RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780400|ref|YP_003064813.1| hypothetical protein CLIBASIA_01425 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A Length = 531 Score = 24.9 bits (54), Expect = 4.7 Identities = 4/18 (22%), Positives = 7/18 (38%) Query: 28 VVCAITGQRIPLKKLCYW 45 V+ IT Q + + Sbjct: 502 VIKIITKQFVIFNNTYIY 519 >2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3e33_B* 1d8e_B* 1fpp_B* ... Length = 437 Score = 24.2 bits (52), Expect = 6.4 Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 11/55 (20%) Query: 10 ASIRYKDGTFEIIRP----GTYVVCAITG-------QRIPLKKLCYWSVDRQVPY 53 A + +G + G Y C + + + LK L W RQ+ + Sbjct: 230 ARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRF 284 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.318 0.136 0.412 Gapped Lambda K H 0.267 0.0549 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 633,624 Number of extensions: 23375 Number of successful extensions: 78 Number of sequences better than 10.0: 1 Number of HSP's gapped: 78 Number of HSP's successfully gapped: 4 Length of query: 71 Length of database: 5,693,230 Length adjustment: 41 Effective length of query: 30 Effective length of database: 4,699,226 Effective search space: 140976780 Effective search space used: 140976780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.4 bits)