RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) >2k5k_A Uncharacterized protein RHR2; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Rhodobacter sphaeroides 2} Length = 70 Score = 79.6 bits (196), Expect = 2e-16 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 2/64 (3%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 M + T + + L A RAL EA++R+ K LP EIGGR G +P RFGDWEK GI Sbjct: 1 MRDMT-EETRKDLPPEALRALAEAEERRRRA-KALDLPKEIGGRNGPEPVRFGDWEKKGI 58 Query: 72 SIDF 75 +IDF Sbjct: 59 AIDF 62 >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 26.0 bits (56), Expect = 2.1 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 7/26 (26%) Query: 28 AKRALEEAKQRKSA-------NNKDA 46 AK+ LEE QR+S NN+ A Sbjct: 116 AKKDLEEWNQRQSEQVEKNKINNRIA 141 >2isn_A NYSGXRC-8828Z, phosphatase; pathogenic strain, praseodymium, sulfate, structural genomics, PSI-2, protein structure initiative; 1.90A {Toxoplasma gondii} Length = 364 Score = 24.2 bits (51), Expect = 7.6 Identities = 7/27 (25%), Positives = 13/27 (48%) Query: 17 IKTSHDPLSSIAKRALEEAKQRKSANN 43 ++ S L +A R ++ A S +N Sbjct: 298 MQRSKGDLEEVAARVMDYAYDMNSQDN 324 >1g57_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli} SCOP: d.115.1.2 PDB: 1g58_A 1iez_A 3h07_A Length = 217 Score = 24.1 bits (52), Expect = 8.8 Identities = 4/28 (14%), Positives = 12/28 (42%), Gaps = 1/28 (3%) Query: 12 MNNSTIKTSHDPLSSIAKRALEEAKQRK 39 M + + + P + + AL ++ + Sbjct: 1 MAQTLLSSFGTPFERV-ENALAALREGR 27 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 612,518 Number of extensions: 21522 Number of successful extensions: 47 Number of sequences better than 10.0: 1 Number of HSP's gapped: 46 Number of HSP's successfully gapped: 8 Length of query: 75 Length of database: 5,693,230 Length adjustment: 44 Effective length of query: 31 Effective length of database: 4,626,494 Effective search space: 143421314 Effective search space used: 143421314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.7 bits)