HHsearch alignment for GI: 254780402 and conserved domain: cd03813

>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=99.57  E-value=1.7e-13  Score=108.24  Aligned_cols=238  Identities=17%  Similarity=0.184  Sum_probs=164.0

Q ss_pred             HHHCCCCEEEE--------------EECCCCCCCCC-C-HHHHHHHHHCCCCCCEEEECCHHHHHHHHHHCC--CCEEEE
Q ss_conf             74224550586--------------41266542121-0-011112331026442366415778889986088--505872
Q gi|254780402|r  147 LSKQRIPQVLV--------------NARMSRRSFKN-W-KTVLSFSKKIFSQFSLVIVQSERYFRRYKELGA--QKLIVS  208 (440)
Q Consensus       147 ~~~~~ip~~li--------------narls~~S~~~-~-~~~~~l~~~~~~~~~~i~~qs~~~~~rl~~lG~--~~i~v~  208 (440)
T Consensus       193 ~~~~g~P~llTEHGIYtRER~i~l~~a~w~~~~~r~~wi~ff~~l~~~~Y~~Ad~I~~l~~~nr~~qi~~Ga~~~k~~vI  272 (475)
T cd03813         193 KARRGTPFLLTEHGIYTRERKIELLQADWEMSYFRRLWIRFFESLGRLAYQAADRITTLYEGNRERQIEDGADPEKIRVI  272 (475)
T ss_pred             HHHHCCCEEEEECCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCEEECCCHHHHHHHHHHCCCHHHCEEC
T ss_conf             88758987985067228999988864754358999999999999999999851700013424489999819899994411


Q ss_pred             CC-C---CCCCCCCCCCHHHHHHHHHHCCCCCEEEC-CCCCC-CCCCCCCCCCCCC-CCCCCEEEEEEE---CCCCHHHH
Q ss_conf             04-3---10123442212568999986179861750-46553-3210000000000-123412488970---55211478
Q gi|254780402|r  209 GN-L---KIDTESLPCDKELLSLYQESIAGRYTWAA-ISTFE-GEEDKAVYVHNFI-KCRTDVLTIIVP---RHPRRCDA  278 (440)
Q Consensus       209 Gn-l---K~d~~~~~~~~~~~~~~~~~~~~r~v~va-gSth~-~EE~~il~a~~~l-~~~~~~~lIIvP---RhpeR~~~  278 (440)
T Consensus       273 pNGId~~~F~~~~~~~~----------~~~~~~v~~vgRv~p~Kdi~tlI~A~~~v~~~~p~~rl~I~Gp~d~~~~y~~e  342 (475)
T cd03813         273 PNGIDPERFAPARRARP----------EKEPPVVGLIGRVVPIKDIKTFIRAAAIVRKKIPDAEGWVIGPTDEDPEYAEE  342 (475)
T ss_pred             CCCCCHHHCCCCCCCCC----------CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHH
T ss_conf             79832988488765666----------78998899997011166999999999999986898399997799888589999


Q ss_pred             HHHHHHHHCCHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHCCCEEEECCCCCCCCCCHHHHHHHCCCEEECCCCCCHH
Q ss_conf             88776530010110013444446641675067652025542208206613554445458376896199499989844379
Q gi|254780402|r  279 IERRLIAKGLKVARRSRGDVINAEVDIFLGDTIGEMGFYLRMTEIAFIGRSFCASGGQNPLEAAMLGCAILSGPNVENFR  358 (440)
Q Consensus       279 i~~~l~~~gl~~~~~S~~~~~~~~~~V~i~Dt~GeL~~lY~~AdiafVGGSl~~~GGhN~lEpaa~G~pVi~GP~~~nf~  358 (440)
T Consensus       343 c~~lv~~lgL~~~V~F~G~--------------~dv~~~l~~~D-v~vl~S~~Eg~plvllEAmA~G~PvVaT-dVGg~~  406 (475)
T cd03813         343 CRELVESLGLEDNVKFTGF--------------QNVKEYLPKLD-VLVLTSISEGQPLVILEAMAAGIPVVAT-DVGSCR  406 (475)
T ss_pred             HHHHHHHHCCCCCEEECCC--------------CCHHHHHHHCC-EEEECCCCCCCCHHHHHHHHCCCCEEEC-CCCCCH
T ss_conf             9999998299872798387--------------89899998579-9996573346757999999769988972-699818


Q ss_pred             HHHHHH-----HHCCCEEEECCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             999999-----9789869957989999999999589899999999999999704556
Q gi|254780402|r  359 DIYRRM-----VSSGAVRIVEEVGTLADMVYSLLSEPTIRYEMINAAINEVKKMQGP  410 (440)
Q Consensus       359 e~~~~L-----~~~g~~~~v~d~~eL~~~l~~ll~d~~~~~~~~~~a~~~i~~~~ga  410 (440)
T Consensus       407 e~v~~~~~~~~G~~G~lvp~~d~~~LA~ai~~Ll~d~~~r~~~g~~ar~rv~~~f~~  463 (475)
T cd03813         407 ELIEGADDEALGPAGEVVPPADPEALARAILRLLKDPELRRAMGEAGRKRVERYYTL  463 (475)
T ss_pred             HHHCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCH
T ss_conf             875386656778854896999999999999999739999999999999999996899