BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780403|ref|YP_003064816.1| hypothetical protein
CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62]
         (80 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|110632797|ref|YP_673005.1| hypothetical protein Meso_0436 [Mesorhizobium sp. BNC1]
 gi|110283781|gb|ABG61840.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 83

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 52/78 (66%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +   ++Q+L+LVFGGEL+ +T  + R+ D +D+VGI+  Y +A   W+ K+QQ VDNA
Sbjct: 1  MADDQGKKQLLHLVFGGELKTLTSTEFRDLDALDIVGIYPDYKSAEAAWRAKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYELG 78
           MRYF+V + R    + G
Sbjct: 61 HMRYFIVHLHRLLDPDAG 78


>gi|239833557|ref|ZP_04681885.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG
          3301]
 gi|239821620|gb|EEQ93189.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG
          3301]
          Length = 105

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 50/76 (65%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+L+LVFGGEL+ +   + R+ +++D+VGI+  Y +A   WK K+QQ VDNA
Sbjct: 23 MSVEGDKKQLLHLVFGGELKKLGTVEFRDLENLDIVGIYPDYESAKTAWKSKAQQTVDNA 82

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF+V + R    E
Sbjct: 83 HMRYFIVHLHRLLDPE 98


>gi|118590716|ref|ZP_01548117.1| hypothetical protein SIAM614_06098 [Stappia aggregata IAM 12614]
 gi|118436692|gb|EAV43332.1| hypothetical protein SIAM614_06098 [Stappia aggregata IAM 12614]
          Length = 79

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 49/77 (63%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+L+LVFGGELE       R+ +D+D+VGI+ +Y+ AY  WK K+Q  VDNA
Sbjct: 1  MSDTDTPKQLLHLVFGGELETPEGLTFRDLNDLDIVGIYPNYAEAYKAWKSKAQATVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    E 
Sbjct: 61 HMRYFIVHMHRLLDPET 77


>gi|254501438|ref|ZP_05113589.1| hypothetical protein SADFL11_1475 [Labrenzia alexandrii DFL-11]
 gi|222437509|gb|EEE44188.1| hypothetical protein SADFL11_1475 [Labrenzia alexandrii DFL-11]
          Length = 79

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+L+LVFGGELE+      R+ D++D+VGI+ +Y+ AY  WK K+Q  VDNA
Sbjct: 1  MSDTEAPKQLLHLVFGGELESPDGLTFRDLDELDIVGIYPNYAEAYTAWKAKAQATVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    + 
Sbjct: 61 HMRYFIVHMHRLLDPDT 77


>gi|17989376|ref|NP_542009.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|23499972|ref|NP_699412.1| hypothetical protein BRA0213 [Brucella suis 1330]
 gi|62317160|ref|YP_223013.1| hypothetical protein BruAb2_0209 [Brucella abortus bv. 1 str.
          9-941]
 gi|83269142|ref|YP_418433.1| hypothetical protein BAB2_0207 [Brucella melitensis biovar
          Abortus 2308]
 gi|148557895|ref|YP_001257261.1| hypothetical protein BOV_A0193 [Brucella ovis ATCC 25840]
 gi|161620291|ref|YP_001594177.1| hypothetical protein BCAN_B0214 [Brucella canis ATCC 23365]
 gi|163844400|ref|YP_001622055.1| hypothetical protein BSUIS_B0217 [Brucella suis ATCC 23445]
 gi|189022419|ref|YP_001932160.1| hypothetical protein BAbS19_II01970 [Brucella abortus S19]
 gi|225628675|ref|ZP_03786709.1| cytoplasmic protein [Brucella ceti str. Cudo]
 gi|225686066|ref|YP_002734038.1| hypothetical protein BMEA_B0213 [Brucella melitensis ATCC 23457]
 gi|237816719|ref|ZP_04595711.1| cytoplasmic protein [Brucella abortus str. 2308 A]
 gi|254691357|ref|ZP_05154611.1| hypothetical protein Babob68_14645 [Brucella abortus bv. 6 str.
          870]
 gi|254695343|ref|ZP_05157171.1| hypothetical protein Babob3T_11995 [Brucella abortus bv. 3 str.
          Tulya]
 gi|254698438|ref|ZP_05160266.1| hypothetical protein Babob28_12227 [Brucella abortus bv. 2 str.
          86/8/59]
 gi|254699504|ref|ZP_05161332.1| hypothetical protein Bsuib55_01394 [Brucella suis bv. 5 str. 513]
 gi|254702627|ref|ZP_05164455.1| hypothetical protein Bsuib36_01507 [Brucella suis bv. 3 str. 686]
 gi|254706241|ref|ZP_05168069.1| hypothetical protein BpinM_04390 [Brucella pinnipedialis
          M163/99/10]
 gi|254711465|ref|ZP_05173276.1| hypothetical protein BpinB_14672 [Brucella pinnipedialis B2/94]
 gi|254712067|ref|ZP_05173878.1| hypothetical protein BcetM6_01477 [Brucella ceti M644/93/1]
 gi|254715137|ref|ZP_05176948.1| hypothetical protein BcetM_01487 [Brucella ceti M13/05/1]
 gi|254719948|ref|ZP_05181759.1| hypothetical protein Bru83_10459 [Brucella sp. 83/13]
 gi|254731886|ref|ZP_05190464.1| hypothetical protein Babob42_12042 [Brucella abortus bv. 4 str.
          292]
 gi|256014999|ref|YP_003105008.1| hypothetical protein BMI_II210 [Brucella microti CCM 4915]
 gi|256029904|ref|ZP_05443518.1| hypothetical protein BpinM2_04485 [Brucella pinnipedialis
          M292/94/1]
 gi|256043133|ref|ZP_05446075.1| hypothetical protein Bmelb1R_01537 [Brucella melitensis bv. 1
          str. Rev.1]
 gi|256059553|ref|ZP_05449752.1| hypothetical protein Bneo5_04270 [Brucella neotomae 5K33]
 gi|256158074|ref|ZP_05455992.1| hypothetical protein BcetM4_04445 [Brucella ceti M490/95/1]
 gi|256252971|ref|ZP_05458507.1| hypothetical protein BcetB_01412 [Brucella ceti B1/94]
 gi|256256542|ref|ZP_05462078.1| hypothetical protein Babob9C_04095 [Brucella abortus bv. 9 str.
          C68]
 gi|256262811|ref|ZP_05465343.1| inositol monophosphatase [Brucella melitensis bv. 2 str. 63/9]
 gi|260166994|ref|ZP_05753805.1| hypothetical protein BruF5_01157 [Brucella sp. F5/99]
 gi|260544394|ref|ZP_05820215.1| inositol monophosphatase [Brucella abortus NCTC 8038]
 gi|260564355|ref|ZP_05834840.1| inositol monophosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|260568464|ref|ZP_05838933.1| inositol monophosphatase [Brucella suis bv. 4 str. 40]
 gi|260756967|ref|ZP_05869315.1| inositol monophosphatase [Brucella abortus bv. 6 str. 870]
 gi|260759659|ref|ZP_05872007.1| inositol monophosphatase [Brucella abortus bv. 4 str. 292]
 gi|260762901|ref|ZP_05875233.1| inositol monophosphatase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882779|ref|ZP_05894393.1| inositol monophosphatase [Brucella abortus bv. 9 str. C68]
 gi|261215715|ref|ZP_05929996.1| inositol monophosphatase [Brucella abortus bv. 3 str. Tulya]
 gi|261216847|ref|ZP_05931128.1| inositol monophosphatase [Brucella ceti M13/05/1]
 gi|261313683|ref|ZP_05952880.1| inositol monophosphatase [Brucella pinnipedialis M163/99/10]
 gi|261319074|ref|ZP_05958271.1| inositol monophosphatase [Brucella pinnipedialis B2/94]
 gi|261319714|ref|ZP_05958911.1| inositol monophosphatase [Brucella ceti M644/93/1]
 gi|261323521|ref|ZP_05962718.1| inositol monophosphatase [Brucella neotomae 5K33]
 gi|261749959|ref|ZP_05993668.1| inositol monophosphatase [Brucella suis bv. 5 str. 513]
 gi|261753212|ref|ZP_05996921.1| inositol monophosphatase [Brucella suis bv. 3 str. 686]
 gi|261756381|ref|ZP_06000090.1| inositol monophosphatase [Brucella sp. F5/99]
 gi|265984956|ref|ZP_06097691.1| inositol monophosphatase [Brucella sp. 83/13]
 gi|265986922|ref|ZP_06099479.1| inositol monophosphatase [Brucella pinnipedialis M292/94/1]
 gi|265989565|ref|ZP_06102122.1| inositol monophosphatase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265996588|ref|ZP_06109145.1| inositol monophosphatase [Brucella ceti M490/95/1]
 gi|294853228|ref|ZP_06793900.1| hypothetical protein BAZG_02176 [Brucella sp. NVSL 07-0026]
 gi|297249898|ref|ZP_06933599.1| hypothetical protein BAYG_02671 [Brucella abortus bv. 5 str.
          B3196]
 gi|306838537|ref|ZP_07471375.1| cytoplasmic protein [Brucella sp. NF 2653]
 gi|306840959|ref|ZP_07473700.1| cytoplasmic protein [Brucella sp. BO2]
 gi|306845530|ref|ZP_07478099.1| cytoplasmic protein [Brucella sp. BO1]
 gi|17985248|gb|AAL54273.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str.
          16M]
 gi|23463554|gb|AAN33417.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62197353|gb|AAX75652.1| conserved hypothetical protein [Brucella abortus bv. 1 str.
          9-941]
 gi|82939416|emb|CAJ12373.1| conserved hypothetical protein [Brucella melitensis biovar
          Abortus 2308]
 gi|148369180|gb|ABQ62052.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|161337102|gb|ABX63406.1| Hypothetical protein BCAN_B0214 [Brucella canis ATCC 23365]
 gi|163675123|gb|ABY39233.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189020993|gb|ACD73714.1| hypothetical protein BAbS19_II01970 [Brucella abortus S19]
 gi|225616521|gb|EEH13569.1| cytoplasmic protein [Brucella ceti str. Cudo]
 gi|225642171|gb|ACO02084.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237787532|gb|EEP61748.1| cytoplasmic protein [Brucella abortus str. 2308 A]
 gi|255997659|gb|ACU49346.1| hypothetical protein BMI_II210 [Brucella microti CCM 4915]
 gi|260097665|gb|EEW81539.1| inositol monophosphatase [Brucella abortus NCTC 8038]
 gi|260151998|gb|EEW87091.1| inositol monophosphatase [Brucella melitensis bv. 1 str. 16M]
 gi|260155129|gb|EEW90210.1| inositol monophosphatase [Brucella suis bv. 4 str. 40]
 gi|260669977|gb|EEX56917.1| inositol monophosphatase [Brucella abortus bv. 4 str. 292]
 gi|260673322|gb|EEX60143.1| inositol monophosphatase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677075|gb|EEX63896.1| inositol monophosphatase [Brucella abortus bv. 6 str. 870]
 gi|260872307|gb|EEX79376.1| inositol monophosphatase [Brucella abortus bv. 9 str. C68]
 gi|260917322|gb|EEX84183.1| inositol monophosphatase [Brucella abortus bv. 3 str. Tulya]
 gi|260921936|gb|EEX88504.1| inositol monophosphatase [Brucella ceti M13/05/1]
 gi|261292404|gb|EEX95900.1| inositol monophosphatase [Brucella ceti M644/93/1]
 gi|261298297|gb|EEY01794.1| inositol monophosphatase [Brucella pinnipedialis B2/94]
 gi|261299501|gb|EEY02998.1| inositol monophosphatase [Brucella neotomae 5K33]
 gi|261302709|gb|EEY06206.1| inositol monophosphatase [Brucella pinnipedialis M163/99/10]
 gi|261736365|gb|EEY24361.1| inositol monophosphatase [Brucella sp. F5/99]
 gi|261739712|gb|EEY27638.1| inositol monophosphatase [Brucella suis bv. 5 str. 513]
 gi|261742965|gb|EEY30891.1| inositol monophosphatase [Brucella suis bv. 3 str. 686]
 gi|262550885|gb|EEZ07046.1| inositol monophosphatase [Brucella ceti M490/95/1]
 gi|263000234|gb|EEZ12924.1| inositol monophosphatase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092632|gb|EEZ16853.1| inositol monophosphatase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659119|gb|EEZ29380.1| inositol monophosphatase [Brucella pinnipedialis M292/94/1]
 gi|264663548|gb|EEZ33809.1| inositol monophosphatase [Brucella sp. 83/13]
 gi|294818883|gb|EFG35883.1| hypothetical protein BAZG_02176 [Brucella sp. NVSL 07-0026]
 gi|297173767|gb|EFH33131.1| hypothetical protein BAYG_02671 [Brucella abortus bv. 5 str.
          B3196]
 gi|306273851|gb|EFM55678.1| cytoplasmic protein [Brucella sp. BO1]
 gi|306289016|gb|EFM60281.1| cytoplasmic protein [Brucella sp. BO2]
 gi|306406404|gb|EFM62645.1| cytoplasmic protein [Brucella sp. NF 2653]
 gi|326410392|gb|ADZ67456.1| putative cytoplasmic protein [Brucella melitensis M28]
 gi|326553685|gb|ADZ88324.1| putative cytoplasmic protein [Brucella melitensis M5-90]
          Length = 83

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+L+LVFGGEL+ +   + R+  ++D+VGI+  Y +A   WK K+QQ VDNA
Sbjct: 1  MSDAGDNKQLLHLVFGGELKKLDSLEFRDLQNLDIVGIYPDYESAKTAWKSKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHY 75
           MRYF+V + R    
Sbjct: 61 HMRYFIVHLHRLLDP 75


>gi|325292079|ref|YP_004277943.1| hypothetical protein AGROH133_04253 [Agrobacterium sp. H13-3]
 gi|325059932|gb|ADY63623.1| hypothetical protein AGROH133_04253 [Agrobacterium sp. H13-3]
          Length = 101

