Query gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 80 No_of_seqs 100 out of 110 Neff 3.5 Searched_HMMs 39220 Date Sun May 29 18:10:06 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780403.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam06163 DUF977 Bacterial pro 84.7 0.65 1.7E-05 26.9 2.2 28 34-62 60-87 (127) 2 KOG0588 consensus 80.0 1.6 4.1E-05 24.6 2.7 58 4-76 80-141 (786) 3 COG5470 Uncharacterized conser 79.1 5.9 0.00015 21.4 5.4 55 11-68 35-94 (96) 4 pfam07045 DUF1330 Protein of u 61.6 8.7 0.00022 20.5 3.0 42 11-55 21-62 (65) 5 pfam05036 SPOR Sporulation rel 42.5 25 0.00063 17.9 2.8 25 34-58 46-70 (75) 6 pfam09301 DUF1970 Domain of un 39.7 15 0.00038 19.1 1.3 26 5-30 1-26 (117) 7 KOG1230 consensus 34.9 14 0.00035 19.3 0.5 23 11-33 134-156 (521) 8 cd03069 PDI_b_ERp57 PDIb famil 32.0 23 0.00059 18.0 1.3 38 23-60 10-48 (104) 9 pfam08939 DUF1917 Domain of un 30.8 35 0.00089 17.0 2.0 24 38-61 150-173 (237) 10 PRK12757 cell division protein 30.3 49 0.0012 16.2 2.7 29 34-62 216-244 (249) 11 KOG1928 consensus 29.0 26 0.00067 17.7 1.2 37 13-53 237-274 (409) 12 pfam07370 DUF1489 Protein of u 28.2 60 0.0015 15.7 3.0 30 9-38 48-81 (137) 13 PRK09411 carbamate kinase; Rev 26.9 63 0.0016 15.6 3.0 50 13-65 103-152 (297) 14 TIGR02541 flagell_FlgJ flagell 25.1 36 0.00092 16.9 1.3 34 17-50 247-280 (332) 15 PRK10927 essential cell divisi 24.5 70 0.0018 15.3 2.7 30 33-62 285-314 (319) 16 KOG0586 consensus 23.8 65 0.0016 15.5 2.4 62 5-77 124-185 (596) 17 pfam04902 Nab1 Conserved regio 22.9 23 0.00058 18.1 -0.1 51 5-56 110-160 (166) 18 cd03068 PDI_b_ERp72 PDIb famil 20.7 83 0.0021 14.9 2.7 35 25-59 12-48 (107) 19 TIGR01254 sfuA ABC transporter 20.6 63 0.0016 15.6 1.8 20 38-58 164-183 (324) No 1 >pfam06163 DUF977 Bacterial protein of unknown function (DUF977). This family consists of several hypothetical bacterial proteins from Escherichia coli and Salmonella typhi. The function of this family is unknown. Probab=84.73 E-value=0.65 Score=26.86 Aligned_cols=28 Identities=29% Similarity=0.516 Sum_probs=22.8 Q ss_pred EEEECCCCHHHHHHHHHHHHHHCHHHCCC Q ss_conf 09814889899999999997648731021 Q gi|254780403|r 34 DVVGIFSSYSNAYDVWKEKSQQMVDNALM 62 (80) Q Consensus 34 eivG~f~~Y~~A~~AWka~Aq~TVDnA~m 62 (80) ...|+||| +.|+..|+.++-+..|--.. T Consensus 60 Gr~GiFpS-EqA~~~W~~~~~k~~d~~li 87 (127) T pfam06163 60 GRCGIFRS-EQAVIDWQKAAEKATDPDLI 87 (127) T ss_pred CCCCCCCC-HHHHHHHHHHHHHCCCHHHH T ss_conf 87576853-99999999888854571188 No 2 >KOG0588 consensus Probab=79.97 E-value=1.6 Score=24.62 Aligned_cols=58 Identities=24% Similarity=0.196 Sum_probs=41.0 Q ss_pred CCCCCEEEEEEE----EEEEECCCCCEECCCCCCEEEECCCCHHHHHHHHHHHHHHCHHHCCCEEEEEEHHHCCCCH Q ss_conf 776642599996----0288548852001687320981488989999999999764873102126766723218812 Q gi|254780403|r 4 GIQEEQVLYLVF----GGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYE 76 (80) Q Consensus 4 ~~~~~Q~lhlV~----GGel~d~~~~~f~d~~~~eivG~f~~Y~~A~~AWka~Aq~TVDnA~mRYfIvhlhrl~dp~ 76 (80) -.+.+|.||||+ |||| |- -+-.