RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780406|ref|YP_003064819.1| putative ribosomal large subunit pseudouridine synthase B [Candidatus Liberibacter asiaticus str. psy62] (354 letters) >d1kska4 d.265.1.3 (A:60-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli [TaxId: 562]} Length = 172 Score = 118 bits (296), Expect = 7e-28 Identities = 41/167 (24%), Positives = 74/167 (44%), Gaps = 3/167 (1%) Query: 74 RLWLYHKPIGLVTTHSDPDGRSTVFDNLPSIFSRVISVGRLDINTEGLLLLTNDGGLARV 133 R ++ +KP G V + DPD + ++ + ++ + GRLDI+T GL+L+T+DG + Sbjct: 2 RYFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHR 61 Query: 134 LELPSTQWLRVYRVRFHGQVDQDKLNLLKKGIVIQGICYGDMQVTLDTQKGSNAWVTVGL 193 + P + Y V V D KG+ + L+ + +T + Sbjct: 62 ITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLT--I 119 Query: 194 REGKNREIKKVFEFFNWKVNRLIRISYGPFQL-GTLLAGSTREVSKK 239 EG+ ++K++F V L R G L L G R ++++ Sbjct: 120 SEGRYHQVKRMFAAVGNHVVELHRERIGGITLDADLAPGEYRPLTEE 166 >d1vioa1 d.265.1.3 (A:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]} Length = 174 Score = 108 bits (271), Expect = 7e-25 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 5/175 (2%) Query: 71 ERTRLWLYHKPIGLVTTHSDPDGRSTVFDNLPSIFS-RVISVGRLDINTEGLLLLTNDGG 129 E + ++ +KP G V ++ D T++ + ++ S GRLD++T GL+LLT+DG Sbjct: 1 EEGQYFMLNKPQGCVCSNDDG-DYPTIYQFFDYPLAGKLHSAGRLDVDTTGLVLLTDDGQ 59 Query: 130 LARVLELPSTQWLRVYRVRFHGQVDQDKLNLLKKGIVIQGICYGDMQVTLDTQKGSNAWV 189 + + P + Y V V+++ +GI+++G L+ N + Sbjct: 60 WSHRITSPKHHCEKTYLVTLADPVEENYSAACAEGILLRGEKEPTKPAKLEILDDYNVNL 119 Query: 190 TVGLREGKNREIKKVFEFFNWKVNRLIRISYGPFQLGTLLA-GSTREVSKKILRE 243 T + EG+ ++K++F KV L R G L L G R +++ + + Sbjct: 120 T--ISEGRYHQVKRMFAALGNKVVGLHRWKIGDVVLDESLEEGEYRPLTQSEIEK 172 >d1kska3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]} Length = 59 Score = 57.1 bits (138), Expect = 2e-09 Identities = 18/55 (32%), Positives = 27/55 (49%) Query: 15 RVSKVIARAGIASRREVERMIAQQRVKVNGILLERAAVNVMSTDHIEVDGVPLRK 69 R+ K IA+ SR R I RV V+G ++ AA ++ + DG PL + Sbjct: 2 RLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQ 56 >d1vioa2 d.66.1.5 (A:0-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 58 Score = 56.6 bits (137), Expect = 3e-09 Identities = 15/53 (28%), Positives = 26/53 (49%) Query: 15 RVSKVIARAGIASRREVERMIAQQRVKVNGILLERAAVNVMSTDHIEVDGVPL 67 R+ K IA +R + + I Q VK+NG +++ +V + D I + L Sbjct: 3 RLDKFIAENVGLTRSQATKAIRQSAVKINGEIVKSGSVQISQEDEIYFEDELL 55 >d1p9ka_ d.66.1.6 (A:) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]} Length = 79 Score = 46.0 bits (109), Expect = 4e-06 Identities = 10/55 (18%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 15 RVSKVIARAGIA-SRREVERMIAQQRVKVNGILLERAAVNVMSTDHIEVDGVPLR 68 + ++ G + S + + IA+ +VKV+G + R +++ + G ++ Sbjct: 22 ELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAVETRKRCKIVAGQTVSFAGHSVQ 76 >d1ejea_ b.45.1.2 (A:) FMN-binding protein MTH152 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 192 Score = 29.8 bits (66), Expect = 0.32 Identities = 10/36 (27%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Query: 59 HIEVDGVPLRKAERTRLWLYHKPIGLVTTHSDPDGR 94 ++ + P+ A R L +P +VTT D +G Sbjct: 9 SMDFEDFPVESAHR---ILTPRPTVMVTTV-DEEGN 40 >d1jh3a_ d.66.1.4 (A:) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 99 Score = 29.0 bits (65), Expect = 0.60 Identities = 12/55 (21%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 16 VSKVIARAGIA-SRREVERMIAQQRVKVNGILLERAAVNVMSTDHIEVDGVPLRK 69 + +++ AGI+ S+R+ I + VNG L+ + + +E +R+ Sbjct: 34 LVELLVSAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAEHRLEGRFTVIRR 88 >d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Length = 306 Score = 29.0 bits (63), Expect = 0.64 Identities = 6/24 (25%), Positives = 14/24 (58%) Query: 16 VSKVIARAGIASRREVERMIAQQR 39 V++ A+ + R E++ + +QR Sbjct: 283 VTRKGAQPSVPWREEIDAFLDRQR 306 >d2vk9a1 c.68.1.22 (A:2-541) Alpha-toxin {Clostridium novyi [TaxId: 1542]} Length = 540 Score = 27.6 bits (61), Expect = 1.6 Identities = 6/52 (11%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Query: 273 NIISEVPDDFTRMKKNSSQKNGLSKQKKLATPV---HRRNLASNVWMAKGIH 321 + ++E+ D++ +S + L + +N ++ +K + Sbjct: 49 SKLNELVDNYQTKYPSSGRNLALENFRDSLYSELRELIKNSRTSTIASKNLS 100 >d1h3fa2 d.66.1.4 (A:352-432) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 81 Score = 25.9 bits (57), Expect = 5.2 Identities = 10/46 (21%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 16 VSKVIARAGIA-SRREVERMIAQQRVKVNGILLERAAVNVMSTDHI 60 V+++ AG+ S E R+I + ++++G +L + V + Sbjct: 20 VARLFTLAGLTPSNAEARRLIQNRGLRLDGEVLTDPMLQVDLSRPR 65 >d1k3ea_ d.198.1.1 (A:) Secretion chaperone CesT {Escherichia coli [TaxId: 562]} Length = 146 Score = 25.7 bits (56), Expect = 5.7 Identities = 9/48 (18%), Positives = 18/48 (37%) Query: 98 FDNLPSIFSRVISVGRLDINTEGLLLLTNDGGLARVLELPSTQWLRVY 145 + L F+ I +G + N L D L + +++ +Y Sbjct: 5 SELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIY 52 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.134 0.385 Gapped Lambda K H 0.267 0.0603 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,278,816 Number of extensions: 60620 Number of successful extensions: 157 Number of sequences better than 10.0: 1 Number of HSP's gapped: 155 Number of HSP's successfully gapped: 13 Length of query: 354 Length of database: 2,407,596 Length adjustment: 86 Effective length of query: 268 Effective length of database: 1,226,816 Effective search space: 328786688 Effective search space used: 328786688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.5 bits)