HHsearch alignment for GI: 254780402 and conserved domain: cd03823

>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
Probab=99.77  E-value=5e-16  Score=124.93  Aligned_cols=297  Identities=14%  Similarity=0.119  Sum_probs=176.5

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHCCCCCCEEEEEC--------CC-------------CCCHHHHHHHH
Q ss_conf             9999999999999861998999962776300121014774168850--------55-------------72013445574
Q gi|254780402|r   67 GETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLGQYAIHQYA--------PL-------------DIQPAVSRFLK  125 (440)
Q Consensus        67 GE~~~a~pli~~l~~~~~~iliT~~T~tg~~~~~~~~~~~~~~~y~--------P~-------------D~~~~~~~fl~  125 (440)
T Consensus        16 G~e~~~~~la~~L~~~Gh~V~v~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (359)
T cd03823          16 GAEVVAHDLAEALAKRGHEVAVLTAGEDPPRQDKEV--IGVVVYGRPIDEVLRSALPRDLFHLSDYDNPAVVAEFARLLE   93 (359)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCC--CCEEEEECCCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             499999999999997799899995579876642135--761797047642003543101567764227899999999998


Q ss_pred             HHCCEEEEEECCCCH-HHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHCC--
Q ss_conf             420203564047621-46788874224550586412665421210011112331026442366415778889986088--
Q gi|254780402|r  126 YWKPDCMILSESDIW-PLTVFELSKQRIPQVLVNARMSRRSFKNWKTVLSFSKKIFSQFSLVIVQSERYFRRYKELGA--  202 (440)
Q Consensus       126 ~~~P~~~i~~e~ElW-Pnli~~~~~~~ip~~linarls~~S~~~~~~~~~l~~~~~~~~~~i~~qs~~~~~rl~~lG~--  202 (440)
T Consensus        94 ~~~pDivh~h~~~~~~~~~~~~~~~~~~p~v~t~h--------~~~~~~~~~~~~~~~~d~vi~~S~~~~~~~~~~~~~~  165 (359)
T cd03823          94 DFRPDVVHFHHLQGLGVSILRAARDRGIPIVLTLH--------DYWLICPRQGLFKKGGDAVIAPSRFLLDRYVANGLFA  165 (359)
T ss_pred             HCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEEC--------CHHHCCCHHHHHHCCCCEEEECCHHHHHHHHHHCCCC
T ss_conf             74999999888317679999999984998999972--------2211061778874589999999999999999808993


Q ss_pred             CCEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEE-CCCCCCC-CCCCCCCCCCCCCCCCCEEEEEEECCCCHHHHHH
Q ss_conf             5058720431012344221256899998617986175-0465533-2100000000001234124889705521147888
Q gi|254780402|r  203 QKLIVSGNLKIDTESLPCDKELLSLYQESIAGRYTWA-AISTFEG-EEDKAVYVHNFIKCRTDVLTIIVPRHPRRCDAIE  280 (440)
Q Consensus       203 ~~i~v~GnlK~d~~~~~~~~~~~~~~~~~~~~r~v~v-agSth~~-EE~~il~a~~~l~~~~~~~lIIvPRhpeR~~~i~  280 (440)
T Consensus       166 ~~i~vI~ng-vd~~~~~~~~~------~~~~~~~~i~~vGRl~~~Kg~~~li~a~~~l~-~~~~~l~i~G~g~~~~~~-~  236 (359)
T cd03823         166 EKISVIRNG-IDLDRAKRPRR------APPGGRLRFGFIGQLTPHKGVDLLLEAFKRLP-RGDIELVIVGNGLELEEE-S  236 (359)
T ss_pred             CCEEEECCC-CCHHHCCCCCC------CCCCCCEEEEEECCCCCCCCHHHHHHHHHHCC-CCCCEEEEECCCCHHHHH-H
T ss_conf             238998898-68454274333------45678749999588976259999999998555-578289997786056899-9


Q ss_pred             HHHHHHCCHHHHHCCCCCCCCCCEEEEECCC--CCCHHHHHHCCCEEEECCC-CCCCCCCHHHHHHHCCCEEECCCCCCH
Q ss_conf             7765300101100134444466416750676--5202554220820661355-444545837689619949998984437
Q gi|254780402|r  281 RRLIAKGLKVARRSRGDVINAEVDIFLGDTI--GEMGFYLRMTEIAFIGRSF-CASGGQNPLEAAMLGCAILSGPNVENF  357 (440)
Q Consensus       281 ~~l~~~gl~~~~~S~~~~~~~~~~V~i~Dt~--GeL~~lY~~AdiafVGGSl-~~~GGhN~lEpaa~G~pVi~GP~~~nf  357 (440)
T Consensus       237 ~~---~~~-------------~~~v~f~G~~~~~~~~~~~~~ad-i~v~pS~~~E~fg~~~lEAma~G~PvIas~-~gg~  298 (359)
T cd03823         237 YE---LEG-------------DPRVEFLGAYPQEEIDDFYAEID-VLVVPSIWPENFPLVIREALAAGVPVIASD-IGGM  298 (359)
T ss_pred             HH---HHC-------------CCCCEECCCCCHHHHHHHHHHCC-CCCCCCCCCCCCCHHHHHHHHCCCCEEECC-CCCC
T ss_conf             99---725-------------77648806567899999998657-365677565777479999998299899888-9981


Q ss_pred             HHHHHHHHHCCCEEE--ECCHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             999999997898699--5798999999999958989999999999999
Q gi|254780402|r  358 RDIYRRMVSSGAVRI--VEEVGTLADMVYSLLSEPTIRYEMINAAINE  403 (440)
Q Consensus       358 ~e~~~~L~~~g~~~~--v~d~~eL~~~l~~ll~d~~~~~~~~~~a~~~  403 (440)
T Consensus       299 ~e~i~---~g~~G~lv~~~d~~~la~ai~~ll~d~~~~~~~~~~~~~~  343 (359)
T cd03823         299 AELVR---DGVNGLLFPPGDAEDLAAALERLIDDPDLLERLRAGIEPP  343 (359)
T ss_pred             HHHHC---CCCCEEEECCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHC
T ss_conf             75603---7986799899999999999999984999999999999974