-|+++..++|+-.|+-.. -|++|| ++.|+| |=|-|| T Consensus 80 Vwe~~~~lylvlEyv~gGEL-------Fd---ylv~kG~l~e~eaa~ff~QIi~--gv~yCH-~~~icH--RDLKpE 141 (786) T KOG0588 80 VWENKQHLYLVLEYVPGGEL-------FD---YLVRKGPLPEREAAHFFRQILD--GVSYCH-AFNICH--RDLKPE 141 (786) T ss_pred EECCCCEEEEEEEECCCCHH-------HH---HHHHHCCCCCHHHHHHHHHHHH--HHHHHH-HHCCEE--CCCCCH T ss_conf 21057357999996378516-------78---9986089887899999999999--898886-505021--457724 No 3 >COG5470 Uncharacterized conserved protein [Function unknown] Probab=79.08 E-value=5.9 Score=21.42 Aligned_cols=55 Identities=27% Similarity=0.308 Sum_probs=40.8 Q ss_pred EEEEEEEEEECCCCCEECCCCCCEEEECCCCHHHHHHHHHH-----HHHHCHHHCCCEEEEEE Q ss_conf 99996028854885200168732098148898999999999-----97648731021267667 Q gi|254780403|r 11 LYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKE-----KSQQMVDNALMRYFVVD 68 (80) Q Consensus 11 lhlV~GGel~d~~~~~f~d~~~~eivG~f~~Y~~A~~AWka-----~Aq~TVDnA~mRYfIvh 68 (80) -|||-||+...+.+.-. -..-+|=-|||++.|.++..+ .+..-.++|..+..||. T Consensus 35 r~LvRGG~v~~lEG~w~---ptr~vviEFps~~~ar~~y~SpeYq~a~~~Rq~~ad~~~iiVe 94 (96) T COG5470 35 RYLVRGGEVETLEGEWR---PTRNVVIEFPSLEAARDCYNSPEYQAAAAIRQAAADSEIIIVE 94 (96) T ss_pred EEEEECCCEEECCCCCC---CCCEEEEECCCHHHHHHHHCCHHHHHHHHHHHHCCCCCEEEEE T ss_conf 26850787033147887---6547999748889999884599789899987512555379872 No 4 >pfam07045 DUF1330 Protein of unknown function (DUF1330). This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown. Probab=61.56 E-value=8.7 Score=20.47 Aligned_cols=42 Identities=29% Similarity=0.283 Sum_probs=28.3 Q ss_pred EEEEEEEEEECCCCCEECCCCCCEEEECCCCHHHHHHHHHHHHHH Q ss_conf 999960288548852001687320981488989999999999764 Q gi|254780403|r 11 LYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQ 55 (80) Q Consensus 11 lhlV~GGel~d~~~~~f~d~~~~eivG~f~~Y~~A~~AWka~Aq~ 55 (80) -+||.||+...+.+.. .. ..-++=-|||.+.|...|.+..-+ T Consensus 21 ~~l~rg~~~~~lEG~~--~~-~~~ViieFps~e~A~~~y~S~eYq 62 (65) T pfam07045 21 RFLARGGAPEVLEGDW--DP-DRIVVIEFPSMEAARAWYNSPEYQ 62 (65) T ss_pred EEEEECCCCEEEECCC--CC-CEEEEEECCCHHHHHHHHCCHHHH T ss_conf 9999879846862589--98-769999819999999997799567 No 5 >pfam05036 SPOR Sporulation related domain. This 70 residue domain is composed of two 35 residue repeats found in proteins involved in sporulation and cell division such as FtsN, DedD, and CwlM. This domain is involved in binding peptidoglycan. Two tandem repeats fold into a pseudo-2-fold symmetric single-domain structure containing numerous contacts between the repeats. FtsN is an essential cell division protein with a simple bitopic topology, a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. These repeats lay at the periplasmic C-terminus. FtsN localizes to the septum ring complex. Probab=42.47 E-value=25 Score=17.87 Aligned_cols=25 Identities=24% Similarity=0.170 Sum_probs=17.4 Q ss_pred EEEECCCCHHHHHHHHHHHHHHCHH Q ss_conf 0981488989999999999764873 Q gi|254780403|r 34 DVVGIFSSYSNAYDVWKEKSQQMVD 58 (80) Q Consensus 34 eivG~f~~Y~~A~~AWka~Aq~TVD 58 (80) -++|||++.