RPSBLAST alignment of GI: 254780404 and protein with PDBid: 1jp4

>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Length = 308
 Score =  115 bits (289), Expect = 8e-27
 Identities = 41/280 (14%), Positives = 89/280 (31%), Gaps = 39/280 (13%)

Query: 35  LDIVRSAVQGASTVAMQYFLR-SPNVWWKHEGSSPVCDADIAVNDYLESFLRPLRPAYGW 93
           +    S  Q A T+           +  K   +     AD  V   + S L    P    
Sbjct: 12  VASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTI 71

Query: 94  LSEETDDDLQ-------------------------RLNYETLFVVDPIDGTRAFIEGRNE 128
           + EE     +                             + +  VDP+DGT+ + EG  +
Sbjct: 72  IGEEDLPPGEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLD 131

Query: 129 -WCISVAVVHHGRPVIGVVHASALGKEFFVSVGMKSTCNGKNISVS---------SNQMS 178
              + + + + G+ + G+++      +      +  T  G     +         + +  
Sbjct: 132 NVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHI 191

Query: 179 DSLAIMASDVSLKGLDSYVRFRRQSSISSLCLRILMIASGEVDVLI-VDRNANDWDLAAA 237
            +     S+  +    + +       +     +I+ +  G+    +        WD  A 
Sbjct: 192 ITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAP 251

Query: 238 DLLLECSGGALVDIDRKLLTYNR--SQVNHEVLFASAKWH 275
           +++L   GG L DI    L Y++    +N   + A+ + +
Sbjct: 252 EVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNY 291