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 52/76 (68%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    +++Q+L+LVFGGELEN+   + R+ + +D+VGI+  Y++A   W+ K+Q  VDNA
Sbjct: 23 MTESGKQKQLLHLVFGGELENLQDVQFRDLNALDIVGIYPDYASALTAWRSKAQMTVDNA 82

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF+V + R  + +
Sbjct: 83 HMRYFIVHMHRLLNPD 98


>gi|86356489|ref|YP_468381.1| hypothetical protein RHE_CH00843 [Rhizobium etli CFN 42]
 gi|86280591|gb|ABC89654.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 82

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +   ++Q+L+LVFGGELE++   + R+   +D+VGIF  Y+ A   WK K+QQ VDNA
Sbjct: 1  MTDSGDKKQLLHLVFGGELESLDDVQFRDLSGLDIVGIFPDYATALTAWKAKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    + 
Sbjct: 61 HMRYFIVHMHRLLDPQQ 77


>gi|328545028|ref|YP_004305137.1| ABC antimicrobial peptide transporter, permease [polymorphum
          gilvum SL003B-26A1]
 gi|326414770|gb|ADZ71833.1| ABC-type antimicrobial peptide transport system, permease
          component [Polymorphum gilvum SL003B-26A1]
          Length = 79

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 51/79 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          MI   + +Q+L+LVFGGEL +      R+ D +D+VGI+ +Y+ AY VWK K+Q  VDNA
Sbjct: 1  MIKDKEPKQLLHLVFGGELVSPAGLTFRDLDRLDIVGIYPNYAEAYKVWKAKAQATVDNA 60

Query: 61 LMRYFVVDISRFPHYELGK 79
           MRYF+V + R    E  +
Sbjct: 61 HMRYFIVHMHRLLDPETEE 79


>gi|153010367|ref|YP_001371581.1| hypothetical protein Oant_3044 [Ochrobactrum anthropi ATCC 49188]
 gi|151562255|gb|ABS15752.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 83

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 50/76 (65%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+L+LVFGGEL+ +   + R+ +++D+VGI+  Y +A   WK K+QQ VDNA
Sbjct: 1  MSVEGDKKQLLHLVFGGELKKLGTVEFRDLENVDIVGIYPDYESAKTAWKSKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF+V + R    E
Sbjct: 61 HMRYFIVHLHRLLDPE 76


>gi|154245431|ref|YP_001416389.1| hypothetical protein Xaut_1484 [Xanthobacter autotrophicus Py2]
 gi|154159516|gb|ABS66732.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 81

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 50/79 (63%), Gaps = 2/79 (2%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+ +LVFGGEL  +   + ++   +D+VGIF  Y++A   WK K+QQ VDNA
Sbjct: 1  MTDTQ--KQLPHLVFGGELTTLDGSEFKDLSKLDIVGIFPDYASAAAAWKGKAQQTVDNA 58

Query: 61 LMRYFVVDISRFPHYELGK 79
          LMRYFVV + R    E GK
Sbjct: 59 LMRYFVVHLHRLLDPETGK 77


>gi|209548093|ref|YP_002280010.1| hypothetical protein Rleg2_0487 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
 gi|209533849|gb|ACI53784.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
          trifolii WSM2304]
          Length = 79

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +   ++Q+L+LVFGGELE++   + R+   +D+VGIF  Y+ A   WK K+QQ VDNA
Sbjct: 1  MTDSGDKKQLLHLVFGGELESLDNVQFRDLKGLDIVGIFPDYATALTAWKSKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    + 
Sbjct: 61 HMRYFIVHMHRLLDPQE 77


>gi|218682628|ref|ZP_03530229.1| hypothetical protein RetlC8_27763 [Rhizobium etli CIAT 894]
          Length = 79

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 50/77 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+L+LVFGGELE++   + R+  D+D+VGIF  Y+ A   WK K+QQ VDNA
Sbjct: 1  MTESGDKKQLLHLVFGGELESLDDVQFRDLKDLDIVGIFPDYATALTAWKSKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    + 
Sbjct: 61 HMRYFIVHMHRLLDPQE 77


>gi|222147683|ref|YP_002548640.1| hypothetical protein Avi_0900 [Agrobacterium vitis S4]
 gi|221734671|gb|ACM35634.1| Conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 78

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 49/75 (65%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+L+LVFGGEL N+ + + R+  ++D+VGIF  Y+ A   WK K+QQ VDNA
Sbjct: 1  MTETSDKKQLLHLVFGGELSNLAEVQFRDLKELDIVGIFPDYATALSAWKSKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHY 75
           MRYF+V + R    
Sbjct: 61 HMRYFIVHMHRLLTP 75


>gi|241203279|ref|YP_002974375.1| hypothetical protein Rleg_0531 [Rhizobium leguminosarum bv.
          trifolii WSM1325]
 gi|240857169|gb|ACS54836.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
          trifolii WSM1325]
          Length = 81

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 51/80 (63%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +   ++Q+L+LVFGGELE++   + R+   +D+VGIF  Y+ A   WK K+QQ VDNA
Sbjct: 1  MTDSGDKKQLLHLVFGGELESLDDVQFRDLQGLDIVGIFPDYATALTAWKSKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R    +   +
Sbjct: 61 HMRYFIVHMHRLLDPQEKPK 80


>gi|307941677|ref|ZP_07657032.1| inositol monophosphatase family protein [Roseibium sp. TrichSKD4]
 gi|307775285|gb|EFO34491.1| inositol monophosphatase family protein [Roseibium sp. TrichSKD4]
          Length = 79

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 48/77 (62%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    + +Q+L+LVFGGELE       R  D++D+VGI+ +Y+ AY  WK K+Q  VDNA
Sbjct: 1  MSGTEENKQLLHLVFGGELETPEGITFRYLDELDIVGIYPNYAEAYVAWKAKAQSTVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    + 
Sbjct: 61 HMRYFIVHMHRLLDPDT 77


>gi|15888038|ref|NP_353719.1| hypothetical protein Atu8086 [Agrobacterium tumefaciens str. C58]
 gi|15155658|gb|AAK86504.1| conserved hypothetical protein [Agrobacterium tumefaciens str.
          C58]
          Length = 79

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 51/76 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    + +Q+L+LVFGGELEN+   + R+ + +D+VGI+  Y++A   WK K+Q  VDNA
Sbjct: 1  MTETGKPKQLLHLVFGGELENLQDVQFRDLNALDIVGIYPDYASALTAWKSKAQMTVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF+V + R  + +
Sbjct: 61 HMRYFIVHMHRLLNPD 76


>gi|190890552|ref|YP_001977094.1| hypothetical protein RHECIAT_CH0000931 [Rhizobium etli CIAT 652]
 gi|190695831|gb|ACE89916.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327192202|gb|EGE59172.1| hypothetical protein RHECNPAF_238009 [Rhizobium etli CNPAF512]
          Length = 82

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 49/77 (63%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+L+LVFGGELE++   + R+   +D+VGIF  Y+ A   WK K+QQ VDNA
Sbjct: 1  MTESGDKKQLLHLVFGGELESLDDVQFRDLKGLDIVGIFPDYATALTAWKAKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    + 
Sbjct: 61 HMRYFIVHMHRLLDPQE 77


>gi|85717184|ref|ZP_01048142.1| hypothetical protein NB311A_14682 [Nitrobacter sp. Nb-311A]
 gi|85696017|gb|EAQ33917.1| hypothetical protein NB311A_14682 [Nitrobacter sp. Nb-311A]
          Length = 83

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 50/80 (62%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M      +Q+L+LV GGEL ++     +N D++++VG++ +Y++AY  WK K+Q+ VDNA
Sbjct: 1  MPPDSPPQQLLHLVIGGELTDLAHVTFKNLDEVEIVGLYPNYASAYAAWKAKAQRTVDNA 60

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R        +
Sbjct: 61 HMRYFIVHLHRLLDPSQDTK 80


>gi|218674010|ref|ZP_03523679.1| hypothetical protein RetlG_21977 [Rhizobium etli GR56]
          Length = 82

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +   ++Q+L+LVFGGELE++   + R+   +D+VGIF  Y+ A   WK K+QQ VDNA
Sbjct: 1  MTDSGDKKQLLHLVFGGELESLDDVQFRDLKGLDIVGIFPDYATALTAWKAKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    + 
Sbjct: 61 HMRYFIVHMHRLLDPQE 77


>gi|227821003|ref|YP_002824973.1| hypothetical protein NGR_c04240 [Sinorhizobium fredii NGR234]
 gi|227340002|gb|ACP24220.1| hypothetical protein NGR_c04240 [Sinorhizobium fredii NGR234]
          Length = 78

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 51/76 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    +++Q+L+LVFGGEL  +T  + R+ +D+D+VGIF  Y +A+  WK K+Q  VDNA
Sbjct: 1  MAQNTEKKQLLHLVFGGELTTLTDVQFRDLNDLDIVGIFPDYESAHVAWKAKAQMTVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF+V + R    E
Sbjct: 61 HMRYFIVHMHRLLDPE 76


>gi|15964562|ref|NP_384915.1| hypothetical protein SMc00895 [Sinorhizobium meliloti 1021]
 gi|307314752|ref|ZP_07594348.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307320046|ref|ZP_07599467.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|15073740|emb|CAC45381.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306894261|gb|EFN25026.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|306898976|gb|EFN29622.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 78

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 51/76 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +  +++Q L+LVFGGEL  +T  + R+ +++D+VGIF  Y +A+  WK K+Q  VDNA
Sbjct: 1  MAHDSEKKQRLHLVFGGELATLTGVQFRDLENLDIVGIFPDYESAHVAWKAKAQMTVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF+V + R    E
Sbjct: 61 HMRYFIVHMHRLLDPE 76


>gi|92118646|ref|YP_578375.1| hypothetical protein Nham_3180 [Nitrobacter hamburgensis X14]
 gi|91801540|gb|ABE63915.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 83

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 50/80 (62%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M      +Q+L+LV GGEL ++     ++ D++++VG++ +Y++AY  WK K+QQ VDNA
Sbjct: 1  MPPDSPPQQLLHLVIGGELTDLAHTTFKDLDEVEIVGLYPNYASAYAAWKAKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R        +
Sbjct: 61 HMRYFIVHLHRLLDPGQDTK 80


>gi|298293946|ref|YP_003695885.1| hypothetical protein Snov_3996 [Starkeya novella DSM 506]
 gi|296930457|gb|ADH91266.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 82

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 48/76 (63%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M       Q+L+LVFGGELE+I     ++ D +D+VG++ +Y+ A+  WK K+QQ VD+A
Sbjct: 1  MTETKASPQLLHLVFGGELESIDGITFKDLDKLDIVGVYPNYATAHAAWKAKAQQTVDSA 60

Query: 61 LMRYFVVDISRFPHYE 76
            RYF+V + R    E
Sbjct: 61 QTRYFIVHLHRLLDPE 76


>gi|319408058|emb|CBI81712.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 80

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 53/77 (68%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    +++Q+L+LVFGGEL+N+   + +N +D+DVVGIF  Y +A+  W+ K+Q  VDNA
Sbjct: 1  MNETNKKKQLLHLVFGGELKNLDDNQFKNINDLDVVGIFPDYQSAHAAWRAKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
          L RY++V + R    E+
Sbjct: 61 LQRYYIVHLHRLLDPEI 77


>gi|158424004|ref|YP_001525296.1| hypothetical protein AZC_2380 [Azorhizobium caulinodans ORS 571]
 gi|158330893|dbj|BAF88378.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 82

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 49/74 (66%)

Query: 6  QEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYF 65
          + +Q+L+LVFGGEL+++     ++   +D+VGI+  Y++A   W+ K+Q  VDNA+MRYF
Sbjct: 5  ERKQLLHLVFGGELKDLDSVDFKDLSQLDIVGIYPDYASAAAAWRGKAQMTVDNAMMRYF 64

Query: 66 VVDISRFPHYELGK 79
          VV + R    +  K
Sbjct: 65 VVHLHRLLDPDTDK 78


>gi|75676742|ref|YP_319163.1| hypothetical protein Nwi_2558 [Nitrobacter winogradskyi Nb-255]
 gi|74421612|gb|ABA05811.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 83

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 50/80 (62%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+L+LV GGEL ++     +N D++++VG++ +Y++AY  WK K+Q+ VDNA
Sbjct: 1  MPSDSPPQQLLHLVIGGELTDLAHTAFKNLDEVEIVGLYPNYASAYAAWKAKAQRTVDNA 60

Query: 61 LMRYFVVDISRFPHYELGKE 80
            RYF+V + R        +
Sbjct: 61 HTRYFIVHLHRLLDPGQDTK 80


>gi|254472025|ref|ZP_05085426.1| inositol monophosphatase family protein [Pseudovibrio sp. JE062]
 gi|211959227|gb|EEA94426.1| inositol monophosphatase family protein [Pseudovibrio sp. JE062]
          Length = 80

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 53/80 (66%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    + +Q+L+LVFGGELE+I+  + ++  D+D+VGI+ +Y+ A+  WK K+Q  VDNA
Sbjct: 1  MSAQEENQQLLHLVFGGELEDISNVRFKDLKDLDIVGIYPNYAEAHAAWKAKAQSTVDNA 60

Query: 61 LMRYFVVDISRFPHYELGKE 80
          LMRYF+V + R        +
Sbjct: 61 LMRYFIVHMHRLLDPGAETK 80


>gi|90419985|ref|ZP_01227894.1| conserved hypothetical protein [Aurantimonas manganoxydans
          SI85-9A1]
 gi|90336026|gb|EAS49774.1| conserved hypothetical protein [Aurantimonas manganoxydans
          SI85-9A1]
          Length = 78

