254780403
hypothetical protein CLIBASIA_01440
| GeneID in NCBI database: | 8209388 | Locus tag: | CLIBASIA_01440 |
| Protein GI in NCBI database: | 254780403 | Protein Accession: | YP_003064816.1 |
| Gene range: | -(304618, 304860) | Protein Length: | 80aa |
| Gene description: | hypothetical protein | ||
| COG prediction: | none | ||
| KEGG prediction: | hypothetical protein | ||
| SEED prediction: | Uncharacterized protein, Bsl7517 homolog | ||
| Pathway involved in KEGG: | not defined | ||
| Subsystem involved in SEED: | - none - | ||
| sequence | sequence profile | ||
Prediction of Local Sequence Properties
| Source | Summary | Result |
|---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
No hits with e-value below 0.05
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
| Identity | Alignment graph | Length | Definition | Round | E-value |
| Target | 80 | hypothetical protein CLIBASIA_01440 [Candidatus Liberib | |||
| 315122185 | 82 | hypothetical protein CKC_02175 [Candidatus Liberibacter | 1 | 3e-28 | |
| 240849927 | 81 | hypothetical protein Bgr_02800 [Bartonella grahamii as4 | 1 | 1e-17 | |
| 163867556 | 81 | hypothetical protein Btr_0293 [Bartonella tribocorum CI | 1 | 4e-16 | |
| 121602438 | 77 | hypothetical protein BARBAKC583_1206 [Bartonella bacill | 1 | 3e-15 | |
| 49473914 | 81 | hypothetical protein BQ02530 [Bartonella quintana str. | 1 | 1e-14 | |
| 49475076 | 81 | hypothetical protein BH02650 [Bartonella henselae str. | 1 | 2e-14 | |
| 114769703 | 80 | hypothetical protein OM2255_09051 [alpha proteobacteriu | 1 | 3e-14 | |
| 89052892 | 108 | hypothetical protein Jann_0401 [Jannaschia sp. CCS1] Le | 1 | 5e-14 | |
| 254472025 | 80 | inositol monophosphatase family protein [Pseudovibrio s | 1 | 6e-14 | |
| 114705770 | 77 | hypothetical protein FP2506_14929 [Fulvimarina pelagi H | 1 | 9e-14 |
| >gi|315122185|ref|YP_004062674.1| hypothetical protein CKC_02175 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 82 | Back alignment and organism information |
|---|
Score = 128 bits (321), Expect = 3e-28, Method: Compositional matrix adjust.
Identities = 61/76 (80%), Positives = 68/76 (89%)
Query: 5 IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
I +EQ LYLVFGGELE IT+KK+RN DDIDVVGIFSSYS+AYD WKEKSQQ VDNALMRY
Sbjct: 7 IDKEQALYLVFGGELEEITKKKIRNLDDIDVVGIFSSYSSAYDAWKEKSQQTVDNALMRY 66
Query: 65 FVVDISRFPHYELGKE 80
FVVDISRFP+ +L K+
Sbjct: 67 FVVDISRFPYCDLEKK 82
|
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|240849927|ref|YP_002971316.1| hypothetical protein Bgr_02800 [Bartonella grahamii as4aup] Length = 81 | Back alignment and organism information |
|---|
| >gi|163867556|ref|YP_001608755.1| hypothetical protein Btr_0293 [Bartonella tribocorum CIP 105476] Length = 81 | Back alignment and organism information |
|---|
| >gi|121602438|ref|YP_989459.1| hypothetical protein BARBAKC583_1206 [Bartonella bacilliformis KC583] Length = 77 | Back alignment and organism information |
|---|
| >gi|49473914|ref|YP_031956.1| hypothetical protein BQ02530 [Bartonella quintana str. Toulouse] Length = 81 | Back alignment and organism information |
|---|
| >gi|49475076|ref|YP_033117.1| hypothetical protein BH02650 [Bartonella henselae str. Houston-1] Length = 81 | Back alignment and organism information |
|---|
| >gi|114769703|ref|ZP_01447313.1| hypothetical protein OM2255_09051 [alpha proteobacterium HTCC2255] Length = 80 | Back alignment and organism information |
|---|
| >gi|89052892|ref|YP_508343.1| hypothetical protein Jann_0401 [Jannaschia sp. CCS1] Length = 108 | Back alignment and organism information |
|---|
| >gi|254472025|ref|ZP_05085426.1| inositol monophosphatase family protein [Pseudovibrio sp. JE062] Length = 80 | Back alignment and organism information |
|---|
| >gi|114705770|ref|ZP_01438673.1| hypothetical protein FP2506_14929 [Fulvimarina pelagi HTCC2506] Length = 77 | Back alignment and organism information |
|---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLAST against CDD database part II
No hit with e-value below 0.005
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
No hit with probability above 90.00
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
No homologous structure with e-value below 0.005
Homologous Structures in PDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Homologous Structures in PDB70 Database Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 90.00
Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch
Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 90.00
Homologous Domains in MMDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against MMDB70 database
No hit with e-value below 0.005
Homologous Domains in MMDB70 Database Detected by HHsearch
Original result of HHsearch against MMDB70 database
No hit with probability higher than 90.00