HHsearch alignment for GI: 254780402 and conserved domain: KOG0853

>KOG0853 consensus.
Probab=98.00  E-value=3.6e-05  Score=53.63  Aligned_cols=226  Identities=15%  Similarity=0.110  Sum_probs=124.9

Q ss_pred             HHCCCCCCEEEECCHHHHHHHH----HHCCCCEEEEC---CC-CCCCCCCCCCHH--HHHHHHHHCC--CCCEEECCCCC
Q ss_conf             3102644236641577888998----60885058720---43-101234422125--6899998617--98617504655
Q gi|254780402|r  177 KKIFSQFSLVIVQSERYFRRYK----ELGAQKLIVSG---NL-KIDTESLPCDKE--LLSLYQESIA--GRYTWAAISTF  244 (440)
Q Consensus       177 ~~~~~~~~~i~~qs~~~~~rl~----~lG~~~i~v~G---nl-K~d~~~~~~~~~--~~~~~~~~~~--~r~v~vagSth  244 (440)
T Consensus       204 ~e~~~~~~~~~~ns~~~~~~f~~~~~~L~~~d~~~~y~ei~~s~~~~~~~~~~~~~~~~~r~~~~v~~~d~~~~siN~~~  283 (495)
T KOG0853         204 EETTGLAWKILVNSYFTKRQFKATFVSLSNSDITSTYPEIDGSWFTYGQYESHLELRLPVRLYRGVSGIDRFFPSINRFE  283 (495)
T ss_pred             HHHHHHCCEEECCHHHHHHHHHHHHHHCCCCCCCEEECCCCHHHCCCCCCCCCHHCCCCCCEEEECCCCCEEEEEEEECC
T ss_conf             45431015172214666654453553057888614632424011255542111010255422430046646754566417


Q ss_pred             CCC-CCCCCCCCCCCCC-C-----CCEEEEEEE------CCCCH---HHHHHHHHHHHCCHHHHHCCCCCCCCCCEEEEE
Q ss_conf             332-1000000000012-3-----412488970------55211---478887765300101100134444466416750
Q gi|254780402|r  245 EGE-EDKAVYVHNFIKC-R-----TDVLTIIVP------RHPRR---CDAIERRLIAKGLKVARRSRGDVINAEVDIFLG  308 (440)
Q Consensus       245 ~~E-E~~il~a~~~l~~-~-----~~~~lIIvP------RhpeR---~~~i~~~l~~~gl~~~~~S~~~~~~~~~~V~i~  308 (440)
T Consensus       284 pgkd~~l~l~a~~~~~~~i~~~~~~~~hl~~~g~~G~d~~~sen~~~~~el~~lie~~~l~g~------------~v~f~  351 (495)
T KOG0853         284 PGKDQDLALPAFTLLHDSIPEPSISSEHLVVAGSRGYDERDSENVEYLKELLSLIEEYDLLGQ------------FVWFL  351 (495)
T ss_pred             CCCCCEEEHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC------------EEEEE
T ss_conf             999846644447764003578887711699943787644553558999999999997276665------------69984


Q ss_pred             CCCCCC--HHHHHHCCCEEEECCCCCCCCCCHHHHHHHCCCEEE----CCCCCCHHHHHHHHHHCCCEEEECCHH---HH
Q ss_conf             676520--255422082066135544454583768961994999----898443799999999789869957989---99
Q gi|254780402|r  309 DTIGEM--GFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILS----GPNVENFRDIYRRMVSSGAVRIVEEVG---TL  379 (440)
Q Consensus       309 Dt~GeL--~~lY~~AdiafVGGSl~~~GGhN~lEpaa~G~pVi~----GP~~~nf~e~~~~L~~~g~~~~v~d~~---eL  379 (440)
T Consensus       352 ~s~~~~~~yrl~adt~~v~~qPa~-E~FGiv~IEAMa~glPvvAt~~GGP-----~EiV~~~-~tG~l~dp-~~e~~~~~  423 (495)
T KOG0853         352 PSTTRVAKYRLAADTKGVLYQPAN-EHFGIVPIEAMACGLPVVATNNGGP-----AEIVVHG-VTGLLIDP-GQEAVAEL  423 (495)
T ss_pred             CCCCHHHHHHHHHHCCEEEECCCC-CCCCCEEHHHHHCCCCEEEECCCCC-----EEEEECC-CCCEEECC-CHHHHHHH
T ss_conf             577638889998744357726888-7756333987855998899669996-----5789848-85044577-45778999


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHCC---CHHHHHHHHHHHHH
Q ss_conf             99999995898999999999999997045---56999999999752
Q gi|254780402|r  380 ADMVYSLLSEPTIRYEMINAAINEVKKMQ---GPLKITLRSLDSYV  422 (440)
Q Consensus       380 ~~~l~~ll~d~~~~~~~~~~a~~~i~~~~---ga~~~~~~~i~~~l  422 (440)
T Consensus       424 a~~~~kl~~~p~l~~~~~~~G~krV~e~fs~~~~~~ri~~~~~~~~  469 (495)
T KOG0853         424 ADALLKLRRDPELWARMGKNGLKRVKEMFSWQHYSERIASVLGKYL  469 (495)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9999998139899999988788999998707779999999877507