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 52/76 (68%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M+   + +Q+L+LVFGGEL+++     ++ D++D+VGIF  Y++A   W+ K+QQ VDNA
Sbjct: 1  MMEEQKPKQLLHLVFGGELDDLQSVDFKDLDNLDIVGIFPDYASALAAWRSKAQQTVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF+V + R    +
Sbjct: 61 AMRYFIVHMHRLMDPD 76


>gi|163758422|ref|ZP_02165510.1| hypothetical protein HPDFL43_02315 [Hoeflea phototrophica DFL-43]
 gi|162284711|gb|EDQ34994.1| hypothetical protein HPDFL43_02315 [Hoeflea phototrophica DFL-43]
          Length = 82

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M  G +++Q+L+LVFGGEL+++     R+ +D+D+VGI+ +Y+ A+  WK K+Q  VDNA
Sbjct: 1  MSEG-EDKQLLHLVFGGELKSLDSMAFRDLNDLDIVGIYPNYATAHQAWKSKAQMTVDNA 59

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R    +   +
Sbjct: 60 HMRYFIVHMHRMLDPDSDSK 79


>gi|319784260|ref|YP_004143736.1| hypothetical protein Mesci_4577 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317170148|gb|ADV13686.1| hypothetical protein Mesci_4577 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 81

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+L+LVFGGEL+ +   + R+ D +D+VGI+  Y +A+  WK K+Q  VDNA
Sbjct: 1  MAAEDGKKQLLHLVFGGELKKLGGTEFRDLDGLDIVGIYPDYQSAHTAWKAKAQASVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYFVV + R    +
Sbjct: 61 HMRYFVVHLHRLLDPD 76


>gi|260464408|ref|ZP_05812599.1| conserved hypothetical protein [Mesorhizobium opportunistum
          WSM2075]
 gi|259029878|gb|EEW31163.1| conserved hypothetical protein [Mesorhizobium opportunistum
          WSM2075]
          Length = 81

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+L+LVFGGEL+ +   + R+ D +D+VGI+  Y +A+  WK K+Q  VDNA
Sbjct: 1  MAAEDGKKQLLHLVFGGELKKLGGTEFRDLDGLDIVGIYPDYQSAHTAWKAKAQASVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYFVV + R    +
Sbjct: 61 HMRYFVVHLHRLLDPD 76


>gi|254563197|ref|YP_003070292.1| hypothetical protein METDI4860 [Methylobacterium extorquens DM4]
 gi|254270475|emb|CAX26475.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 75

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M   I  +Q L+LVFGGELE+++  + R+  D+D+VGIF  Y++A   W+ K+Q  VDNA
Sbjct: 1  MTTTIDSDQKLHLVFGGELEDVSGVRFRDVKDLDIVGIFPDYASAQTAWRSKAQATVDNA 60

Query: 61 LMRYFVVDISRFPHY 75
            RYF+V + R    
Sbjct: 61 QTRYFIVHLHRLLEP 75


>gi|170744128|ref|YP_001772783.1| hypothetical protein M446_6073 [Methylobacterium sp. 4-46]
 gi|168198402|gb|ACA20349.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 82

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
              +  Q+L+LVFGGEL ++     R+   +D+VGIF  Y++A   WK K+QQ VD+AL
Sbjct: 9  TQTSEPTQLLHLVFGGELTSLDGITFRDLSKLDIVGIFPDYASAAVAWKAKAQQTVDSAL 68

Query: 62 MRYFVVDISRFPHY 75
           RYF+V + R    
Sbjct: 69 TRYFIVHLHRLLQP 82


>gi|150395648|ref|YP_001326115.1| hypothetical protein Smed_0423 [Sinorhizobium medicae WSM419]
 gi|150027163|gb|ABR59280.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 78

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 52/77 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +  +++Q L+LVFGGEL  +   + R+ +++D+VGIF  Y +A+ VWK K+Q  VDNA
Sbjct: 1  MAHDSEKKQRLHLVFGGELATLADVQFRDLENLDIVGIFPDYESAHAVWKAKAQMTVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
           MRYF+V + R    E+
Sbjct: 61 HMRYFIVHMHRLLDPEV 77


>gi|304393193|ref|ZP_07375121.1| inositol monophosphatase family protein [Ahrensia sp. R2A130]
 gi|303294200|gb|EFL88572.1| inositol monophosphatase family protein [Ahrensia sp. R2A130]
          Length = 78

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 48/76 (63%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    + +Q+L+LVFGGELE++     R+ + +D+VGI+ +Y  A   WK K+Q  VDNA
Sbjct: 1  MAIETENKQLLHLVFGGELESLEGVTFRDLEKLDIVGIYPNYETARAAWKAKAQASVDNA 60

Query: 61 LMRYFVVDISRFPHYE 76
           MRYF V + RF   E
Sbjct: 61 HMRYFCVHLHRFLEPE 76


>gi|110677696|ref|YP_680703.1| hypothetical protein RD1_0292 [Roseobacter denitrificans OCh 114]
 gi|109453812|gb|ABG30017.1| hypothetical protein RD1_0292 [Roseobacter denitrificans OCh 114]
          Length = 97

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 46/69 (66%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGEL +  +   +N DD+ +VGIF  Y++A+D WK ++Q+ VDNA MRYF+  
Sbjct: 20 QRLHLVFGGELVDPGKNTFKNVDDLHIVGIFPDYASAFDAWKAEAQRTVDNAHMRYFIAH 79

Query: 69 ISRFPHYEL 77
          I R    E 
Sbjct: 80 IHRLRDEET 88


>gi|163853274|ref|YP_001641317.1| hypothetical protein Mext_3874 [Methylobacterium extorquens PA1]
 gi|218532090|ref|YP_002422906.1| hypothetical protein Mchl_4184 [Methylobacterium chloromethanicum
          CM4]
 gi|240140682|ref|YP_002965162.1| hypothetical protein MexAM1_META1p4248 [Methylobacterium
          extorquens AM1]
 gi|163664879|gb|ABY32246.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
 gi|218524393|gb|ACK84978.1| conserved hypothetical protein [Methylobacterium chloromethanicum
          CM4]
 gi|240010659|gb|ACS41885.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 75

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M   I  +Q L+LVFGGELE+++  + R+  D+D+VG+F  Y++A   W+ K+Q  VDNA
Sbjct: 1  MTTTIDSDQKLHLVFGGELEDVSGVRFRDVKDLDIVGVFPDYASAQTAWRSKAQATVDNA 60

Query: 61 LMRYFVVDISRFPHY 75
            RYF+V + R    
Sbjct: 61 QTRYFIVHLHRLLEP 75


>gi|114705770|ref|ZP_01438673.1| hypothetical protein FP2506_14929 [Fulvimarina pelagi HTCC2506]
 gi|114538616|gb|EAU41737.1| hypothetical protein FP2506_14929 [Fulvimarina pelagi HTCC2506]
          Length = 77

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 52/75 (69%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
          ++  + +Q+L+LVFGGEL+++     ++ DD+D+VGIF  YS+A   W+ KSQQ VDNA 
Sbjct: 1  MDEQKPKQLLHLVFGGELDDLQSVNFKDLDDLDIVGIFPDYSSALSAWRSKSQQTVDNAA 60

Query: 62 MRYFVVDISRFPHYE 76
          MRYF+V + R    E
Sbjct: 61 MRYFIVHMHRLLTPE 75


>gi|89052892|ref|YP_508343.1| hypothetical protein Jann_0401 [Jannaschia sp. CCS1]
 gi|88862441|gb|ABD53318.1| hypothetical protein Jann_0401 [Jannaschia sp. CCS1]
          Length = 108

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 47/71 (66%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          I   Q L+LVFGGEL++  + +  NP+DI VVG+F  Y +AYD WK ++Q+ VDNA MRY
Sbjct: 26 IPVPQRLHLVFGGELKDPQKTEFENPEDIHVVGMFPDYQSAYDAWKSEAQRTVDNAHMRY 85

Query: 65 FVVDISRFPHY 75
          F+  I R    
Sbjct: 86 FIAHIHRLRDE 96


>gi|83950893|ref|ZP_00959626.1| hypothetical protein ISM_07325 [Roseovarius nubinhibens ISM]
 gi|83838792|gb|EAP78088.1| hypothetical protein ISM_07325 [Roseovarius nubinhibens ISM]
          Length = 80

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 45/72 (62%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T+   ++ +D+ +VGIF +Y  AY+ WK ++Q+ VDNA MRYF+
Sbjct: 1  MTQRLHLVFGGELSDPTKTVFKDVNDLHIVGIFPNYETAYNAWKSEAQRTVDNAHMRYFI 60

Query: 67 VDISRFPHYELG 78
            + R       
Sbjct: 61 AHLHRLRDETTP 72


>gi|254486282|ref|ZP_05099487.1| inositol monophosphatase family protein [Roseobacter sp. GAI101]
 gi|214043151|gb|EEB83789.1| inositol monophosphatase family protein [Roseobacter sp. GAI101]
          Length = 87

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 47/75 (62%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
                 Q L+LVFGGEL + T    +N DDI VVGIF +Y++AYD WK ++Q+ VDNA 
Sbjct: 3  TKDSTMTQRLHLVFGGELVSPTGTAFKNVDDIHVVGIFPNYASAYDAWKNEAQRTVDNAH 62

Query: 62 MRYFVVDISRFPHYE 76
          MRYF+  + R    E
Sbjct: 63 MRYFIAHLHRLRDEE 77


>gi|209886366|ref|YP_002290223.1| inositol monophosphatase family protein [Oligotropha
          carboxidovorans OM5]
 gi|209874562|gb|ACI94358.1| inositol monophosphatase family protein [Oligotropha
          carboxidovorans OM5]
          Length = 82

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +     Q+L+LV GGE+ ++     ++   ++ VG+F +Y+ AY  WK ++QQ VDNA
Sbjct: 1  MPDTAP-PQLLHLVIGGEVSDLDGTTFKDLSKVETVGLFPNYATAYQAWKARAQQTVDNA 59

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R     L  +
Sbjct: 60 HMRYFIVHVHRLLDPGLDSK 79


>gi|170747906|ref|YP_001754166.1| hypothetical protein Mrad2831_1488 [Methylobacterium
          radiotolerans JCM 2831]
 gi|170654428|gb|ACB23483.1| conserved hypothetical protein [Methylobacterium radiotolerans
          JCM 2831]
          Length = 78

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (62%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M   I  +Q L+LVFGGEL+++   + R+  ++D+VGIF  Y++A   W+ K+Q  VD+A
Sbjct: 1  MTTAIDSDQKLHLVFGGELQDLDGVRFRDIRNLDIVGIFPDYASAQAAWRAKAQATVDSA 60

Query: 61 LMRYFVVDISRFPHY 75
            RYFVV + R    
Sbjct: 61 QTRYFVVHLHRLLEP 75


>gi|188583527|ref|YP_001926972.1| hypothetical protein Mpop_4331 [Methylobacterium populi BJ001]
 gi|179347025|gb|ACB82437.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 75

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M   I  +Q L+LVFGGELE+++  + R+  D+D+VGIF  Y++A   W+ K+Q  VD+A
Sbjct: 1  MTTTIDSDQKLHLVFGGELEDVSGVRFRDIKDLDIVGIFPDYASAQTAWRVKAQATVDSA 60

Query: 61 LMRYFVVDISRFPHY 75
            RYF+V + R    
Sbjct: 61 QTRYFIVHLHRLLEP 75


>gi|220926378|ref|YP_002501680.1| hypothetical protein Mnod_6609 [Methylobacterium nodulans ORS
          2060]
 gi|219950985|gb|ACL61377.1| conserved hypothetical protein [Methylobacterium nodulans ORS
          2060]
          Length = 82

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 45/74 (60%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
              +  Q+L+LVFGGEL ++     R+   +D+VGIF  Y++A   WK K+QQ VD+AL
Sbjct: 9  SQSSEPTQLLHLVFGGELTSLEGITFRDLSKLDIVGIFPDYASAAMAWKAKAQQTVDSAL 68

Query: 62 MRYFVVDISRFPHY 75
           RYF+V + +    
Sbjct: 69 TRYFIVHLHKLLQP 82


>gi|23007704|ref|ZP_00049455.1| COG0577: ABC-type antimicrobial peptide transport system,
          permease component [Magnetospirillum magnetotacticum
          MS-1]
          Length = 75

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M   I  +Q L+LVFGGELE+++  + R+  D+D+VG+F  Y++A   W+ K+Q  VD+A
Sbjct: 1  MTTTIDSDQKLHLVFGGELEDVSGVRFRDVKDLDIVGVFPDYASAQTAWRSKAQATVDSA 60

Query: 61 LMRYFVVDISRFPHY 75
            RYF+V + R    
Sbjct: 61 QTRYFIVHLHRLLEP 75


>gi|294675788|ref|YP_003576403.1| hypothetical protein RCAP_rcc00231 [Rhodobacter capsulatus SB
          1003]
 gi|294474608|gb|ADE83996.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 85

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 4  GIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMR 63
               Q L+LVFGGEL + ++ + ++ + I +VGI+ +Y+ AY  WK ++Q+ VD+A MR
Sbjct: 2  SKPSPQRLHLVFGGELVSASRSEFKDVNAIHIVGIYPNYATAYSAWKAEAQRTVDDAHMR 61

Query: 64 YFVVDISRFPHYELG 78
          YF+  + R    E  
Sbjct: 62 YFIAHLHRLRDEETP 76


>gi|114799663|ref|YP_760082.1| inositol monophosphatase family protein [Hyphomonas neptunium ATCC
           15444]
 gi|114739837|gb|ABI77962.1| inositol monophosphatase family protein [Hyphomonas neptunium ATCC
           15444]
          Length = 364

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MINGIQE-EQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDN 59
           M    +  +Q+L++VFGGEL+++T  +  +   +D +G F +Y  AYD WK  +Q+ VD 
Sbjct: 281 MSESAKTGKQLLHIVFGGELKDVTGVEFEDLSQMDFIGAFPNYQEAYDAWKSAAQRTVDQ 340

