RPSBLAST alignment for GI: 254780404 and conserved domain: TIGR02067

>gnl|CDD|162680 TIGR02067, his_9_proposed, histidinol-phosphate phosphatase HisN, inositol monophosphatase family. This subfamily belongs to the inositol monophosphatase family (pfam00459). The members of this family consist of no more than one per species and are found only in species in which histidine is synthesized de novo but no histidinol phosphatase can be found in either of the two described families (TIGR01261, TIGR01856). In at least one species, the member of this family is found near known histidine biosynthesis genes. Length = 251
 Score = 90.1 bits (224), Expect = 7e-19
 Identities = 64/219 (29%), Positives = 106/219 (48%), Gaps = 13/219 (5%)

Query: 45  ASTVAMQYFLRSPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGWLSEETDDDLQR 104
           A    + +F  S  V  K    +PV +AD A  + +   +    P +G L EE   + + 
Sbjct: 12  AGETILPFFRASLLVVDKKSDKTPVTEADRAAEEAMRELIAAFFPDHGILGEEFGHN-EE 70

Query: 105 LNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKST 164
            + E ++V+DPIDGT++FI G   W   +A+V  G PV+GV+   A G+ ++ + G  + 
Sbjct: 71  GDAERVWVLDPIDGTKSFIRGVPVWGTLIALVEGGMPVLGVIFQPATGERWWAAGGGAAF 130

Query: 165 CNGKNISVSSNQMSDSLAIMASDVSLKGLDS------YVRFRRQSSISSL---CLRILMI 215
             G+ + VSS        +  +   L  LD       + R R  + ++     C   LM+
Sbjct: 131 LGGRRLRVSSCANLSDAVLFTTSPYL--LDDPENRPAFQRLRDAARLTRYGGDCYAYLMV 188

Query: 216 ASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRK 254
           A G VD ++V+   + WD+AA   ++E +GG   D D K
Sbjct: 189 AGGAVD-IVVEPGLSPWDIAALIPVIEEAGGCFTDWDGK 226