RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) >gnl|CDD|36342 KOG1127, KOG1127, KOG1127, TPR repeat-containing protein [RNA processing and modification]. Length = 1238 Score = 25.0 bits (54), Expect = 4.1 Identities = 6/37 (16%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Query: 39 FSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFPHY 75 + D+W +K + + L + + ++ HY Sbjct: 181 LYNQPTNSDLW-DKIRSEAEGLLYQRLGMFLAAKKHY 216 >gnl|CDD|114493 pfam05770, Ins134_P3_kin, Inositol 1, 3, 4-trisphosphate 5/6-kinase. This family consists of several inositol 1, 3, 4-trisphosphate 5/6-kinase proteins. Inositol 1,3,4-trisphosphate is at a branch point in inositol phosphate metabolism. It is dephosphorylated by specific phosphatases to either inositol 3,4-bisphosphate or inositol 1,3-bisphosphate. Alternatively, it is phosphorylated to inositol 1,3,4,6-tetrakisphosphate or inositol 1,3,4,5-tetrakisphosphate by inositol trisphosphate 5/6-kinase. Length = 307 Score = 25.1 bits (55), Expect = 4.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 63 RYFVVDISRFPHYE 76 RY V+DI+ FP Y Sbjct: 279 RYLVIDINYFPGYA 292 >gnl|CDD|32849 COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 298 Score = 24.6 bits (53), Expect = 6.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 24 QKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMV 57 +K NPD + I Y NAYD ++ + Sbjct: 108 TRKQLNPDSYYYLSINIGYPNAYDKALGRTGGGI 141 >gnl|CDD|107262 cd06267, PBP1_LacI_sugar_binding_like, Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily. Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily. In most cases, ligands are monosaccharide including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. The LacI family of proteins consists of transcriptional regulators related to the lac repressor. In this case, the domain sugar binding changes the DNA binding activity of the repressor domain. Length = 264 Score = 24.5 bits (54), Expect = 6.9 Identities = 13/61 (21%), Positives = 23/61 (37%), Gaps = 20/61 (32%) Query: 22 ITQKKMRNPDDIDVVGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDIS--RFPHYELGK 79 + + +R P+D+ VVG +D D L ++ R P E+G+ Sbjct: 196 LRELGLRVPEDVSVVG--------FD----------DIPLAELLTPPLTTVRQPIEEMGR 237 Query: 80 E 80 Sbjct: 238 A 238 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.138 0.397 Gapped Lambda K H 0.267 0.0654 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,020,318 Number of extensions: 43813 Number of successful extensions: 139 Number of sequences better than 10.0: 1 Number of HSP's gapped: 139 Number of HSP's successfully gapped: 6 Length of query: 80 Length of database: 6,263,737 Length adjustment: 50 Effective length of query: 30 Effective length of database: 5,183,287 Effective search space: 155498610 Effective search space used: 155498610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)