Query: 60  ALMRYFVVDISRFPHYELG 78
           A MRYF++   +      G
Sbjct: 341 AEMRYFILHAHKLLDPATG 359


>gi|83855275|ref|ZP_00948805.1| hypothetical protein NAS141_11106 [Sulfitobacter sp. NAS-14.1]
 gi|83843118|gb|EAP82285.1| hypothetical protein NAS141_11106 [Sulfitobacter sp. NAS-14.1]
          Length = 87

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 47/75 (62%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
                 Q L+LVFGGEL + T    +N DDI VVGIF +Y++AYD WK ++Q+ VDNA 
Sbjct: 3  TKDRDMTQRLHLVFGGELISPTGTAFKNVDDIHVVGIFPNYASAYDAWKNEAQRTVDNAH 62

Query: 62 MRYFVVDISRFPHYE 76
          MRYF+  + R    E
Sbjct: 63 MRYFIAHLHRLRDEE 77


>gi|126730451|ref|ZP_01746262.1| hypothetical protein SSE37_11864 [Sagittula stellata E-37]
 gi|126709184|gb|EBA08239.1| hypothetical protein SSE37_11864 [Sagittula stellata E-37]
          Length = 96

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 2/72 (2%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGELE+ T+   R+ +D+ +VGIF +Y  AY+ WK ++Q+ VDNA MRYF+  
Sbjct: 19 QRLHLVFGGELEDPTKTVFRDVNDLHIVGIFPNYEEAYNAWKAEAQRTVDNAHMRYFIAH 78

Query: 69 ISRFPHYELGKE 80
          + R    E GKE
Sbjct: 79 LHRLR--EEGKE 88


>gi|300024091|ref|YP_003756702.1| hypothetical protein Hden_2585 [Hyphomicrobium denitrificans ATCC
          51888]
 gi|299525912|gb|ADJ24381.1| hypothetical protein Hden_2585 [Hyphomicrobium denitrificans ATCC
          51888]
          Length = 92

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 47/71 (66%)

Query: 6  QEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYF 65
          ++ Q+L+LVFGGEL+ +   +  +   +D+VGIF  Y +AY  WK  +Q+ VDNA+MRYF
Sbjct: 10 KQPQLLHLVFGGELKTLDSHEFHDLSTLDIVGIFPDYQSAYVAWKGAAQRSVDNAMMRYF 69

Query: 66 VVDISRFPHYE 76
          +V + R    +
Sbjct: 70 IVHLHRLLEPK 80


>gi|221233248|ref|YP_002515684.1| cytosolic protein [Caulobacter crescentus NA1000]
 gi|220962420|gb|ACL93776.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000]
          Length = 77

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 44/74 (59%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          + ++Q+L++V GGEL+++   + R+   ++ VG + SY  A+  WK K+Q  VDNA  RY
Sbjct: 4  MPDKQLLHIVVGGELKDVAGVEFRDLSKVEFVGAYPSYDEAHKAWKAKAQATVDNAHARY 63

Query: 65 FVVDISRFPHYELG 78
          F++   +      G
Sbjct: 64 FIIHAHKLLDPSEG 77


>gi|90426177|ref|YP_534547.1| hypothetical protein RPC_4706 [Rhodopseudomonas palustris BisB18]
 gi|90108191|gb|ABD90228.1| conserved hypothetical protein [Rhodopseudomonas palustris
          BisB18]
          Length = 80

 Score =  127 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 6  QEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYF 65
            EQ+L+LV GGEL N+     ++   ++ VG+F +Y+ AY  WK K+ Q VDNA MRYF
Sbjct: 3  DNEQLLHLVLGGELTNLEGNTFKDLSQVEFVGVFPNYATAYAAWKAKAHQTVDNAHMRYF 62

Query: 66 VVDISRFPHYELGKE 80
          VV + R    +   +
Sbjct: 63 VVHLHRLLDPDQDPK 77


>gi|254293379|ref|YP_003059402.1| inositol monophosphatase [Hirschia baltica ATCC 49814]
 gi|254041910|gb|ACT58705.1| inositol monophosphatase [Hirschia baltica ATCC 49814]
          Length = 383

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 6   QEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYF 65
              Q+L+LV GGEL+++T  +  +   ++ VG F S+  AY+ WK  +Q+ VDNA MR+F
Sbjct: 306 SSSQLLHLVIGGELKDVTGIEFEDLKAVEFVGAFGSHEEAYNAWKAAAQRTVDNAEMRFF 365

Query: 66  VVDISRFPHYELG 78
           ++   R    E G
Sbjct: 366 ILHAHRLMDPETG 378


>gi|16124562|ref|NP_419126.1| hypothetical protein CC_0307 [Caulobacter crescentus CB15]
 gi|13421450|gb|AAK22294.1| hypothetical protein CC_0307 [Caulobacter crescentus CB15]
          Length = 74

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 44/74 (59%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          + ++Q+L++V GGEL+++   + R+   ++ VG + SY  A+  WK K+Q  VDNA  RY
Sbjct: 1  MPDKQLLHIVVGGELKDVAGVEFRDLSKVEFVGAYPSYDEAHKAWKAKAQATVDNAHARY 60

Query: 65 FVVDISRFPHYELG 78
          F++   +      G
Sbjct: 61 FIIHAHKLLDPSEG 74


>gi|84685997|ref|ZP_01013893.1| hypothetical protein 1099457000261_RB2654_14800 [Maritimibacter
          alkaliphilus HTCC2654]
 gi|84666090|gb|EAQ12564.1| hypothetical protein RB2654_14800 [Rhodobacterales bacterium
          HTCC2654]
          Length = 80

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 47/70 (67%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGEL + T+ + ++ DDI +VGI+  Y+ AYD W+ ++Q+ VDNA MRYF+  
Sbjct: 3  QRLHLVFGGELVDPTKTQFKSVDDIHIVGIYPDYATAYDAWRAEAQRTVDNAHMRYFIAH 62

Query: 69 ISRFPHYELG 78
          + R    E  
Sbjct: 63 LHRLRDEETP 72


>gi|114569189|ref|YP_755869.1| hypothetical protein Mmar10_0638 [Maricaulis maris MCS10]
 gi|114339651|gb|ABI64931.1| hypothetical protein Mmar10_0638 [Maricaulis maris MCS10]
          Length = 84

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 1  MINGIQEEQVLYLVFGGELE--NITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVD 58
          M       Q+L+LV GGEL   +    + ++ D++D VG F +Y+ A   WK  +Q+ VD
Sbjct: 1  MSETKINNQLLHLVIGGELACVDPQNCEFKDLDEVDFVGAFGTYAEARAAWKGAAQRTVD 60

Query: 59 NALMRYFVVDISRFPHYELGKE 80
          NA MRYFV+   +       K+
Sbjct: 61 NAHMRYFVIHAHKLLDPATEKK 82


>gi|83941798|ref|ZP_00954260.1| hypothetical protein EE36_06178 [Sulfitobacter sp. EE-36]
 gi|83847618|gb|EAP85493.1| hypothetical protein EE36_06178 [Sulfitobacter sp. EE-36]
          Length = 80

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T    +N DDI VVGIF +Y++AYD WK ++Q+ VDNA MRYF+
Sbjct: 1  MTQRLHLVFGGELISPTGTAFKNVDDIHVVGIFPNYASAYDAWKNEAQRTVDNAHMRYFI 60

Query: 67 VDISRFPHYE 76
            + R    E
Sbjct: 61 AHLHRLRDEE 70


>gi|27382628|ref|NP_774157.1| hypothetical protein bsl7517 [Bradyrhizobium japonicum USDA 110]
 gi|27355800|dbj|BAC52782.1| bsl7517 [Bradyrhizobium japonicum USDA 110]
          Length = 81

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+L+LV GGEL ++     +N DD+++VG++ +Y++A+  W+ K+Q  VDNA
Sbjct: 1  MPDSAP-QQLLHLVIGGELLDLEHNTFKNLDDVEIVGLYPNYASAHVAWRAKAQSTVDNA 59

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R        +
Sbjct: 60 QMRYFIVHLHRLLDPNQETK 79


>gi|295691194|ref|YP_003594887.1| cytosolic protein [Caulobacter segnis ATCC 21756]
 gi|295433097|gb|ADG12269.1| cytosolic protein [Caulobacter segnis ATCC 21756]
          Length = 75

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 43/74 (58%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          + ++Q+L++V GGEL+++   + R+   ++ VG + +Y  A+  WK K+Q  VDNA  RY
Sbjct: 1  MPDKQLLHIVIGGELKDVAGIEFRDLSKVEFVGAYPNYDEAHKAWKAKAQATVDNAHARY 60

Query: 65 FVVDISRFPHYELG 78
          F++   +       
Sbjct: 61 FIIHAHKLLDPSSE 74


>gi|89070025|ref|ZP_01157356.1| hypothetical protein OG2516_09655 [Oceanicola granulosus
          HTCC2516]
 gi|89044362|gb|EAR50500.1| hypothetical protein OG2516_09655 [Oceanicola granulosus
          HTCC2516]
          Length = 81

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 45/70 (64%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + ++   +N DDI +VG+F  Y +AY  WK ++Q+ VDNA MRYF+
Sbjct: 1  MTQRLHLVFGGELVDPSKNAFKNVDDIHIVGMFPDYDSAYSAWKAEAQRTVDNAHMRYFI 60

Query: 67 VDISRFPHYE 76
            + R    E
Sbjct: 61 AHLHRLRDEE 70


>gi|84515032|ref|ZP_01002395.1| hypothetical protein SKA53_12448 [Loktanella vestfoldensis SKA53]
 gi|84511191|gb|EAQ07645.1| hypothetical protein SKA53_12448 [Loktanella vestfoldensis SKA53]
          Length = 81

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 44/71 (61%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T+   ++   ID+VG+F +Y  A++ WK  +Q+ VD+A MRYF+
Sbjct: 1  MTQRLHLVFGGELVDPTKNAFKDVAAIDIVGMFPNYQTAFNAWKAAAQRTVDDAHMRYFI 60

Query: 67 VDISRFPHYEL 77
            I R    E 
Sbjct: 61 AHIHRLRDEET 71


>gi|255263428|ref|ZP_05342770.1| inositol monophosphatase family protein [Thalassiobium sp. R2A62]
 gi|255105763|gb|EET48437.1| inositol monophosphatase family protein [Thalassiobium sp. R2A62]
          Length = 81

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T+   ++ DDI +VGIF  Y +AY+ WK ++Q+ VDNA MRYF+
Sbjct: 1  MTQRLHLVFGGELIDPTKNAFKSVDDIHIVGIFPDYESAYNAWKSEAQRTVDNAHMRYFI 60

Query: 67 VDISRFPHYEL 77
            I R    + 
Sbjct: 61 AHIHRLRDEQT 71


>gi|49475076|ref|YP_033117.1| hypothetical protein BH02650 [Bartonella henselae str. Houston-1]
 gi|49237881|emb|CAF27077.1| hypothetical protein BH02650 [Bartonella henselae str. Houston-1]
          Length = 81

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 53/78 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          MI   +++Q L+LVFGGEL+N+   + +N DD+DVVGIF  Y +A + W  K+Q  VDNA
Sbjct: 1  MIETNEKKQYLHLVFGGELKNLNSNQFKNVDDLDVVGIFPDYQSAQEAWHAKAQSTVDNA 60

Query: 61 LMRYFVVDISRFPHYELG 78
          L RY+++D+ R    E G
Sbjct: 61 LQRYYILDLHRLLDLENG 78


>gi|86748977|ref|YP_485473.1| hypothetical protein RPB_1854 [Rhodopseudomonas palustris HaA2]
 gi|86572005|gb|ABD06562.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 81

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 8  EQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          +Q+L+LV GGELE++     R+ D +D+VG++ SY++A+  WK K+ Q VDNA MRYF+V
Sbjct: 6  QQLLHLVIGGELEDLENVTFRDLDKVDIVGVYPSYASAFAAWKAKAHQTVDNAHMRYFIV 65

Query: 68 DISRFPHYELGKE 80
           + R        +
Sbjct: 66 HLHRLLDPGQDAK 78


>gi|84500597|ref|ZP_00998846.1| hypothetical protein OB2597_11581 [Oceanicola batsensis HTCC2597]
 gi|84391550|gb|EAQ03882.1| hypothetical protein OB2597_11581 [Oceanicola batsensis HTCC2597]
          Length = 81

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 47/70 (67%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T+   ++ DDI +VGIF  Y++A+D WK ++Q+ VDNA MRY++
Sbjct: 1  MTQRLHLVFGGELVDPTKNVFKDVDDIHIVGIFPDYASAFDAWKAEAQRTVDNAHMRYYI 60

Query: 67 VDISRFPHYE 76
            + R    E
Sbjct: 61 AHLHRLRDEE 70


>gi|316932701|ref|YP_004107683.1| hypothetical protein Rpdx1_1327 [Rhodopseudomonas palustris DX-1]
 gi|315600415|gb|ADU42950.1| hypothetical protein Rpdx1_1327 [Rhodopseudomonas palustris DX-1]
          Length = 82

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%)

Query: 8  EQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          +Q+L+LV GGEL ++     R+ D +D+VG++ +Y+ AY  WK ++ Q VDNA MRYF+V
Sbjct: 6  QQLLHLVIGGELTDLENVTFRDLDKVDIVGVYPNYATAYAAWKARAHQTVDNAHMRYFIV 65

Query: 68 DISRFPHYELGKE 80
           + R    E   +
Sbjct: 66 HLHRLLDPEKEAQ 78


>gi|126736222|ref|ZP_01751965.1| hypothetical protein RCCS2_10805 [Roseobacter sp. CCS2]
 gi|126714388|gb|EBA11256.1| hypothetical protein RCCS2_10805 [Roseobacter sp. CCS2]
          Length = 81

