RPSBLAST alignment for GI: 254780404 and conserved domain: COG0483

>gnl|CDD|30831 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism]. Length = 260
 Score =  157 bits (397), Expect = 4e-39
 Identities = 67/241 (27%), Positives = 104/241 (43%), Gaps = 14/241 (5%)

Query: 34  DLDIVRSAVQGASTVAMQYFLRSPNVWW--KHEGSSPVCDADIAVNDYLESFLRPLRPAY 91
            L+I   A + A  + +  F     V    K     PV +AD A    + + LR   P +
Sbjct: 4   MLNIALRAARKAGALILPLFRELDAVEVEVKKSDGDPVTEADKAAERIIRARLRAAFPDH 63

Query: 92  GWLSEETDDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVIGVVHASAL 151
           G L EE+   L     E ++V+DPIDGT  F+ G   + +S+A+V  G PV GV++  A 
Sbjct: 64  GILGEESGGALGG-GDEYVWVIDPIDGTTNFVRGIPFFAVSIALVEDGEPVAGVIYDPAT 122

Query: 152 GKEFFVSVGMKSTCNGKNISVSSN-QMSDSLAIMASDVSLKGLDSYVR---------FRR 201
           G+ +  + G  +  NG+ I VS    ++ SL                           RR
Sbjct: 123 GELYTAAKGKGAYLNGRRIKVSLRTSLNASLLGTGFPGKSLARFPAYLNILAKLLRKVRR 182

Query: 202 QSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVDIDRKLLTYNRS 261
                S  L +  +A+G +D   V+     WD+AA  L++  +GG + D+D   L  N  
Sbjct: 183 VRRYGSAALDLAYVAAGRLDG-FVEFGLRPWDIAAGVLIVREAGGIVTDLDGGPLDPNSG 241

Query: 262 Q 262
            
Sbjct: 242 G 242