PSIBLAST alignment of GI: 254780404 and protein with PDB id: 2qfl

>gi|157835913|pdb|2QFL|A Chain A, Structure Of Suhb: Inositol Monophosphatase And Extragenic Suppressor From E. Coli Length = 267
 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/260 (18%), Positives = 96/260 (36%), Gaps = 17/260 (6%)

Query: 31  WKQDLDIVRSAVQGASTVAMQYFLRSPNVWWKHEG-SSPVCDADIAVNDYLESFLRPLRP 89
               L+I   A + A  +  + +     V    +G +  V + D A    +   +R   P
Sbjct: 1   MHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYP 60

Query: 90  AYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHAS 149
            +  ++EE+ +          +V+DP+DGT  FI+    + +S+AV   GR  + VV+  
Sbjct: 61  QHTIITEESGELEGTDQDV-QWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDP 119

Query: 150 ALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVSLKGL----------DSYVRF 199
              + F  + G  +  NG  +  S+ +  D   +                      +   
Sbjct: 120 MRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNEC 179

Query: 200 RRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYN 259
               +  S  L +  +A+G VD    +     WD AA +LL+  +GG + D        +
Sbjct: 180 ADFRATGSAALDLAYVAAGRVDGFF-EIGLRPWDFAAGELLVREAGGIVSDFTGG----H 234

Query: 260 RSQVNHEVLFASAKWHFPSF 279
              +   ++  + +      
Sbjct: 235 NYMLTGNIVAGNPRVVKAML 254