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 43/72 (59%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + ++   ++ + ID+VG+F  Y  AY+ WK  + + VDNA MRYF+
Sbjct: 1  MTQRLHLVFGGELIDPSKNAFKDIEAIDIVGMFPDYDTAYNAWKSAAHRTVDNAHMRYFI 60

Query: 67 VDISRFPHYELG 78
            I R    E  
Sbjct: 61 AHIHRLRDEETE 72


>gi|91978571|ref|YP_571230.1| hypothetical protein RPD_4110 [Rhodopseudomonas palustris BisB5]
 gi|91685027|gb|ABE41329.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 81

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 8  EQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          +Q+L+LV GGELE++     R+ + +D+VG+F SY++A+  WK K+ Q VDNA MRYF+V
Sbjct: 6  QQLLHLVIGGELEDLENVTFRDLEKVDIVGVFPSYASAFAAWKAKAHQTVDNAHMRYFIV 65

Query: 68 DISRFPHYELGKE 80
           + R        +
Sbjct: 66 HLHRLLDPGQDAK 78


>gi|39934232|ref|NP_946508.1| hypothetical protein RPA1157 [Rhodopseudomonas palustris CGA009]
 gi|192289758|ref|YP_001990363.1| hypothetical protein Rpal_1348 [Rhodopseudomonas palustris TIE-1]
 gi|39648080|emb|CAE26600.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
 gi|192283507|gb|ACE99887.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 82

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%)

Query: 8  EQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          +Q+L+LV GGELE++     R+ + +D+VG++ +Y+ AY  WK ++ Q VDNA MRYF+V
Sbjct: 6  QQLLHLVIGGELEDLENVTFRDLEKVDIVGVYPNYATAYAAWKARAHQTVDNAHMRYFIV 65

Query: 68 DISRFPHYE 76
           + R    E
Sbjct: 66 HLHRLLDPE 74


>gi|163745420|ref|ZP_02152780.1| hypothetical protein OIHEL45_07515 [Oceanibulbus indolifex
          HEL-45]
 gi|161382238|gb|EDQ06647.1| hypothetical protein OIHEL45_07515 [Oceanibulbus indolifex
          HEL-45]
          Length = 80

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T+   +N DDI +VGIF  Y++AYD WK ++ + VDNA MRY++
Sbjct: 1  MTQRLHLVFGGELIDPTKNAFKNVDDIHIVGIFPDYASAYDAWKSEAHRTVDNAHMRYYI 60

Query: 67 VDISRFPHYEL 77
            + R    E 
Sbjct: 61 AHLHRLRDEET 71


>gi|323137824|ref|ZP_08072899.1| hypothetical protein Met49242DRAFT_2287 [Methylocystis sp. ATCC
          49242]
 gi|322396827|gb|EFX99353.1| hypothetical protein Met49242DRAFT_2287 [Methylocystis sp. ATCC
          49242]
          Length = 84

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
              +++Q+L+LVFGGELE++     R+P  +D+VGI+    +A   WK K+   VDNA 
Sbjct: 6  TKAKKDKQLLHLVFGGELESLDGVTFRDPSKLDIVGIYPDNDSALAAWKAKAHSTVDNAH 65

Query: 62 MRYFVVDISRFPHYE 76
          MRYFVV + R    +
Sbjct: 66 MRYFVVHLYRLLDPD 80


>gi|319403678|emb|CBI77263.1| conserved hypothetical protein [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 81

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 52/77 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    ++ Q+L+LVFGGEL+++   + R+P ++DVVGIF  Y +A + W+ K+Q  VDNA
Sbjct: 1  MAEVNEKRQLLHLVFGGELKDLNDNQFRDPSNLDVVGIFPDYQSAQEAWRAKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
          L RY+VV + +F  Y  
Sbjct: 61 LQRYYVVPLHQFLDYST 77


>gi|154251085|ref|YP_001411909.1| hypothetical protein Plav_0629 [Parvibaculum lavamentivorans
          DS-1]
 gi|154155035|gb|ABS62252.1| conserved hypothetical protein [Parvibaculum lavamentivorans
          DS-1]
          Length = 79

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 48/72 (66%)

Query: 8  EQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          +Q+L+LVFGGEL ++   + ++   +D+VGIF SY+ A+  WK  +Q+ VDNA MRYF+V
Sbjct: 3  KQLLHLVFGGELTHLEAHEFKDTGALDIVGIFPSYAEAHRAWKAAAQRTVDNAHMRYFIV 62

Query: 68 DISRFPHYELGK 79
           + R    +  +
Sbjct: 63 HLHRLMDPDQEE 74


>gi|319898385|ref|YP_004158478.1| hypothetical protein BARCL_0207 [Bartonella clarridgeiae 73]
 gi|319402349|emb|CBI75888.1| conserved protein of unknown function [Bartonella clarridgeiae
          73]
          Length = 81

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 53/77 (68%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    ++ Q+L+LVFGGEL+N++  + ++  ++DVVGIF  Y +A + W+ K+Q  VDNA
Sbjct: 1  MAEVNEKRQLLHLVFGGELKNLSDNQFKDLSNLDVVGIFPDYQSAQEAWRTKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
          L RY+VV + +F  +E 
Sbjct: 61 LQRYYVVPLHQFLDHET 77


>gi|240849927|ref|YP_002971316.1| hypothetical protein Bgr_02800 [Bartonella grahamii as4aup]
 gi|240267050|gb|ACS50638.1| hypothetical protein Bgr_02800 [Bartonella grahamii as4aup]
          Length = 81

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/78 (52%), Positives = 57/78 (73%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    +++Q LYLVFGGEL+N+   + +NPDD+DVVGIFS Y +A + W+ K+Q  VDNA
Sbjct: 1  MTETNEKKQYLYLVFGGELKNLNSNQFKNPDDLDVVGIFSDYQSAQEAWQAKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYELG 78
          L RY++VD+ +F   ELG
Sbjct: 61 LQRYYIVDLHQFLDAELG 78


>gi|254451401|ref|ZP_05064838.1| inositol monophosphatase family protein [Octadecabacter
          antarcticus 238]
 gi|198265807|gb|EDY90077.1| inositol monophosphatase family protein [Octadecabacter
          antarcticus 238]
          Length = 80

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 46/72 (63%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T+   +N DDI VVG+F  Y +A++ WK ++Q+ VDNA MRYF+
Sbjct: 1  MSQRLHLVFGGELVDPTKNAFKNVDDIHVVGMFPDYDSAFNAWKSEAQKTVDNAHMRYFI 60

Query: 67 VDISRFPHYELG 78
            I R    E  
Sbjct: 61 AHIHRLRDEEAE 72


>gi|49473914|ref|YP_031956.1| hypothetical protein BQ02530 [Bartonella quintana str. Toulouse]
 gi|49239417|emb|CAF25756.1| hypothetical protein BQ02530 [Bartonella quintana str. Toulouse]
          Length = 81

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 53/78 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          MI   +++Q L+LVFGGEL+N+   + +N DD+DVVGIF  Y +A + W+ K+Q  VDNA
Sbjct: 1  MIEAKEKKQYLHLVFGGELKNLNSNQFKNIDDLDVVGIFPDYQSAQEAWQAKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYELG 78
          L RY++VD+ R    E  
Sbjct: 61 LQRYYIVDLHRLLDLEND 78


>gi|254439409|ref|ZP_05052903.1| hypothetical protein OA307_4279 [Octadecabacter antarcticus 307]
 gi|198254855|gb|EDY79169.1| hypothetical protein OA307_4279 [Octadecabacter antarcticus 307]
          Length = 80

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 47/72 (65%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + T+   +N DDI +VG+F +Y +A++ WK ++Q+ VDNA MRYF+
Sbjct: 1  MSQRLHLVFGGELIDPTKNAFKNVDDIHIVGMFPNYDSAFNAWKSEAQKTVDNAHMRYFI 60

Query: 67 VDISRFPHYELG 78
            I R    +  
Sbjct: 61 AHIHRLRDEKAE 72


>gi|163733091|ref|ZP_02140535.1| hypothetical protein RLO149_10535 [Roseobacter litoralis Och 149]
 gi|161393626|gb|EDQ17951.1| hypothetical protein RLO149_10535 [Roseobacter litoralis Och 149]
          Length = 80

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 48/69 (69%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGEL + ++   +N DDI +VGI+++Y+ A+D WK ++Q+ VDNA MRYF+  
Sbjct: 3  QRLHLVFGGELVDPSKNTFKNVDDIHIVGIYANYAGAFDAWKAEAQRTVDNAHMRYFIAH 62

Query: 69 ISRFPHYEL 77
          I R    E 
Sbjct: 63 IHRLRDEET 71


>gi|319406595|emb|CBI80237.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 81

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 52/77 (67%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    ++ Q+L+LVFGGEL+++   + R+P ++DVVGIF  Y +A + W+ K+Q  VDNA
Sbjct: 1  MAEVNEKRQLLHLVFGGELKDLNDNQFRDPSNLDVVGIFPDYQSAQEAWRAKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
          L RY+VV + +F  Y  
Sbjct: 61 LQRYYVVPLHQFFDYAT 77


>gi|146276116|ref|YP_001166275.1| hypothetical protein Rsph17025_0058 [Rhodobacter sphaeroides ATCC
          17025]
 gi|145554357|gb|ABP68970.1| hypothetical protein Rsph17025_0058 [Rhodobacter sphaeroides ATCC
          17025]
          Length = 81

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGEL + T+   ++   I +VG+F  Y++AY  WK ++Q+ VD+A +RYF+  
Sbjct: 3  QRLHLVFGGELVSPTKNAFKDVKAIHIVGMFPDYASAYTAWKAEAQRTVDDAHVRYFIAH 62

Query: 69 ISRFPHYELG 78
          + R    E  
Sbjct: 63 LHRLRDEEQP 72


>gi|167648491|ref|YP_001686154.1| hypothetical protein Caul_4536 [Caulobacter sp. K31]
 gi|167350921|gb|ABZ73656.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 74

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 48/74 (64%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          + ++Q+L+LV GGEL+N++  + R+   ++ VG ++SY++A+  WK K+Q  VDNA  RY
Sbjct: 1  MSDKQLLHLVIGGELKNVSDIEFRDLSKVEFVGAYASYADAHKAWKAKAQATVDNAHARY 60

Query: 65 FVVDISRFPHYELG 78
          F++   +     L 
Sbjct: 61 FIIHAHKLLDPSLD 74


>gi|299134212|ref|ZP_07027405.1| inositol monophosphatase family protein [Afipia sp. 1NLS2]
 gi|298590959|gb|EFI51161.1| inositol monophosphatase family protein [Afipia sp. 1NLS2]
          Length = 82

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 42/69 (60%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q+L+LV GGE+  +     ++   ++ VG+F +Y+ AY  WK K+QQ VDNA MRYF+
Sbjct: 6  PPQLLHLVIGGEVSALDDTTFKDLSKVETVGLFPNYATAYQAWKAKAQQSVDNAHMRYFI 65

Query: 67 VDISRFPHY 75
          V I R    
Sbjct: 66 VHIHRLLDP 74


>gi|83859490|ref|ZP_00953011.1| hypothetical protein OA2633_13835 [Oceanicaulis alexandrii
          HTCC2633]
 gi|83852937|gb|EAP90790.1| hypothetical protein OA2633_13835 [Oceanicaulis alexandrii
          HTCC2633]
          Length = 80

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 1  MINGIQEEQVLYLVFGGELEN--ITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVD 58
          M N     Q+L+LV GGEL +      + ++   +D VG + SY  A D WK  +Q+ VD
Sbjct: 1  MSNT-SSPQLLHLVIGGELSDIGPGAPEFKDLSQVDFVGAYPSYEEARDAWKSAAQRTVD 59

Query: 59 NALMRYFVVDISRFPHYE 76
          NA MRYFV+   +     
Sbjct: 60 NAHMRYFVIHAHKLLDPS 77


>gi|77461999|ref|YP_351503.1| hypothetical protein RSP_1460 [Rhodobacter sphaeroides 2.4.1]
 gi|126460889|ref|YP_001042003.1| hypothetical protein Rsph17029_0111 [Rhodobacter sphaeroides ATCC
          17029]
 gi|221640950|ref|YP_002527212.1| hypothetical protein RSKD131_2851 [Rhodobacter sphaeroides KD131]
 gi|332559926|ref|ZP_08414248.1| hypothetical protein RSWS8N_12725 [Rhodobacter sphaeroides WS8N]
 gi|77386417|gb|ABA77602.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|126102553|gb|ABN75231.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC
          17029]
 gi|221161731|gb|ACM02711.1| Hypothetical Protein RSKD131_2851 [Rhodobacter sphaeroides KD131]
 gi|332277638|gb|EGJ22953.1| hypothetical protein RSWS8N_12725 [Rhodobacter sphaeroides WS8N]
          Length = 81

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 44/70 (62%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGEL + T+   ++   I +VG+F  Y++A+  WK ++Q+ VD+A +RYF+  
Sbjct: 3  QRLHLVFGGELASPTKNVFKDVKAIHIVGMFPDYASAFAAWKAEAQRTVDDAHVRYFIAH 62

Query: 69 ISRFPHYELG 78
          + R    E  
Sbjct: 63 LHRLRDEEQP 72


>gi|87200243|ref|YP_497500.1| hypothetical protein Saro_2228 [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135924|gb|ABD26666.1| conserved hypothetical protein [Novosphingobium aromaticivorans
          DSM 12444]
          Length = 73

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 42/71 (59%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LV GG +++    +  +   IDVVG+F  Y+ A D W+  +Q+ VD+A MRY +V 
Sbjct: 2  QKLHLVMGGRVKDPQGLEFVDLKAIDVVGVFPDYAAAEDAWRSAAQKTVDDAEMRYVIVH 61

