIGAFDS  101 (101)
T ss_dssp             EEEEEEETTEEEEEEES
T ss_pred             EEEECCCCCEEEEEEEC
T ss_conf             89954667819999849


No 2  
>d1iwma_ b.125.1.2 (A:) Outer membrane lipoprotein receptor LolB {Escherichia coli [TaxId: 562]}
Probab=53.37  E-value=3.7  Score=20.97  Aligned_cols=44  Identities=23%  Similarity=0.422  Sum_probs=33.3

Q ss_pred             CCCCCEEEEEECCCCEEEEECCCEEEEE---------ECCCEECHHHCCCCCH
Q ss_conf             2377669999849980992079889984---------1496706776542778
Q gi|254780400|r    4 KVDENEASIRYKDGTFEIIRPGTYVVCA---------ITGQRIPLKKLCYWSV   47 (71)
Q Consensus         4 km~~~~Akl~Y~~~~F~ii~~G~yV~CA---------Vsgk~IpL~~L~YWnV   47 (71)
                      -++.+.++|.=.++...++.....+.-|         ++|-.||++.|+||=-
T Consensus        58 plG~~~~~i~~~~~~~~l~~~dg~~~~a~~~e~Ll~~~lG~~lPv~~L~~Wl~  110 (177)
T d1iwma_          58 PLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWIL  110 (177)
T ss_dssp             TTSCEEEEEEEETTEEEEECTTSCEEEESCHHHHHHHHHSCCCCHHHHHHHTT
T ss_pred             CCCCEEEEEEECCCEEEEEECCCCEEECCCHHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             46543999998699799996899889679999999998788467899999971


No 3  
>d1zvpa1 d.58.18.9 (A:2-67) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]}
Probab=42.37  E-value=7.4  Score=19.14  Aligned_cols=16  Identities=31%  Similarity=0.796  Sum_probs=13.1

Q ss_pred             EEEECCCEEEEEECCC
Q ss_conf             9920798899841496
Q gi|254780400|r   20 EIIRPGTYVVCAITGQ   35 (71)
Q Consensus        20 ~ii~~G~yV~CAVsgk   35 (71)
                      -++.+|+||-|.+.+.
T Consensus        15 P~L~~g~yVF~t~~~~   30 (66)
T d1zvpa1          15 PELMAGDYVFCTVNGA   30 (66)
T ss_dssp             EEECSSCEEEEEECSC
T ss_pred             CEECCCCEEEEEECCC
T ss_conf             6678996899998885


No 4  
>d1dzla_ b.121.6.1 (A:) Papillomavirus L1 protein {Human papillomavirus type 16 [TaxId: 333760]}
Probab=34.63  E-value=2.9  Score=21.62  Aligned_cols=24  Identities=25%  Similarity=0.553  Sum_probs=20.3

Q ss_pred             ECCCEECHHHCCCCCHHHCCCCCC
Q ss_conf             149670677654277878072259
Q gi|254780400|r   32 ITGQRIPLKKLCYWSVDRQVPYAN   55 (71)
Q Consensus        32 Vsgk~IpL~~L~YWnVe~QEaY~s   55 (71)
                      -..|+-|..++++|+||+.|-..+
T Consensus       415 p~ek~DPy~~~~FW~VDL~er~S~  438 (455)
T d1dzla_         415 PAPKEDPLKKYTFWEVNLKEKFSA  438 (455)
T ss_dssp             CCCCCCTTTTSCCEEEECTTCCBS
T ss_pred             CCCCCCCCCCCCEEEECCCHHCCC
T ss_conf             988889755772135446110254


No 5  
>d1bdfa2 d.181.1.1 (A:53-178) RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
Probab=29.97  E-value=9  Score=18.62  Aligned_cols=25  Identities=32%  Similarity=0.772  Sum_probs=18.7

Q ss_pred             CCCCEEEEECCCEEEEEECCCEECHH
Q ss_conf             49980992079889984149670677
Q gi|254780400|r   15 KDGTFEIIRPGTYVVCAITGQRIPLK   40 (71)
Q Consensus        15 ~~~~F~ii~~G~yV~CAVsgk~IpL~   40 (71)
                      .|.+++|+.| |+++|.+|.+...|+
T Consensus        65 ~~~~veIvNp-d~~Iatlt~~~~~l~   89 (126)
T d1bdfa2          65 HDGDVEIVKP-QHVICHLTDENASIS   89 (126)
T ss_dssp             CCSSCEESCT-TCEEEEECSTTCEEE
T ss_pred             CCCCEEEECC-CEEEEEEECCCCEEE
T ss_conf             7898799677-639999804785089


No 6  
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}
Probab=29.76  E-value=13  Score=17.63  Aligned_cols=44  Identities=16%  Similarity=0.231  Sum_probs=34.4

Q ss_pred             CCCCEEEEECCCEEEEEE--CCCEECHHHCCCCCHHHCCCCCCHHH
Q ss_conf             499809920798899841--49670677654277878072259999
Q gi|254780400|r   15 KDGTFEIIRPGTYVVCAI--TGQRIPLKKLCYWSVDRQVPYANAEA   58 (71)
Q Consensus        15 ~~~~F~ii~~G~yV~CAV--sgk~IpL~~L~YWnVe~QEaY~s~e~   58 (71)
                      ..+..+.+-.+.++..||  .|+++|+..|...+-+-++-|..+.+
T Consensus        99 ~~~~~~~~~~~~ftfVavd~~gkp~~vp~l~p~t~ee~~~~~~a~~  144 (155)
T d1vpma_          99 LTGERTLTTESFLTMVAVDESGKPKPVPQVEPQTEEEKRLYETAPA  144 (155)
T ss_dssp             TTCCEEEEEEEEEEEEEECTTSCBCCCCEEECCSHHHHHHHHHHHH
T ss_pred             CCCCEEEEEEEEEEEEEECCCCCEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             9992899767999999976899724779535799999999999999


