RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 39.5 bits (92), Expect = 2e-04 Identities = 19/109 (17%), Positives = 30/109 (27%), Gaps = 48/109 (44%) Query: 6 QEEQV-LYLVFGG---------ELENI--TQKKM----------------RNPDDIDVVG 37 E L +FGG EL ++ T + R D + Sbjct: 150 GEGNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAE--- 206 Query: 38 IFSSYSNAYDV--WKEKSQQMVDNALMRYFV-VDISRFP--------HY 75 ++ ++ W E D Y + + IS P HY Sbjct: 207 --KVFTQGLNILEWLENPSNTPDKD---YLLSIPIS-CPLIGVIQLAHY 249 Score = 24.9 bits (54), Expect = 4.2 Identities = 14/74 (18%), Positives = 24/74 (32%), Gaps = 21/74 (28%) Query: 6 QEEQVLYLVFGGELENITQKKMRNPDDI-DVVG---------------IFSSYSNAYDVW 49 Q +QVL L L + +DI + + +Y A + Sbjct: 79 QFDQVLNLC----LTEFENCYLEG-NDIHALAAKLLQENDTTLVKTKELIKNYITARIMA 133 Query: 50 KEKSQQMVDNALMR 63 K + ++AL R Sbjct: 134 KRPFDKKSNSALFR 147 >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Length = 276 Score = 26.2 bits (57), Expect = 1.7 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Query: 37 GIFSSYSNAYDVWKEKSQQMVDNALMRY---FVVDISR 71 GI SS ++WK K Q+ M Y FVV++ R Sbjct: 9 GICSSAPTLGEIWKRKLNQLDAKEFMAYRRRFVVEVDR 46 >3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A* Length = 411 Score = 25.1 bits (54), Expect = 3.4 Identities = 7/18 (38%), Positives = 9/18 (50%) Query: 60 ALMRYFVVDISRFPHYEL 77 L V +RFP +EL Sbjct: 394 FLADLLVPTKARFPAFEL 411 >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} Length = 508 Score = 23.9 bits (51), Expect = 9.6 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 8/43 (18%) Query: 36 VGIFSSYSNAYDVWKEKSQQMVDNALMRYFVVDISRFP--HYE 76 VG+ ++ + W+E NA+ YF I+R P YE Sbjct: 460 VGVSINFVHDKKSWEEM------NAIQEYFQRPITRVPTDDYE 496 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.319 0.138 0.397 Gapped Lambda K H 0.267 0.0588 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 734,724 Number of extensions: 28115 Number of successful extensions: 110 Number of sequences better than 10.0: 1 Number of HSP's gapped: 110 Number of HSP's successfully gapped: 9 Length of query: 80 Length of database: 5,693,230 Length adjustment: 49 Effective length of query: 31 Effective length of database: 4,505,274 Effective search space: 139663494 Effective search space used: 139663494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)