Query: 69 ISRFPHYELGK 79
          + R    +L K
Sbjct: 62 LHRLLEPDLPK 72


>gi|114769703|ref|ZP_01447313.1| hypothetical protein OM2255_09051 [alpha proteobacterium
          HTCC2255]
 gi|114549408|gb|EAU52290.1| hypothetical protein OM2255_09051 [alpha proteobacterium
          HTCC2255]
          Length = 80

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 47/70 (67%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L++VFGGEL+N T K+ RN D+ID+VGI+ +Y  AY  WK K+ Q VDNA +RYF+
Sbjct: 1  MTQRLHMVFGGELKNPTTKEFRNSDEIDIVGIYPNYQAAYSAWKAKAHQTVDNAHVRYFI 60

Query: 67 VDISRFPHYE 76
            + R    +
Sbjct: 61 AHLHRLRDED 70


>gi|319405149|emb|CBI78755.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 81

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 53/77 (68%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    ++ Q+L+LVFGGEL+N+   + ++ D++DVVGIF  Y +A +VW+ K+Q  VDNA
Sbjct: 1  MAEVNEKRQLLHLVFGGELKNLNDNQFKDLDNLDVVGIFPDYQSAQEVWRAKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYEL 77
          L RY+VV + RF  +  
Sbjct: 61 LQRYYVVPLHRFLDHAT 77


>gi|217976269|ref|YP_002360416.1| hypothetical protein Msil_0071 [Methylocella silvestris BL2]
 gi|217501645|gb|ACK49054.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 87

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 46/70 (65%)

Query: 6  QEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYF 65
           ++Q+L+ VFGGEL++    + +N D+I++VG+F  +++A   W+ K+Q  VDNA MRYF
Sbjct: 8  PKKQLLHFVFGGELKDFDSTEFKNLDEIEIVGLFPDHASAVAAWRAKAQASVDNAQMRYF 67

Query: 66 VVDISRFPHY 75
          V  + R    
Sbjct: 68 VAHLHRLIEP 77


>gi|302382969|ref|YP_003818792.1| inositol monophosphatase family protein [Brevundimonas
          subvibrioides ATCC 15264]
 gi|302193597|gb|ADL01169.1| inositol monophosphatase family protein [Brevundimonas
          subvibrioides ATCC 15264]
          Length = 84

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 40/69 (57%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
          + Q+L+LV GGEL ++     R+   ++ VG F +Y+ A   WK ++Q  VDNA MR+F+
Sbjct: 9  DPQLLHLVIGGELRHLDAPVFRDLSKVEFVGAFPNYAEAKAAWKARAQATVDNAHMRFFI 68

Query: 67 VDISRFPHY 75
          +   R    
Sbjct: 69 LHAHRMIDP 77


>gi|288957028|ref|YP_003447369.1| hypothetical protein AZL_001870 [Azospirillum sp. B510]
 gi|288909336|dbj|BAI70825.1| hypothetical protein AZL_001870 [Azospirillum sp. B510]
          Length = 78

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (59%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          + ++Q+L+LVFGGEL      +  +P  + +VGIF +Y  AY  W+  + Q +D+A  RY
Sbjct: 1  MPDKQLLHLVFGGELVRPDTDQFVDPSKLHIVGIFPNYDEAYKAWRGATGQTIDDAHTRY 60

Query: 65 FVVDISRFPHYE 76
          ++V + RF    
Sbjct: 61 YIVHLHRFLDPA 72


>gi|315500497|ref|YP_004089300.1| hypothetical protein Astex_3519 [Asticcacaulis excentricus CB 48]
 gi|315418509|gb|ADU15149.1| hypothetical protein Astex_3519 [Asticcacaulis excentricus CB 48]
          Length = 74

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 43/74 (58%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          + ++Q+L++V GGEL+       ++   ++ VG ++SY  A   W+ K+Q  VDNALMRY
Sbjct: 1  MSDKQLLHIVIGGELQAPGSTDFKDLKAVEFVGAYASYEEAKTAWRAKAQSTVDNALMRY 60

Query: 65 FVVDISRFPHYELG 78
          FV+   R  +    
Sbjct: 61 FVIHAHRLLNPAND 74


>gi|304320910|ref|YP_003854553.1| hypothetical protein PB2503_06727 [Parvularcula bermudensis
          HTCC2503]
 gi|303299812|gb|ADM09411.1| hypothetical protein PB2503_06727 [Parvularcula bermudensis
          HTCC2503]
          Length = 83

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
               + Q LYLVFGGEL +  + + R+   +DVVGIF  ++ A   W+ K+Q+ VD+A 
Sbjct: 3  SQAETDRQTLYLVFGGELVSTRKAEFRDLSALDVVGIFPDFAAAERAWRAKAQETVDSAA 62

Query: 62 MRYFVVDISRFPHYE 76
           RYF+V +  F   +
Sbjct: 63 TRYFIVHLHEFLDPD 77


>gi|197103983|ref|YP_002129360.1| hypothetical protein PHZ_c0517 [Phenylobacterium zucineum HLK1]
 gi|196477403|gb|ACG76931.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 77

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query: 5  IQEEQVLYLVFGGELENITQK-KMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMR 63
          + ++Q+L+LV GGELE++    + R+   +D+VG F SY  A   W+ K+Q+ VDNALMR
Sbjct: 1  MSDKQLLHLVIGGELESLEGPPQFRDLRKVDLVGAFPSYDEALRAWRAKAQETVDNALMR 60

Query: 64 YFVVDISRFPHY-ELGK 79
          YF++   +     E G+
Sbjct: 61 YFIIHAHKLLSPAEEGR 77


>gi|163867556|ref|YP_001608755.1| hypothetical protein Btr_0293 [Bartonella tribocorum CIP 105476]
 gi|161017202|emb|CAK00760.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 81

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 56/78 (71%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M    +++Q L+LVFGGEL+N+   + +NPDD+DVVGIFS+Y +A + W+ K+Q  VDNA
Sbjct: 1  MTETNEKKQYLHLVFGGELKNLKSNQFKNPDDLDVVGIFSNYQSAQEAWQAKAQSSVDNA 60

Query: 61 LMRYFVVDISRFPHYELG 78
          L RY++VD+ +F   E  
Sbjct: 61 LQRYYIVDLHQFLDAETD 78


>gi|254463271|ref|ZP_05076687.1| inositol monophosphatase family protein [Rhodobacterales
          bacterium HTCC2083]
 gi|206679860|gb|EDZ44347.1| inositol monophosphatase family protein [Rhodobacteraceae
          bacterium HTCC2083]
          Length = 80

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 46/72 (63%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
           E+ L+LVFGGEL + T+   ++ DD+ +VGIF  Y  AY+ WK ++Q+ VDNA MRY++
Sbjct: 1  MEKRLHLVFGGELVDPTKNVFKDVDDLHIVGIFPDYDAAYNAWKAEAQRTVDNAHMRYYI 60

Query: 67 VDISRFPHYELG 78
            + R  +    
Sbjct: 61 AHLHRLRNEGTE 72


>gi|260426188|ref|ZP_05780167.1| inositol monophosphatase family protein [Citreicella sp. SE45]
 gi|260420680|gb|EEX13931.1| inositol monophosphatase family protein [Citreicella sp. SE45]
          Length = 80

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 44/66 (66%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGEL    +   +N +D+ VVGIF  Y++A+D WK ++Q+ VDNA MRY++  
Sbjct: 3  QRLHLVFGGELVTPEKNVFKNVEDLHVVGIFPDYASAHDAWKAEAQRTVDNAHMRYYIAH 62

Query: 69 ISRFPH 74
          + R   
Sbjct: 63 LHRLRD 68


>gi|254420026|ref|ZP_05033750.1| hypothetical protein BBAL3_2336 [Brevundimonas sp. BAL3]
 gi|196186203|gb|EDX81179.1| hypothetical protein BBAL3_2336 [Brevundimonas sp. BAL3]
          Length = 81

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 39/73 (53%)

Query: 3  NGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALM 62
                Q+L+LV GGEL ++ +   R+   I+ VG F SY  A   WK ++Q  VDNA M
Sbjct: 4  QSSVPPQLLHLVIGGELRHLGEPTFRDLSQIEFVGAFGSYDEAKKAWKARAQATVDNAHM 63

Query: 63 RYFVVDISRFPHY 75
          RYF++   +    
Sbjct: 64 RYFILHAHKLIDP 76


>gi|329851182|ref|ZP_08265939.1| inositol monophosphatase family protein [Asticcacaulis
          biprosthecum C19]
 gi|328840028|gb|EGF89600.1| inositol monophosphatase family protein [Asticcacaulis
          biprosthecum C19]
          Length = 76

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 5  IQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
          +  +Q+L+LV GGEL ++T    ++   ++ VG ++S + A   W+ K+Q  VDNALMRY
Sbjct: 1  MATKQLLHLVIGGELTDLTGTTFKDLTKVEFVGAYASNAEAVKAWRTKAQATVDNALMRY 60

Query: 65 FVVDISRFPHYELGKE 80
          FV+   +        E
Sbjct: 61 FVIHAHKLIDPTTAGE 76


>gi|182677908|ref|YP_001832054.1| hypothetical protein Bind_0916 [Beijerinckia indica subsp. indica
          ATCC 9039]
 gi|182633791|gb|ACB94565.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
          ATCC 9039]
          Length = 82

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 46/70 (65%)

Query: 8  EQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          +Q L+LVFGGEL++++  + ++   ID+VG++  Y+ A  VW+ K+Q  VDNA MRYFV 
Sbjct: 7  KQHLHLVFGGELKDLSGHEFQDLSKIDIVGVYPDYATAESVWRSKAQATVDNAQMRYFVA 66

Query: 68 DISRFPHYEL 77
          D+S       
Sbjct: 67 DLSLLLDPAT 76


>gi|307295445|ref|ZP_07575281.1| hypothetical protein SphchDRAFT_2876 [Sphingobium
          chlorophenolicum L-1]
 gi|306878484|gb|EFN09704.1| hypothetical protein SphchDRAFT_2876 [Sphingobium
          chlorophenolicum L-1]
          Length = 73

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 41/69 (59%)

Query: 10 VLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDI 69
           L+LV GG +++    +  + + I++VG++  Y+ A + W+  +Q+ VD+A MRY +V +
Sbjct: 3  KLHLVMGGRVKDPQTLEFEDLNSIELVGVYPDYAAAENAWRGAAQRTVDDAEMRYVIVHL 62

Query: 70 SRFPHYELG 78
           R    +L 
Sbjct: 63 HRLLEPDLP 71


>gi|329890437|ref|ZP_08268780.1| inositol monophosphatase family protein [Brevundimonas diminuta
          ATCC 11568]
 gi|328845738|gb|EGF95302.1| inositol monophosphatase family protein [Brevundimonas diminuta
          ATCC 11568]
          Length = 83

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
          + Q+L+LV GGE+ +  +   R+   ++ VG F +Y  A   WK ++Q  VDNA MRYF+
Sbjct: 11 DPQLLHLVIGGEMRHPAEPVFRDLSQVEFVGAFGNYEEAKKAWKARAQATVDNAHMRYFI 70

Query: 67 VDISRFPHYELG 78
          +   +       
Sbjct: 71 LHAHKLIDPRTD 82


>gi|294011428|ref|YP_003544888.1| hypothetical protein SJA_C1-14420 [Sphingobium japonicum UT26S]
 gi|292674758|dbj|BAI96276.1| hypothetical protein SJA_C1-14420 [Sphingobium japonicum UT26S]
          Length = 73

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 40/69 (57%)

Query: 10 VLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDI 69
           L+LV GG ++N       + + I++VG++  Y+ A + W+  +Q+ VD+A MRY +V +
Sbjct: 3  KLHLVMGGRVKNPQTLDFEDLNSIELVGVYPDYAAAENAWRGAAQRTVDDAEMRYVIVHL 62

Query: 70 SRFPHYELG 78
           R    +L 
Sbjct: 63 HRLLEPDLP 71


>gi|94498552|ref|ZP_01305107.1| hypothetical protein SKA58_08264 [Sphingomonas sp. SKA58]
 gi|94421995|gb|EAT07041.1| hypothetical protein SKA58_08264 [Sphingomonas sp. SKA58]
          Length = 73

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 42/69 (60%)

Query: 10 VLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDI 69
           ++LV GG +++    + ++ + +D+VG++  Y++A   W+  +Q+ VD+A MRY +V +
Sbjct: 3  KMHLVMGGRVKDPQTLEFQDLNQVDLVGVYPDYASAEKAWRGAAQRTVDDAEMRYVIVHL 62

Query: 70 SRFPHYELG 78
           R    EL 
Sbjct: 63 HRLLEPELP 71


>gi|260574058|ref|ZP_05842063.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259023524|gb|EEW26815.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 81

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 45/71 (63%)

Query: 7  EEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
            Q L+LVFGGEL + ++   ++ + ID+VG++ +Y+ A++ WK+ +Q  VD+A MRYF+
Sbjct: 1  MSQRLHLVFGGELVDPSKNVFKDVNAIDIVGMYPNYALAFNAWKKAAQHSVDDAHMRYFI 60

Query: 67 VDISRFPHYEL 77
            I R      
Sbjct: 61 AHIHRLRDEAE 71


>gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040080|gb|ACT56876.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 80

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 80/80 (100%), Positives = 80/80 (100%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA
Sbjct: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60

Query: 61 LMRYFVVDISRFPHYELGKE 80
          LMRYFVVDISRFPHYELGKE
Sbjct: 61 LMRYFVVDISRFPHYELGKE 80


>gi|296284020|ref|ZP_06862018.1| hypothetical protein CbatJ_10366 [Citromicrobium bathyomarinum
          JL354]
          Length = 84