++|..+=+.....-.+ T Consensus 46 V~vGpf~~~~~A~~~~~~Lk~~g~~ 70 (75) T pfam05036 46 VRVGPFASREEARAALKKLKAAGLS 70 (75) T ss_pred EEECCCCCHHHHHHHHHHHHHCCCC T ss_conf 9988869999999999999985998 No 6 >pfam09301 DUF1970 Domain of unknown function (DUF1970). Members of this family consist of various uncharacterized viral hypothetical proteins. Probab=39.68 E-value=15 Score=19.13 Aligned_cols=26 Identities=27% Similarity=0.362 Sum_probs=17.6 Q ss_pred CCCCEEEEEEEEEEEECCCCCEECCC Q ss_conf 76642599996028854885200168 Q gi|254780403|r 5 IQEEQVLYLVFGGELENITQKKMRNP 30 (80) Q Consensus 5 ~~~~Q~lhlV~GGel~d~~~~~f~d~ 30 (80) |++|.+||||=||-.--+-..=|++- T Consensus 1 mdkkkllywvggglvliliwlwfrnr 26 (117) T pfam09301 1 MDKKKLLYWVGGGLVLILIWLWFRNR 26 (117) T ss_pred CCCCEEEEEECCCHHHHHHHHHHCCC T ss_conf 97100687755763446789998368 No 7 >KOG1230 consensus Probab=34.90 E-value=14 Score=19.30 Aligned_cols=23 Identities=26% Similarity=0.612 Sum_probs=16.0 Q ss_pred EEEEEEEEEECCCCCEECCCCCC Q ss_conf 99996028854885200168732 Q gi|254780403|r 11 LYLVFGGELENITQKKMRNPDDI 33 (80) Q Consensus 11 lhlV~GGel~d~~~~~f~d~~~~ 33 (80) .-|+||||..+|...+|-.-+++ T Consensus 134 ~l~~fGGEfaSPnq~qF~HYkD~ 156 (521) T KOG1230 134 ILWLFGGEFASPNQEQFHHYKDL 156 (521) T ss_pred EEEEECCCCCCCCHHHHHHHHHE T ss_conf 17983254378645441000010 No 8 >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds. It also displays chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp57 contains two redox-active TRX (a) domains and two redox inactive TRX-like (b) domains. It shares the same domain arrangement of abb'a' as PDI, but lacks the C-terminal acid-rich region (c domain) that is present in PDI. ERp57 interacts with the lectin chaperones, calnexin and calreticulin, and specifically promotes the oxidative folding of glycoproteins. Similar to PDI, the b domain of ERp57 is likely involved in binding to substrates. Probab=31.98 E-value=23 Score=18.04 Aligned_cols=38 Identities=18% Similarity=0.308 Sum_probs=30.9 Q ss_pred CCCEECCCCCCEEEECCCCHH-HHHHHHHHHHHHCHHHC Q ss_conf 852001687320981488989-99999999976487310 Q gi|254780403|r 23 TQKKMRNPDDIDVVGIFSSYS-NAYDVWKEKSQQMVDNA 60 (80) Q Consensus 23 ~~~~f~d~~~~eivG~f~~Y~-~A~~AWka~Aq~TVDnA 60 (80) ...+|.+.+++-|||-|.+-+ .++++....|...+|+- T Consensus 10 ~~e~Fl~~~dv~VVGFF~~~ds~~~~~Fl~~A~~lRd~~ 48 (104) T cd03069 10 EFEKFLSDDDASVVGFFEDEDSKLLSEFLKAADTLRESF 48 (104) T ss_pred HHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCC T ss_conf 999873659869999983788479999999999745255 No 9 >pfam08939 DUF1917 Domain of unknown function (DUF1917). This domain is found in various hypothetical and basophilic leukaemia proteins. It has no known function. Probab=30.81 E-value=35 Score=17.01 Aligned_cols=24 Identities=17% Similarity=0.457 Sum_probs=21.0 Q ss_pred CCCCHHHHHHHHHHHHHHCHHHCC Q ss_conf 488989999999999764873102 Q gi|254780403|r 38 IFSSYSNAYDVWKEKSQQMVDNAL 61 (80) Q Consensus 38 ~f~~Y~~A~~AWka~Aq~TVDnA~ 61 (80) +|..-+++-.+|++.|..||.