No 7  
>d1vetb_ d.110.7.1 (B:) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=29.24  E-value=21  Score=16.45  Aligned_cols=37  Identities=14%  Similarity=0.231  Sum_probs=34.0

Q ss_pred             CEEEEEECCCCEEEEECCCEEEEEECCCEECHHHCCC
Q ss_conf             6699998499809920798899841496706776542
Q gi|254780400|r    8 NEASIRYKDGTFEIIRPGTYVVCAITGQRIPLKKLCY   44 (71)
Q Consensus         8 ~~Akl~Y~~~~F~ii~~G~yV~CAVsgk~IpL~~L~Y   44 (71)
                      .+..++|..|..-+...|+.++|.++...-.|.-|+|
T Consensus        70 ~qviie~~~G~l~i~~~g~~~L~vla~~~~~lGll~~  106 (118)
T d1vetb_          70 KFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKA  106 (118)
T ss_dssp             CEEEEEETTEEEEEEEETTEEEEEEECTTSCHHHHHH
T ss_pred             EEEEEECCCCEEEEEECCCCEEEEEECCCCCCHHHHH
T ss_conf             8999991997999999222739999469988048999


No 8  
>d1bcoa1 b.48.1.1 (A:481-560) mu transposase, C-terminal domain {Bacteriophage mu [TaxId: 10677]}
Probab=19.98  E-value=6.7  Score=19.40  Aligned_cols=30  Identities=17%  Similarity=0.259  Sum_probs=20.5

Q ss_pred             ECCCEEEEEECCCEECHHHCCCCCHHHCCCCCC
Q ss_conf             079889984149670677654277878072259
Q gi|254780400|r   23 RPGTYVVCAITGQRIPLKKLCYWSVDRQVPYAN   55 (71)
Q Consensus        23 ~~G~yV~CAVsgk~IpL~~L~YWnVe~QEaY~s   55 (71)
                      ++|.+-+  +.|+.|-+.+.+|||.+|-. |.+
T Consensus        19 r~G~~~l--~~~g~i~~~~n~Y~~~~L~~-~~G   48 (80)
T d1bcoa1          19 RKGEFTL--KVGGSLKGAKNVYYNMALMN-AGV   48 (80)
T ss_dssp             TTSEEEE--EECTTSCCEEEEEECGGGTS-SSC
T ss_pred             CCCEEEE--CCCCEEEECCCEEECHHHHH-CCC
T ss_conf             4865996--05744896793798889984-049


No 9  
>g1pya.1 d.155.1.1 (A:,B:) Histidine decarboxylase {Lactobacillus sp., strain 30a [TaxId: 1591]}
Probab=19.73  E-value=21  Score=16.48  Aligned_cols=14  Identities=43%  Similarity=0.961  Sum_probs=10.6

Q ss_pred             EECCCEEEEEECCC
Q ss_conf             20798899841496
Q gi|254780400|r   22 IRPGTYVVCAITGQ   35 (71)
Q Consensus        22 i~~G~yV~CAVsgk   35 (71)
                      .-||.||+||.-+-
T Consensus       144 ~~PGa~vicAnK~v  157 (310)
T g1pya.1         144 PAPGSFIVCANKGV  157 (310)
T ss_dssp             BCTTCEEEEEEEEE
T ss_pred             CCCCCEEEECCCCC
T ss_conf             99974687404653


No 10 
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}
Probab=18.60  E-value=36  Score=15.02  Aligned_cols=51  Identities=16%  Similarity=0.193  Sum_probs=32.8

Q ss_pred             CCCCEEEE----ECCCEEEEEECCCEEC---H---HHCCCCCHHHCCCCCCHHHHHHHHHHH
Q ss_conf             49980992----0798899841496706---7---765427787807225999999999984
Q gi|254780400|r   15 KDGTFEII----RPGTYVVCAITGQRIP---L---KKLCYWSVDRQVPYANAEASFEAEKIS   66 (71)
Q Consensus        15 ~~~~F~ii----~~G~yV~CAVsgk~Ip---L---~~L~YWnVe~QEaY~s~e~~~~r~~~~   66 (71)
                      -+|.|-|-    .+|+||++-.++.+|-   +   ++-. ..++-+..+.|..+-+..++..
T Consensus        28 ~~G~FLVR~S~~~~g~yvLSv~~~~~v~H~~I~~~~~g~-~~l~~~~~F~sl~~Lv~~Y~~~   88 (130)
T d2oq1a1          28 ADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGT-YAIAGGKAHCGPAELCEFYSRD   88 (130)
T ss_dssp             CTTCEEEEECSSSTTCEEEEEEETTEEEEEEEEECTTSC-EEETTSCCBSSHHHHHHHHHHC
T ss_pred             CCCEEEEEECCCCCCCEEEEEEECCCEEEEEEEECCCCC-EECCCCCCCCCHHHHHHHHHHC
T ss_conf             884089873699886479987618723789878868996-6636997759999999998248


Done!