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 44/75 (58%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
          +      Q+L+LV GG +++    + ++P+ I VVG+FS+Y  A + W+  +Q+ VD+A 
Sbjct: 9  VQETTSPQLLHLVMGGRVKDPRSVEFQDPESIHVVGVFSTYEQAEEAWRANAQRTVDDAE 68

Query: 62 MRYFVVDISRFPHYE 76
          M+Y +V I +     
Sbjct: 69 MKYVIVHIHKLLEPA 83


>gi|121602438|ref|YP_989459.1| hypothetical protein BARBAKC583_1206 [Bartonella bacilliformis
          KC583]
 gi|120614615|gb|ABM45216.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 77

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 36/77 (46%), Positives = 53/77 (68%), Gaps = 1/77 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M     ++Q+LY VFGG+L+N+   +  NPDD+D+VGIF  Y +A D W+ K+Q  VDNA
Sbjct: 1  MTEDN-KKQLLYFVFGGKLKNLNSNEFTNPDDLDIVGIFMDYQSAQDAWRAKAQSTVDNA 59

Query: 61 LMRYFVVDISRFPHYEL 77
          L RY++VD+ +  H E+
Sbjct: 60 LQRYYIVDLHQSLHSEI 76


>gi|85373969|ref|YP_458031.1| hypothetical protein ELI_05710 [Erythrobacter litoralis HTCC2594]
 gi|84787052|gb|ABC63234.1| hypothetical protein ELI_05710 [Erythrobacter litoralis HTCC2594]
          Length = 89

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M      +Q L+LV GG + +    + ++P+ + VVG++S+Y  A + W+ ++Q+ VD+A
Sbjct: 14 MEETTP-KQKLHLVMGGRVTDPRTMEFQDPESVHVVGVYSNYDAAEEAWRGQAQRTVDDA 72

Query: 61 LMRYFVVDISRFPHYEL 77
           M+Y +V + +    + 
Sbjct: 73 EMKYVIVHLHKLLTPDE 89


>gi|315122185|ref|YP_004062674.1| hypothetical protein CKC_02175 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495587|gb|ADR52186.1| hypothetical protein CKC_02175 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 82

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 69/80 (86%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          +   I +EQ LYLVFGGELE IT+KK+RN DDIDVVGIFSSYS+AYD WKEKSQQ VDNA
Sbjct: 3  VTKDIDKEQALYLVFGGELEEITKKKIRNLDDIDVVGIFSSYSSAYDAWKEKSQQTVDNA 62

Query: 61 LMRYFVVDISRFPHYELGKE 80
          LMRYFVVDISRFP+ +L K+
Sbjct: 63 LMRYFVVDISRFPYCDLEKK 82


>gi|148553365|ref|YP_001260947.1| hypothetical protein Swit_0441 [Sphingomonas wittichii RW1]
 gi|148498555|gb|ABQ66809.1| hypothetical protein Swit_0441 [Sphingomonas wittichii RW1]
          Length = 71

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (56%)

Query: 10 VLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDI 69
           ++LVFGG +++       +   IDVVG +  Y +A   W+  +Q+ VD+A MRY VV +
Sbjct: 3  KIHLVFGGRVKDPQGLDFEDLSQIDVVGFYQDYKSAEKAWRGAAQRTVDDAEMRYVVVHL 62

Query: 70 SRFPHYELG 78
           +    ELG
Sbjct: 63 HKLLEPELG 71


>gi|326387385|ref|ZP_08208994.1| hypothetical protein Y88_0910 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208041|gb|EGD58849.1| hypothetical protein Y88_0910 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 66

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 38/66 (57%)

Query: 15 FGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPH 74
           GG +++       +   IDVVG+F  Y++A + W+  +Q+ VD+A MRY +V + R   
Sbjct: 1  MGGRVKDPQGLDFVDLKAIDVVGVFPDYASAEEAWRGAAQRTVDDAEMRYVIVHLHRLLE 60

Query: 75 YELGKE 80
           EL KE
Sbjct: 61 PELPKE 66


>gi|149184454|ref|ZP_01862772.1| hypothetical protein ED21_27088 [Erythrobacter sp. SD-21]
 gi|148831774|gb|EDL50207.1| hypothetical protein ED21_27088 [Erythrobacter sp. SD-21]
          Length = 76

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 42/75 (56%)

Query: 2  INGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNAL 61
          +   + +Q LYLV GG + +       +P+ I V G++SSY +A   W+  +Q+ VD+A 
Sbjct: 1  MEEKESKQTLYLVMGGRVTDPRSVTFSDPESIHVAGVYSSYDDAESAWRGNAQRTVDDAE 60

Query: 62 MRYFVVDISRFPHYE 76
          M+Y +V + +    +
Sbjct: 61 MKYVIVHLHKLLDPD 75


>gi|332185699|ref|ZP_08387446.1| hypothetical protein SUS17_964 [Sphingomonas sp. S17]
 gi|332014057|gb|EGI56115.1| hypothetical protein SUS17_964 [Sphingomonas sp. S17]
          Length = 71

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 39/69 (56%)

Query: 10 VLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDI 69
           L+LVFGG + +       +P  ++VVG+F  Y++A   W+  +Q+ VD+A M++ VV +
Sbjct: 3  KLHLVFGGRVSDPQTLDFVDPAALEVVGVFPDYASAEKAWRAAAQRTVDDAEMKFVVVHL 62

Query: 70 SRFPHYELG 78
           R     L 
Sbjct: 63 HRLLEPTLD 71


>gi|103486011|ref|YP_615572.1| hypothetical protein Sala_0518 [Sphingopyxis alaskensis RB2256]
 gi|98976088|gb|ABF52239.1| conserved hypothetical protein [Sphingopyxis alaskensis RB2256]
          Length = 71

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%)

Query: 10 VLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDI 69
           L+LVFGG + +       +  ++DVVG++  Y +A   W+  +Q+ VD+A M+Y VV +
Sbjct: 3  KLHLVFGGRVSDPQGLDFVDLANLDVVGLYPDYKSAEKAWRSAAQRTVDDAEMKYVVVHL 62

Query: 70 SRFPHYELG 78
           +    E  
Sbjct: 63 HKLLQPEAE 71


>gi|114766567|ref|ZP_01445523.1| hypothetical protein 1100011001317_R2601_08651 [Pelagibaca
          bermudensis HTCC2601]
 gi|114541183|gb|EAU44235.1| hypothetical protein R2601_08651 [Roseovarius sp. HTCC2601]
          Length = 73

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 25/60 (41%), Positives = 39/60 (65%)

Query: 15 FGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPH 74
          FGGEL    +   +N D++ +VGIF  Y++A+D WK ++Q+ VDNA MRY++  + R   
Sbjct: 2  FGGELVTPEKNVFKNVDELHIVGIFPDYASAHDAWKAEAQRTVDNAHMRYYIAHLHRLRD 61


>gi|85708558|ref|ZP_01039624.1| hypothetical protein NAP1_04945 [Erythrobacter sp. NAP1]
 gi|85690092|gb|EAQ30095.1| hypothetical protein NAP1_04945 [Erythrobacter sp. NAP1]
          Length = 76

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M       Q L+LV GG + +    +  +P+ + VVG++SSY  A D W+ ++Q+ VD+A
Sbjct: 1  MEETTPG-QKLHLVMGGRVTDPRGHEFADPESVHVVGVYSSYDAAVDAWRAQAQRTVDDA 59

Query: 61 LMRYFVVDISRFPHYE 76
           M+Y VV I +    +
Sbjct: 60 EMKYVVVHIHKLLTPD 75


>gi|146342917|ref|YP_001207965.1| hypothetical protein BRADO6098 [Bradyrhizobium sp. ORS278]
 gi|146195723|emb|CAL79750.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 79

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+L+LV GGEL N+ + + ++ D +D+VG++ +Y+ A+  W+ K+Q  VDNA
Sbjct: 1  MTDS-ASQQLLHLVIGGELVNLDKNEFKDLDKVDIVGVYPNYAAAHAAWRAKAQMTVDNA 59

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R        +
Sbjct: 60 HMRYFIVHLHRLLDPGQDAK 79


>gi|148253219|ref|YP_001237804.1| hypothetical protein BBta_1689 [Bradyrhizobium sp. BTAi1]
 gi|146405392|gb|ABQ33898.1| hypothetical protein BBta_1689 [Bradyrhizobium sp. BTAi1]
          Length = 79

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 1  MINGIQEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
          M +    +Q+L+LV GGEL N+ + + ++ D +D+VG++ +Y+ A+  W+ K+Q  VDNA
Sbjct: 1  MTDS-ASQQLLHLVIGGELINLDKNEFKDLDKVDIVGVYPNYAAAHAAWRAKAQMTVDNA 59

Query: 61 LMRYFVVDISRFPHYELGKE 80
           MRYF+V + R        +
Sbjct: 60 HMRYFIVHLHRLLDPGQDAK 79


>gi|115522904|ref|YP_779815.1| hypothetical protein RPE_0879 [Rhodopseudomonas palustris BisA53]
 gi|115516851|gb|ABJ04835.1| conserved hypothetical protein [Rhodopseudomonas palustris
          BisA53]
          Length = 80

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 46/70 (65%)

Query: 6  QEEQVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYF 65
          + EQ+L+LV GGEL N+     ++ D +++VG+F +Y+ A   W+ K+QQ VDNA MRYF
Sbjct: 3  ENEQLLHLVLGGELTNLDGTTFKDLDQVEIVGLFPNYAAATAAWRAKAQQTVDNAHMRYF 62

Query: 66 VVDISRFPHY 75
          VV + R    
Sbjct: 63 VVHLHRMLDP 72


>gi|256111880|ref|ZP_05452841.1| hypothetical protein Bmelb3E_04370 [Brucella melitensis bv. 3
          str. Ether]
          Length = 58

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 26 KMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHY 75
          + R+  ++D+VGI+  Y +A   WK K+QQ VDNA MRYF+V + R    
Sbjct: 1  EFRDLQNLDIVGIYPDYESAKTAWKSKAQQTVDNAHMRYFIVHLHRLLDP 50


>gi|265993333|ref|ZP_06105890.1| LOW QUALITY PROTEIN: inositol monophosphatase [Brucella
          melitensis bv. 3 str. Ether]
 gi|262764203|gb|EEZ10235.1| LOW QUALITY PROTEIN: inositol monophosphatase [Brucella
          melitensis bv. 3 str. Ether]
          Length = 57

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 31/49 (63%)

Query: 27 MRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHY 75
           R+  ++D+VGI+  Y +A   WK K+QQ VDNA MRYF+V + R    
Sbjct: 1  FRDLQNLDIVGIYPDYESAKTAWKSKAQQTVDNAHMRYFIVHLHRLLDP 49


>gi|296444346|ref|ZP_06886311.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296257993|gb|EFH05055.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 85

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 41/71 (57%)

Query: 9  QVLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Q L+LVFGGEL ++     R+P  +D+VGIFS    A   WK K+   VDNA MRYFVV 
Sbjct: 14 QPLHLVFGGELADLQGVAFRDPAKLDIVGIFSDIDAAVAAWKAKAHASVDNAHMRYFVVH 73

Query: 69 ISRFPHYELGK 79
          +      E  +
Sbjct: 74 LDGLLDPEAKR 84


>gi|163797994|ref|ZP_02191935.1| hypothetical protein BAL199_07023 [alpha proteobacterium BAL199]
 gi|159176715|gb|EDP61287.1| hypothetical protein BAL199_07023 [alpha proteobacterium BAL199]
          Length = 124

 Score = 86.0 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVD 68
          Y V GG+  + +   +   D  + VG F  Y  A  +W + + Q VD+A +RY ++ 
Sbjct: 3  YWVIGGKYTDTSFTLIEGGDAEEKVGPFRDYETAKSIWGKLAWQHVDDAHVRYRILH 59



 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 28/55 (50%)

Query: 12  YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
           + + GG  ++    +  +      +G F++Y  A  +W++K+   VD+A  R+ +
Sbjct: 65  FWLVGGVYKSTDFTETVDGSPETKIGPFATYEEAKKLWQQKAWATVDDAHSRWRI 119


>gi|83311579|ref|YP_421843.1| hypothetical protein amb2480 [Magnetospirillum magneticum AMB-1]
 gi|82946420|dbj|BAE51284.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 135

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
          Y V GGE  + +   +      +  G F  +  A+  W+  + + VDNA++RYF+
Sbjct: 5  YYVVGGEYADTSFTVIAPGHTEERFGPFEEH-EAHICWRALTGKSVDNAMVRYFI 58



 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 13  LVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
            V GGE  + T +++     ++V G + S   A D W+E + + VD+ L RY
Sbjct: 70  YVMGGEYADTTFQEVTEGRTLEVHGPY-SRKEALDKWRELTGKSVDSCLTRY 120


>gi|83593091|ref|YP_426843.1| hypothetical protein Rru_A1756 [Rhodospirillum rubrum ATCC 11170]
 gi|83576005|gb|ABC22556.1| hypothetical protein Rru_A1756 [Rhodospirillum rubrum ATCC 11170]
          Length = 139

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
          Y V GGE  + +   +      +  G F+  S A++ W+  + + VDNA++RYFV
Sbjct: 6  YWVVGGEYADTSFSALVEGTPEERFGPFTE-SGAHECWRALTGKTVDNAMVRYFV 59



 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 2/67 (2%)

Query: 2   INGIQEEQ-VLYLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNA 60
           +    + Q   + V GGE      K M     ++  G F     A   W+  + Q VD+A
Sbjct: 59  VRNEDDRQGKAFFVVGGEYAGTDFKTMAEGHSVERYGPFEK-QEAMIFWRGITSQTVDSA 117

Query: 61  LMRYFVV 67
           L RY +V
Sbjct: 118 LHRYDIV 124


>gi|46202423|ref|ZP_00053242.2| hypothetical protein Magn03007787 [Magnetospirillum
          magnetotacticum MS-1]
          Length = 77

