HHsearch alignment of GI: 254780406 and MMDB domain: 3i1m_D_97-190

>3i1m_D (D:97-190) 30S ribosomal protein S4; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_D* 3e1a_R 3e1c_R 1vs5_D 3i1o_D 3i1q_D 3i1s_D 3i1z_D 3i21_D 2qal_D* 1p6g_D 1p87_D 2aw7_D 2avy_D 2i2u_D 2i2p_D* 2qan_D* 2qb9_D* 2qbb_D* 2qbd_D ...
Probab=98.39  E-value=1.8e-07  Score=66.41  Aligned_cols=51  Identities=24%  Similarity=0.472  Sum_probs=48.2

Q ss_pred             HHHHHHHHCCCC-CHHHHHHHHHCCCEEECCEECCCCCEEECCCCEEEECCE
Q ss_conf             478899988687-789999999869869999992406878079997999998
Q gi|254780406|r   15 RVSKVIARAGIA-SRREVERMIAQQRVKVNGILLERAAVNVMSTDHIEVDGV   65 (354)
Q Consensus        15 RL~K~la~~g~~-SRr~a~~lI~~G~V~Vng~~v~~~~~~v~~~d~v~vdg~   65 (354)
                      |||.+|.++|++ ||.+|.+||..|.|.|||++|+.|++.|.++|.|+|..+
T Consensus         1 RLD~~l~r~gfa~S~~~ARqlI~hghv~VNg~~v~~ps~~vk~gD~i~i~~~   52 (94)
T 3i1m_D            1 RLDNVVYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREK   52 (94)
T ss_dssp             STTHHHHTTTSCSSHHHHHHHHHTTCEESSSSBCCSTTCCCCTTCCEEECSS
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHCCEECCCEEEEEEEEEECCCCEEEECCC
T ss_conf             8888866031254099999999850376088799763177058977886232