BLAST/PSIBLAST alignment of GI: 254780403 and GI: 315122185 at iteration 1
>gi|315122185|ref|YP_004062674.1| hypothetical protein CKC_02175 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 82
>gi|313495587|gb|ADR52186.1| hypothetical protein CKC_02175 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 82
 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          I +EQ LYLVFGGELE IT+KK+RN DDIDVVGIFSSYS+AYD WKEKSQQ VDNALMRY
Sbjct: 7  IDKEQALYLVFGGELEEITKKKIRNLDDIDVVGIFSSYSSAYDAWKEKSQQTVDNALMRY 66

Query: 65 FVVDISRFPHYELGKE 80
          FVVDISRFP+ +L K+
Sbjct: 67 FVVDISRFPYCDLEKK 82