HHsearch alignment for GI: 254780402 and conserved domain: COG3914

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
Probab=94.14  E-value=0.48  Score=26.55  Aligned_cols=295  Identities=8%  Similarity=0.048  Sum_probs=150.6

Q ss_pred             HHHHHHHHHHHHHHCCCCEEE-EECCCCCCHHHHCCCCCCEEEEE--CCCCCCHHHHHHHHHHCCEEEEEECCCCHHHHH
Q ss_conf             999999999999861998999-96277630012101477416885--055720134455744202035640476214678
Q gi|254780402|r   68 ETMALIGLIPAIRSRHVNVLL-TTMTATSAKVARKYLGQYAIHQY--APLDIQPAVSRFLKYWKPDCMILSESDIWPLTV  144 (440)
Q Consensus        68 E~~~a~pli~~l~~~~~~ili-T~~T~tg~~~~~~~~~~~~~~~y--~P~D~~~~~~~fl~~~~P~~~i~~e~ElWPnli  144 (440)
T Consensus       274 vg~l~~~v~e~hDRdkfEvfay~~g~~-~~dal~~rI~a~~~~~~~~~~~dd~e~a~~I~~-d~IdILvDl~g~T~d~r~  351 (620)
T COG3914         274 VGFLLRWVFEYHDRDKFEVFAYSLGPP-HTDALQERISAAVEKWYPIGRMDDAEIANAIRT-DGIDILVDLDGHTVDTRC  351 (620)
T ss_pred             HHHHHHHHHHHHCHHHEEEEEEECCCC-CCHHHHHHHHHHHHHEECCCCCCHHHHHHHHHH-CCCEEEEECCCCEECCCH
T ss_conf             899999999873500158999965887-731678888876531410588688999999872-587099965672103400


Q ss_pred             HHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEE----ECCHHHHHHHHHHC--CCCEEEECCCCCCCCCC
Q ss_conf             8874224550586412665421210011112331026442366----41577888998608--85058720431012344
Q gi|254780402|r  145 FELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVI----VQSERYFRRYKELG--AQKLIVSGNLKIDTESL  218 (440)
Q Consensus       145 ~~~~~~~ip~~linarls~~S~~~~~~~~~l~~~~~~~~~~i~----~qs~~~~~rl~~lG--~~~i~v~GnlK~d~~~~  218 (440)
T Consensus       352 ~v~A~RpAPiq-vs------------wlGy~aT~g~p~~DY~I~D~y~vPp~ae~yysEkl~RLp-~cy~p~d~~~~v~p  417 (620)
T COG3914         352 QVFAHRPAPIQ-VS------------WLGYPATTGSPNMDYFISDPYTVPPTAEEYYSEKLWRLP-QCYQPVDGFEPVTP  417 (620)
T ss_pred             HHHHCCCCCEE-EE------------ECCCCCCCCCCCCEEEEECCEECCCHHHHHHHHHHHHCC-CCCCCCCCCCCCCC
T ss_conf             36635777648-76------------226566668876307850760368147789989987330-13688777565889


Q ss_pred             CCCHHHHHHHHHHCCCCCEEECC-CCCCCCCCCCCCCCCCCCCCCCEEEEEEEC--CCCHHHHHHHHHHHHCCHHHHHC-
Q ss_conf             22125689999861798617504-655332100000000001234124889705--52114788877653001011001-
Q gi|254780402|r  219 PCDKELLSLYQESIAGRYTWAAI-STFEGEEDKAVYVHNFIKCRTDVLTIIVPR--HPRRCDAIERRLIAKGLKVARRS-  294 (440)
Q Consensus       219 ~~~~~~~~~~~~~~~~r~v~vag-Sth~~EE~~il~a~~~l~~~~~~~lIIvPR--hpeR~~~i~~~l~~~gl~~~~~S-  294 (440)
T Consensus       418 ~~sR~~l----glp~~avVf~c~~n~~K~~pev~~~wmqIL~~vP~Svl~L~~~~~~~~~~~~l~~la~~~Gv~~eRL~f  493 (620)
T COG3914         418 PPSRAQL----GLPEDAVVFCCFNNYFKITPEVFALWMQILSAVPNSVLLLKAGGDDAEINARLRDLAEREGVDSERLRF  493 (620)
T ss_pred             CCCHHHC----CCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCHHHEEE
T ss_conf             9432105----999980899966886447879999999999848985799826898688999999999970898133462


Q ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHCCCEEEECCCCCCCCC-CHHHHHHHCCCEEECCCCCCHHH--HHHHHHHCCCEE
Q ss_conf             344444664167506765202554220820661355444545-83768961994999898443799--999999789869
Q gi|254780402|r  295 RGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQ-NPLEAAMLGCAILSGPNVENFRD--IYRRMVSSGAVR  371 (440)
Q Consensus       295 ~~~~~~~~~~V~i~Dt~GeL~~lY~~AdiafVGGSl~~~GGh-N~lEpaa~G~pVi~GP~~~nf~e--~~~~L~~~g~~~  371 (440)
T Consensus       494 ~p~~~~~-----------~h~a~~~iADlv--LDTy-PY~g~TTa~daLwm~vPVlT~~G~-~FasR~~~si~~~agi~e  558 (620)
T COG3914         494 LPPAPNE-----------DHRARYGIADLV--LDTY-PYGGHTTASDALWMGVPVLTRVGE-QFASRNGASIATNAGIPE  558 (620)
T ss_pred             CCCCCCH-----------HHHHHHCHHHEE--EECC-CCCCCCCHHHHHHHCCCEEEECCH-HHHHHHHHHHHHHCCCCH
T ss_conf             6999988-----------999862313246--5246-678864267778735844651117-788760599998669802


Q ss_pred             E-ECCHHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             9-5798999999999958989999999
Q gi|254780402|r  372 I-VEEVGTLADMVYSLLSEPTIRYEMI  397 (440)
Q Consensus       372 ~-v~d~~eL~~~l~~ll~d~~~~~~~~  397 (440)
T Consensus       559 ~vA~s~~dYV~~av~~g~dral~q~~r  585 (620)
T COG3914         559 LVADSRADYVEKAVAFGSDRALRQQVR  585 (620)
T ss_pred             HHCCCHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             421888899999998534177787557