|-. T Consensus 150 lf~~~~~vd~~W~~Va~at~~~~L 173 (237) T pfam08939 150 LFLPPDEVDEAWSKVAEATVEGEL 173 (237) T ss_pred EECCHHHHHHHHHHHHHHHHHCCC T ss_conf 657888999999999999970555 No 10 >PRK12757 cell division protein FtsN; Provisional Probab=30.28 E-value=49 Score=16.19 Aligned_cols=29 Identities=14% Similarity=0.091 Sum_probs=24.3 Q ss_pred EEEECCCCHHHHHHHHHHHHHHCHHHCCC Q ss_conf 09814889899999999997648731021 Q gi|254780403|r 34 DVVGIFSSYSNAYDVWKEKSQQMVDNALM 62 (80) Q Consensus 34 eivG~f~~Y~~A~~AWka~Aq~TVDnA~m 62 (80) -++|||.+.+.|.++-......-|.+|-- T Consensus 216 V~lGPy~~k~~a~~~~~~l~~ag~~~Ci~ 244 (249) T PRK12757 216 VVLGPYNSKAAADKALQRLKGAGHSGCIP 244 (249) T ss_pred EEECCCCCHHHHHHHHHHHHHCCCCCCEE T ss_conf 99557786789999999998679878466 No 11 >KOG1928 consensus Probab=29.01 E-value=26 Score=17.71 Aligned_cols=37 Identities=16% Similarity=0.398 Sum_probs=29.3 Q ss_pred EEEEEEEECCCCCEECCCCCCE-EEECCCCHHHHHHHHHHHH Q ss_conf 9960288548852001687320-9814889899999999997 Q gi|254780403|r 13 LVFGGELENITQKKMRNPDDID-VVGIFSSYSNAYDVWKEKS 53 (80) Q Consensus 13 lV~GGel~d~~~~~f~d~~~~e-ivG~f~~Y~~A~~AWka~A 53 (80) +=+||-|-|++...+++++.+. ++| .++|-.+|.+.. T Consensus 237 yKYGGvYLDTDvIvLksl~~l~N~ig----~~~~~~~~~~ln 274 (409) T KOG1928 237 YKYGGVYLDTDVIVLKSLSNLRNVIG----VDPATQAWTRLN 274 (409) T ss_pred HHHCCEEEECCEEEECCCCCCCCCCC----CCCHHHHHHHHC T ss_conf 98487886134799624312566556----662155777624 No 12 >pfam07370 DUF1489 Protein of unknown function (DUF1489). This family consists of several hypothetical bacterial proteins of around 150 residues in length. Members of this family seem to be founds exclusively in the Class Alphaproteobacteria. The function of this family is unknown. Probab=28.16 E-value=60 Score=15.69 Aligned_cols=30 Identities=23% Similarity=0.439 Sum_probs=20.9 Q ss_pred EEEEEEEEEEEEC----CCCCEECCCCCCEEEEC Q ss_conf 2599996028854----88520016873209814 Q gi|254780403|r 9 QVLYLVFGGELEN----ITQKKMRNPDDIDVVGI 38 (80) Q Consensus 9 Q~lhlV~GGel~d----~~~~~f~d~~~~eivG~ 38 (80) -.|||||.|.... +++.+|.+.+.+-..++ T Consensus 48 GSlYWViKg~I~~RQ~Il~i~~~~~~dG~~rC~i 81 (137) T pfam07370 48 GSLYWVIKGQIQARQRILGIDEVTDGDGIRRCAI 81 (137) T ss_pred CCEEEEECCEEEEEEEEECCEEEECCCCCEEEEE T ss_conf 7089997366999888521216876898366899 No 13 >PRK09411 carbamate kinase; Reviewed Probab=26.87 E-value=63 Score=15.56 Aligned_cols=50 Identities=10% Similarity=-0.043 Sum_probs=39.2 Q ss_pred EEEEEEEECCCCCEECCCCCCEEEECCCCHHHHHHHHHHHHHHCHHHCCCEEE Q ss_conf 99602885488520016873209814889899999999997648731021267 Q gi|254780403|r 13 LVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYF 65 (80) Q Consensus 13 lV~GGel~d~~~~~f~d~~~~eivG~f~~Y~~A~~AWka~Aq~TVDnA~mRYf 65 (80) -|+---+.|.+...|.++++ .+|||=+.++|+..=+...|.-+++ --.