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
          Y V GGE  + +   +      +  G F  +  A+  W+  + + VDNA++RYF+
Sbjct: 5  YYVVGGEYADTSFTVIAPGHTEERFGPFEEH-EAHICWRALTGKSVDNAMIRYFI 58


>gi|144897801|emb|CAM74665.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 134

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFV 66
          + V GGE  +     +      +  G F  +  A+  W+  + + VDNA++RYF+
Sbjct: 5  FYVVGGEYADTAFTTIAPGHKEERFGPFGEH-EAHVCWRALTGKTVDNAMIRYFI 58



 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 13  LVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
            V GGE  +     +     ++V G F     A + W+E + + VDNA++RY
Sbjct: 70  YVVGGEYADTDFDVIAAGKTLEVHGPFE-RQLAMNTWRELTGKTVDNAMVRY 120


>gi|197106672|ref|YP_002132049.1| hypothetical protein PHZ_c3211 [Phenylobacterium zucineum HLK1]
 gi|196480092|gb|ACG79620.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 68

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 26/62 (41%), Gaps = 1/62 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISR 71
          + V GGE   +  K +++    +V+G + +   A   W+ KS +    A  RY +     
Sbjct: 6  FWVVGGEYSCLAFKSLKSG-APEVLGPYDTREEARAAWRRKSDETRACATARYAIATEHL 64

Query: 72 FP 73
            
Sbjct: 65 VL 66


>gi|163795461|ref|ZP_02189428.1| hypothetical protein BAL199_15122 [alpha proteobacterium BAL199]
 gi|159179447|gb|EDP63978.1| hypothetical protein BAL199_15122 [alpha proteobacterium BAL199]
          Length = 66

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 23/56 (41%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          Y V GGE E     ++ +     ++G +    +A   W+  + +       R+ +V
Sbjct: 5  YWVIGGEYETTAFDRLLDGTK-QILGPYRDVDDAKKAWESVAVETRSICNARFTIV 59


>gi|85715310|ref|ZP_01046293.1| hypothetical protein NB311A_05418 [Nitrobacter sp. Nb-311A]
 gi|85697956|gb|EAQ35830.1| hypothetical protein NB311A_05418 [Nitrobacter sp. Nb-311A]
          Length = 78

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A D W+  S++    A +R+ +V
Sbjct: 16 FWVIGGEFGSMNFHKLVEGSA-QVQGPFKTRQEAEDAWRVVSEKNRHRAGVRFSIV 70


>gi|92116677|ref|YP_576406.1| hypothetical protein Nham_1098 [Nitrobacter hamburgensis X14]
 gi|91799571|gb|ABE61946.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 68

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A D W+  S++    A +R+ +V
Sbjct: 6  FWVIGGEFGSMNFHKLVEGSA-QVQGPFKTRKEAEDAWRVVSEENRHRAGVRFSIV 60


>gi|86751305|ref|YP_487801.1| hypothetical protein RPB_4198 [Rhodopseudomonas palustris HaA2]
 gi|86574333|gb|ABD08890.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 69

 Score = 64.8 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A + WK  S++    A +R+ +V
Sbjct: 7  FWVIGGEFGSMNFHKLVEGSA-QVQGPFKTRKEAEEAWKVVSEENRHRAGVRFSIV 61


>gi|91978513|ref|YP_571172.1| hypothetical protein RPD_4052 [Rhodopseudomonas palustris BisB5]
 gi|91684969|gb|ABE41271.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 69

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A + WK  S++    A +R+ +V
Sbjct: 7  FWVIGGEFGSMNFHKLVEGSA-QVQGPFKTRKEAEEAWKIVSEENRHRAGVRFSIV 61


>gi|39937453|ref|NP_949729.1| hypothetical protein RPA4393 [Rhodopseudomonas palustris CGA009]
 gi|192293236|ref|YP_001993841.1| hypothetical protein Rpal_4877 [Rhodopseudomonas palustris TIE-1]
 gi|39651312|emb|CAE29834.1| unknown protein [Rhodopseudomonas palustris CGA009]
 gi|192286985|gb|ACF03366.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 71

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A + WK  S++    A +R+ +V
Sbjct: 7  FWVIGGEFGSMNFHKLVEGSA-QVKGPFKTRKEAEEAWKVLSEENRHRAGVRFSIV 61


>gi|90422891|ref|YP_531261.1| hypothetical protein RPC_1380 [Rhodopseudomonas palustris BisB18]
 gi|90104905|gb|ABD86942.1| conserved hypothetical protein [Rhodopseudomonas palustris
          BisB18]
          Length = 69

 Score = 63.7 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A D W+E S++    A +R+ +V
Sbjct: 6  FWVIGGEFGSMNFHKLVEGSA-QVKGPFKTRKEAEDAWREVSEENRHKAGVRFSIV 60


>gi|316935909|ref|YP_004110891.1| hypothetical protein Rpdx1_4609 [Rhodopseudomonas palustris DX-1]
 gi|315603623|gb|ADU46158.1| hypothetical protein Rpdx1_4609 [Rhodopseudomonas palustris DX-1]
          Length = 71

 Score = 63.7 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A + WK  S++    A +R+ +V
Sbjct: 7  FWVIGGEFGSMNFHKLVEGSA-QVKGPFKTRKEAEEAWKVLSEENRHRAGVRFSIV 61


>gi|75677165|ref|YP_319586.1| hypothetical protein Nwi_2984 [Nitrobacter winogradskyi Nb-255]
 gi|74422035|gb|ABA06234.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 68

 Score = 63.7 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A D WK  S++    A +R+ +V
Sbjct: 6  FWVIGGEFGSMNFHKLVEGSA-QVQGPFKTRQEAEDAWKVVSEENRYRAGVRFSIV 60


>gi|115523417|ref|YP_780328.1| hypothetical protein RPE_1396 [Rhodopseudomonas palustris BisA53]
 gi|115517364|gb|ABJ05348.1| conserved hypothetical protein [Rhodopseudomonas palustris
          BisA53]
          Length = 71

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A + WK  S++    A +R+ +V
Sbjct: 7  FWVIGGEFGSMNFHKLVEGSA-QVKGPFKTRKEAEEAWKIVSEENRHRAGVRFSIV 61


>gi|148253754|ref|YP_001238339.1| hypothetical protein BBta_2255 [Bradyrhizobium sp. BTAi1]
 gi|146405927|gb|ABQ34433.1| hypothetical protein BBta_2255 [Bradyrhizobium sp. BTAi1]
          Length = 68

 Score = 62.9 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F S   A D W+E S++    A +R+ +V
Sbjct: 5  FWVIGGEFGSMNFHKLVEGSA-QVKGPFKSRKEAEDCWREVSEENRHKAGVRFSIV 59


>gi|299134626|ref|ZP_07027818.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298590436|gb|EFI50639.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 68

 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+       V G F +   A D W+  S++      +R+ +V
Sbjct: 6  FWVIGGEFGSMNFHKLVQGSA-QVQGPFKTRKEAEDAWRVVSEENRHRGSVRFSIV 60


>gi|209886137|ref|YP_002289994.1| hypothetical protein OCAR_7021 [Oligotropha carboxidovorans OM5]
 gi|209874333|gb|ACI94129.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 68

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          + V GGE  ++   K+ +     V G F +   A D W+  S++      +R+ VV
Sbjct: 6  FWVIGGEFGSMNFHKLVHGSA-QVQGPFKTRKEAEDAWRVVSEENRHRGSVRFSVV 60


>gi|146339003|ref|YP_001204051.1| hypothetical protein BRADO1952 [Bradyrhizobium sp. ORS278]
 gi|146191809|emb|CAL75814.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 62

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 15 FGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
           GGE  ++   K+       V G F S   A D W+E S++    A +R+ +V
Sbjct: 2  IGGEFGSMNFHKLVEGSA-QVKGPFKSRKEAEDCWREVSEENRHKAGVRFSIV 53


>gi|23013333|ref|ZP_00053241.1| hypothetical protein Magn03007786 [Magnetospirillum
          magnetotacticum MS-1]
          Length = 50

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 30 PDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRY 64
             ++V G + S   A D W+E + + VD+ L RY
Sbjct: 2  GRQLEVHGPY-SRKEALDKWRELTGKSVDSCLTRY 35


>gi|262277983|ref|ZP_06055776.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262225086|gb|EEY75545.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 61

 Score = 42.5 bits (99), Expect = 0.022,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 26/56 (46%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVV 67
          +LV  GE ++    +  +       G F + + A D+ K   Q+ +DN   R +V+
Sbjct: 3  FLVIDGEHKDPNDIQTLDQSTKKEYGPFDTEAEADDICKGLIQRNIDNYYHRAWVI 58


>gi|167769291|ref|ZP_02441344.1| hypothetical protein ANACOL_00614 [Anaerotruncus colihominis DSM
           17241]
 gi|167668259|gb|EDS12389.1| hypothetical protein ANACOL_00614 [Anaerotruncus colihominis DSM
           17241]
          Length = 243

 Score = 37.1 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 25  KKMRNPDDIDVVGIFSSYSNAYD-VWKEKSQQMVDNALMRYFVVD 68
                 + I+ +G +    +A +  W++K+    D+A  RYF VD
Sbjct: 69  TNFVLANTIERLGPYKEQLSAENQEWQKKAYVPPDDAHNRYFEVD 113


>gi|32266375|ref|NP_860407.1| flagellar hook-associated protein FlgK [Helicobacter hepaticus ATCC
           51449]
 gi|32262425|gb|AAP77473.1| flagellar hook-associated protein FlgK [Helicobacter hepaticus ATCC
           51449]
          Length = 606

 Score = 36.7 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 28/74 (37%), Gaps = 14/74 (18%)

Query: 4   GIQEEQVLY--LVFG--------GELENITQKKMRNPDD----IDVVGIFSSYSNAYDVW 49
            I+  Q ++   VF          +  +     +R        +D VGI++     ++ W
Sbjct: 62  SIETIQRIHDEFVFNRYRKAAEEAQYYDTHFTTLREASAFFPEVDGVGIYNDLEEYFNAW 121

Query: 50  KEKSQQMVDNALMR 63
           K+ ++   D A  +
Sbjct: 122 KDLAKNSTDPAQKQ 135


>gi|330813251|ref|YP_004357490.1| hypothetical protein SAR11G3_00276 [Candidatus Pelagibacter sp.
          IMCC9063]
 gi|327486346|gb|AEA80751.1| hypothetical protein SAR11G3_00276 [Candidatus Pelagibacter sp.
          IMCC9063]
          Length = 61

 Score = 36.7 bits (84), Expect = 1.2,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 23/52 (44%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMR 63
          ++V  G+ ++       +    ++ G F +   A ++ K   Q+ +DN   R
Sbjct: 4  FIVIEGDHKDPNDFATLDKGTENIYGPFENKEEADNMAKHLIQKNIDNFYHR 55


>gi|13474183|ref|NP_105751.1| hypothetical protein mlr5013 [Mesorhizobium loti MAFF303099]
 gi|14024935|dbj|BAB51537.1| mlr5013 [Mesorhizobium loti MAFF303099]
          Length = 101

 Score = 36.3 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 4/45 (8%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQM 56
          YLV GGE+ N             VV  F SY  A   ++ +  Q 
Sbjct: 42 YLVRGGEVTNPEGSDF----GRHVVVEFDSYETALSCYRSQGYQT 82


>gi|71083944|ref|YP_266664.1| hypothetical protein SAR11_1256 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|71063057|gb|AAZ22060.1| unknown [Candidatus Pelagibacter ubique HTCC1062]
          Length = 65

 Score = 34.4 bits (78), Expect = 5.9,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 24/61 (39%), Gaps = 1/61 (1%)

Query: 12 YLVFGGELENITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISR 71
          + V  G  ++  + +    D     G F     A ++ K   Q+ +D+   R ++V  + 
Sbjct: 4  FYVVAGIHKDPNKIETIIKDTEKKFGPFEEI-EANNLAKSLIQKNIDDFYHRAWIVKSNN 62

Query: 72 F 72
           
Sbjct: 63 L 63


>gi|159468143|ref|XP_001692242.1| hypothetical protein CHLREDRAFT_189491 [Chlamydomonas reinhardtii]
 gi|158278428|gb|EDP04192.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 167

 Score = 34.0 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 44  NAYDVWKEKSQQMVDNALMRYFVVDISR 71
           +A+  WK  +   + +AL+RY V    R
Sbjct: 95  SAFKAWKAGTDDTLRDALLRYNVAANHR 122


>gi|260172124|ref|ZP_05758536.1| hypothetical protein BacD2_09698 [Bacteroides sp. D2]
 gi|315920434|ref|ZP_07916674.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313694309|gb|EFS31144.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 550

 Score = 34.0 bits (77), Expect = 7.5,   Method: Composition-based stats.
 Identities = 13/63 (20%), Positives = 21/63 (33%), Gaps = 8/63 (12%)

Query: 13  LVFGGELENITQKKMRNPDDIDVVGIFSSYSNAY----DVWKEKSQQMVD----NALMRY 64
           +V GG +  + +         D  G  ++Y  AY    D W             N  + Y
Sbjct: 44  IVVGGYITAMQKSVFPTGTQADDTGPVNAYQTAYNLSADAWSGYIGINNTFEGGNCHLNY 103

Query: 65  FVV 67
            +V
Sbjct: 104 VIV 106


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.308    0.161    0.537 

Lambda     K      H
   0.267   0.0497    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,092,358,687
Number of Sequences: 14124377
Number of extensions: 48469720
Number of successful extensions: 99995
Number of sequences better than 10.0: 153
Number of HSP's better than 10.0 without gapping: 148
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 99816
Number of HSP's gapped (non-prelim): 157
length of query: 80
length of database: 4,842,793,630
effective HSP length: 51
effective length of query: 29
effective length of database: 4,122,450,403
effective search space: 119551061687
effective search space used: 119551061687
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.8 bits)
S2: 76 (33.6 bits)