BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780405|ref|YP_003064818.1| hypothetical protein CLIBASIA_01450 [Candidatus Liberibacter asiaticus str. psy62] (189 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780405|ref|YP_003064818.1| hypothetical protein CLIBASIA_01450 [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 390 bits (1003), Expect = e-111, Method: Compositional matrix adjust. Identities = 189/189 (100%), Positives = 189/189 (100%) Query: 1 MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTG 60 MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTG Sbjct: 1 MNKIRIIGGKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHVYPVFLDSTRMLNIFAGTG 60 Query: 61 SVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQ 120 SVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQ Sbjct: 61 SVGFEALSRGCHYVLFVDNNSESIRLIRRNSELLGVEKNCNIFFRDVLRLGKIGNISPFQ 120 Query: 121 LVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTK 180 LVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTK Sbjct: 121 LVYLDPPYGQGLAQQALAIIDKEGWLEPNALVIIEEYAGTCISVGAAFHFLQERKYGDTK 180 Query: 181 IYFFSYNPV 189 IYFFSYNPV Sbjct: 181 IYFFSYNPV 189 >gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter asiaticus str. psy62] Length = 1398 Score = 24.3 bits (51), Expect = 1.5, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 9 GKFQRRLLHTPQNRSIRPSDSRTKKALFDILTHV 42 G RRL+ QN + D TKK L +TH+ Sbjct: 791 GYLSRRLVDVAQNCVVNQVDCNTKKGL--TITHI 822 >gi|254781171|ref|YP_003065584.1| hypothetical protein CLIBASIA_05390 [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Score = 23.1 bits (48), Expect = 3.0, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 163 SVGAAFHFLQERKYGDTKIYFF 184 S+G A HF+ ++ + I FF Sbjct: 156 SIGIATHFITDKHIKSSTIVFF 177 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 22.7 bits (47), Expect = 4.6, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 98 KNCNIFFRDVLRLGKIGNISPFQLVYLDPPYGQG 131 KN NI +++ + K+ ISP Q L+ Y G Sbjct: 829 KNLNIKGDEIINIRKLKTISPRQESTLEIHYSDG 862 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.143 0.429 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 126,679 Number of Sequences: 1233 Number of extensions: 5199 Number of successful extensions: 13 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 5 length of query: 189 length of database: 328,796 effective HSP length: 69 effective length of query: 120 effective length of database: 243,719 effective search space: 29246280 effective search space used: 29246280 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 36 (18.5 bits)