|. T Consensus 103 tvlTQv~VD~~DpAF~~PtK--pIGpfy~~eeA~~l~~~~gw~~~ed-grg~R 152 (297) T PRK09411 103 TVLTRIEVSPDDPAFLQPEK--FIGPVYQPEEQEALEAAYGWQMKRD-GKYLR 152 (297) T ss_pred EEEEEEEECCCCCCCCCCCC--CCCCCCCHHHHHHHHHHCCCEEECC-CCEEE T ss_conf 99888998899812138998--5178879999999997559689526-98026 No 14 >TIGR02541 flagell_FlgJ flagellar rod assembly protein/muramidase FlgJ; InterPro: IPR013377 The N-terminal region of this protein acts directly in flagellar rod assembly, while the C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring .; GO: 0016798 hydrolase activity acting on glycosyl bonds, 0001539 ciliary or flagellar motility, 0009296 flagellum biogenesis, 0009288 flagellin-based flagellum. Probab=25.11 E-value=36 Score=16.94 Aligned_cols=34 Identities=18% Similarity=0.255 Sum_probs=27.2 Q ss_pred EEEECCCCCEECCCCCCEEEECCCCHHHHHHHHH Q ss_conf 2885488520016873209814889899999999 Q gi|254780403|r 17 GELENITQKKMRNPDDIDVVGIFSSYSNAYDVWK 50 (80) Q Consensus 17 Gel~d~~~~~f~d~~~~eivG~f~~Y~~A~~AWk 50 (80) |..+++..+||.|+...-..-.|.+|.+=.+|.+ T Consensus 247 G~vv~~~TtEY~dG~a~K~~~~FR~YsSY~eaF~ 280 (332) T TIGR02541 247 GKVVEIMTTEYVDGVAQKLKEKFRSYSSYEEAFS 280 (332) T ss_pred CCEEEEEEEEEECCEEEECCCCCCCCCCHHHHHH T ss_conf 8744568767657812311116866444789999 No 15 >PRK10927 essential cell division protein; Provisional Probab=24.49 E-value=70 Score=15.30 Aligned_cols=30 Identities=17% Similarity=0.058 Sum_probs=24.9 Q ss_pred CEEEECCCCHHHHHHHHHHHHHHCHHHCCC Q ss_conf 209814889899999999997648731021 Q gi|254780403|r 33 IDVVGIFSSYSNAYDVWKEKSQQMVDNALM 62 (80) Q Consensus 33 ~eivG~f~~Y~~A~~AWka~Aq~TVDnA~m 62 (80) --++|||++-+.|.++-......-+++|-- T Consensus 285 RVvlGPy~~k~~a~~~~~~l~~ag~~~cI~ 314 (319) T PRK10927 285 RVVIGPVKGKENADSTLNRLKMAGHTNCIR 314 (319) T ss_pred EEEECCCCCHHHHHHHHHHHHHCCCCCCEE T ss_conf 688447785778999999998668777355 No 16 >KOG0586 consensus Probab=23.77 E-value=65 Score=15.49 Aligned_cols=62 Identities=19% Similarity=0.135 Sum_probs=38.4 Q ss_pred CCCCEEEEEEEEEEEECCCCCEECCCCCCEEEECCCCHHHHHHHHHHHHHHCHHHCCCEEEEEEHHHCCCCHH Q ss_conf 7664259999602885488520016873209814889899999999997648731021267667232188120 Q gi|254780403|r 5 IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHYEL 77 (80) Q Consensus 5 ~~~~Q~lhlV~GGel~d~~~~~f~d~~~~eivG~f~~Y~~A~~AWka~Aq~TVDnA~mRYfIvhlhrl~dp~~ 77 (80) +..+.-||||+ ||... +..|. -+...|--.++...-..|. +-.+|+.||.+.+| ||.|+.|. T Consensus 124 ~~t~~~lylV~--eya~~-ge~~~---yl~~~gr~~e~~ar~~F~q--~vsaveYcH~k~iv---HrdLk~eN 185 (596) T KOG0586 124 IETEATLYLVM--EYASG-GELFD---YLVKHGRMKEKEARAKFRQ--IVSAVEYCHSKNIV---HRDLKAEN 185 (596) T ss_pred EEECCEEEEEE--EECCC-CHHHH---HHHHCCCCHHHHHHHHHHH--HHHHHHHHHHCCEE---CCCCCHHH T ss_conf 42056158999--95057-21789---9986164013566666677--88899987531443---46553654 No 17 >pfam04902 Nab1 Conserved region in Nab1. Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of transcription factors. This C-terminal region is found only in the Nab1 subfamily. Probab=22.86 E-value=23 Score=18.09 Aligned_cols=51 Identities=20% Similarity=0.318 Sum_probs=34.4 Q ss_pred CCCCEEEEEEEEEEEECCCCCEECCCCCCEEEECCCCHHHHHHHHHHHHHHC Q ss_conf 7664259999602885488520016873209814889899999999997648 Q gi|254780403|r 5 IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQM 56 (80) Q Consensus 5 ~~~~Q~lhlV~GGel~d~~~~~f~d~~~~eivG~f~~Y~~A~~AWka~Aq~T 56 (80) ...