RPSBLAST alignment for GI: 254780404 and conserved domain: cd01515

>gnl|CDD|30131 cd01515, Arch_FBPase_1, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV). These are Mg++ dependent phosphatases. Members in this family may have both fructose-1,6-bisphosphatase and inositol-monophosphatase activity. In hyperthermophilic archaea, inositol monophosphatase is thought to play a role in the biosynthesis of di-myo-inositol-1,1'-phosphate, an osmolyte unique to hyperthermophiles.. Length = 257
 Score = 65.3 bits (159), Expect = 2e-11
 Identities = 55/192 (28%), Positives = 80/192 (41%), Gaps = 9/192 (4%)

Query: 72  ADIAVNDYLESFLRPLRPAYGWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCI 131
            D    D     L+ L      +SEE          E   V+DP+DGT   I G   + +
Sbjct: 41  IDKVAEDAAIEILKKLGSV-NIVSEEIGVIDNGDEPEYTVVLDPLDGTYNAINGIPFYSV 99

Query: 132 SVAVVHH--GRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVSSNQMSDSLAIMASDVS 189
           SVAV       P  G V+  A G  ++   G  +  NGK I VS      S+++    + 
Sbjct: 100 SVAVFKIDKSDPYYGYVYNLATGDLYYAIKGKGAYLNGKRIKVSDFSSLKSISVSYY-IY 158

Query: 190 LKGLDSYV----RFRRQSSISSLCLRILMIASGEVDVLI-VDRNANDWDLAAADLLLECS 244
            K  D       + RR     S+ L +  +ASG +D  + V  N    D+AA  L+ E +
Sbjct: 159 GKNHDRTFKICRKVRRVRIFGSVALELCYVASGALDAFVDVRENLRLVDIAAGYLIAEEA 218

Query: 245 GGALVDIDRKLL 256
           GG + D + K L
Sbjct: 219 GGIVTDENGKEL 230