BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] (75 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780408|ref|YP_003064821.1| hypothetical protein CLIBASIA_01465 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Score = 154 bits (388), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 75/75 (100%), Positives = 75/75 (100%) Query: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP Sbjct: 1 MRTVQINIRGLMNNSTIKTSHDPLSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDP 60 Query: 61 TRFGDWEKNGISIDF 75 TRFGDWEKNGISIDF Sbjct: 61 TRFGDWEKNGISIDF 75 >gi|254780804|ref|YP_003065217.1| DNA polymerase III subunit delta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 22.3 bits (46), Expect = 1.7, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 10/18 (55%) Query: 19 TSHDPLSSIAKRALEEAK 36 T HDP S + ALE K Sbjct: 48 TYHDPFSLVVLNALEIQK 65 >gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] Length = 223 Score = 21.2 bits (43), Expect = 3.2, Method: Compositional matrix adjust. Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 24 LSSIAKRALEEAKQRKSANNKDAKLPIEIGGRKGLDPTRFGDWEKNGI 71 ++S + + + EA R + + P + + GLDPT F ++ GI Sbjct: 1 MTSFSHKKIWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGI 46 >gi|254780655|ref|YP_003065068.1| transketolase [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 20.8 bits (42), Expect = 4.2, Method: Compositional matrix adjust. Identities = 7/9 (77%), Positives = 8/9 (88%) Query: 66 WEKNGISID 74 W+ NGISID Sbjct: 195 WDNNGISID 203 >gi|255764490|ref|YP_003065085.2| dehydrogenase, E1 component [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 20.4 bits (41), Expect = 5.5, Method: Composition-based stats. Identities = 5/15 (33%), Positives = 13/15 (86%) Query: 1 MRTVQINIRGLMNNS 15 ++ +++N+R ++NNS Sbjct: 329 LKEIEMNVRKIINNS 343 >gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Score = 20.0 bits (40), Expect = 7.1, Method: Compositional matrix adjust. Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 43 NKDAKLPIEIGGRK 56 N D LPI++ G+K Sbjct: 807 NTDIILPIQVNGKK 820 >gi|254781078|ref|YP_003065491.1| hypothetical protein CLIBASIA_04900 [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Score = 19.6 bits (39), Expect = 9.2, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 40 SANNKDAKLPIEIGGRKG 57 S NN +AK +E RKG Sbjct: 212 SVNNSNAKSDVERVDRKG 229 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.131 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,375 Number of Sequences: 1233 Number of extensions: 1502 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 75 length of database: 328,796 effective HSP length: 45 effective length of query: 30 effective length of database: 273,311 effective search space: 8199330 effective search space used: 8199330 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 31 (16.5 bits)