+|.+|.|.-|||+-.-..+-+.-++ +-+||-.+|-...---..|..+| T Consensus 110 ~~~~qp~~~~~d~EL~r~y~se~~~~ss-e~~gilkD~~~sa~nlEkKvIKt 160 (166) T pfam04902 110 LQNRQPHHFVADGELSRLYPSEAKSHSS-ENLGILKDYPHSAFTLEKKVIKT 160 (166) T ss_pred CCCCCCCCHHHHHHHHHHCCHHHHCCCH-HHHHHHHCCCHHHHHHHHHHHCC T ss_conf 4435764111113676404404320202-23323201625677776555407 No 18 >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds. It also displays chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp72 contains three redox-active TRX (a) domains and two redox inactive TRX-like (b) domains. Its molecular structure is a"abb'a', compared to the abb'a' structure of PDI. ERp72 associates with several ER chaperones and folding factors to form complexes in the ER that bind nascent proteins. Similar to PDI, the b domain of ERp72 is likely involved in binding to substrates. Probab=20.74 E-value=83 Score=14.86 Aligned_cols=35 Identities=23% Similarity=0.659 Sum_probs=27.8 Q ss_pred CEE-CCCCCCEEEECCCCH-HHHHHHHHHHHHHCHHH Q ss_conf 200-168732098148898-99999999997648731 Q gi|254780403|r 25 KKM-RNPDDIDVVGIFSSY-SNAYDVWKEKSQQMVDN 59 (80) Q Consensus 25 ~~f-~d~~~~eivG~f~~Y-~~A~~AWka~Aq~TVDn 59 (80) .+| +|.+++-|||-|.+- ..++++.-..|-.-+|+ T Consensus 12 ~~fl~d~ddv~VVGfF~~~ds~~~~~FlkaA~~lRe~ 48 (107) T cd03068 12 QEFLRDGDDVIIIGVFSGEEDPAYQLYQDAANSLRED 48 (107) T ss_pred HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCC T ss_conf 9985378870899998689977899999999855056 No 19 >TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily; InterPro: IPR005948 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. In Gram-positive bacteria, which are surrounded by a single membrane and therefore have no periplasmic region, the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute through the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. Thiamine pyrophosphate 1 is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and alpha-ketoglutarate dehydrogenase (1.2.4.2 from EC). Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism. The thiamine ABC transporter, periplasmic binding protein in bacteria is believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane. The protein belongs to the larger ABC transport system which consists of at least three components: the inner membrane permease; thiamine binding protein and an ATP-binding subunit. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate TPP. ; GO: 0005215 transporter activity, 0006810 transport, 0030288 outer membrane-bounded periplasmic space. Probab=20.56 E-value=63 Score=15.56 Aligned_cols=20 Identities=20% Similarity=0.551 Sum_probs=16.8 Q ss_pred CCCCHHHHHHHHHHHHHHCHH Q ss_conf 488989999999999764873 Q gi|254780403|r 38 IFSSYSNAYDVWKEKSQQMVD 58 (80) Q Consensus 38 ~f~~Y~~A~~AWka~Aq~TVD 58 (80) .|+. +.|..||+..++.||- T Consensus 164 ~Yg~-d~a~~aW~~l~~~tv~ 183 (324) T TIGR01254 164 VYGE-DKAPQAWKQLRKKTVT 183 (324) T ss_pred CCCH-HHHHHHHHHHHHCCCE T ss_conf 3780-0379999999837947 Done!