HHsearch alignment for GI: 254780409 and conserved domain: PRK02270

>PRK02270 consensus.
Probab=98.15  E-value=0.00013  Score=50.98  Aligned_cols=141  Identities=11%  Similarity=0.145  Sum_probs=94.2

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCCCCCCCCEEEEECHHHCC-HHH---HHHHHHHHH
Q ss_conf             5551885166563578999999709979998326767632100002454557428995213203-366---888989875
Q gi|254780409|r  158 ISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDT-GGT---LCGAADALY  233 (310)
Q Consensus       158 ~~~~vVVaPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~v~~~~~~gdV~gr~vIIVDDii~T-GgT---i~~aa~~Lk  233 (310)
T Consensus         3 ~~~~~ifsgs-s~~~LA~~IA~~Lg~~l~~~~~~~F~DGE~~v-~i~esvrg~dV~ivqs~~~pvnd~lmELll~idA~r   80 (327)
T PRK02270          3 KENIILFGME-NSIDLAKEISKITNIPLSTIEKTVFADGEVLL-KSKETVRNRDVFIVASTSRPVNENIMELLIFIDSLK   80 (327)
T ss_pred             CCCEEEEECC-CCHHHHHHHHHHHCCCCCCEEEEECCCCCEEE-EECCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             7877999799-98999999999969973122889989998898-427877898089987899993178999999999998


Q ss_pred             HCCCCCEEEEEECCCCC-------------HH-HHHHHHHCCCCEEEECCCCCCCHHHHCCCCEEEEECHHHHHHHHHHH
Q ss_conf             26875217872055557-------------16-89888636998999817887843474079859981179999999987
Q gi|254780409|r  234 EQGALSVTAYITHGVLS-------------SS-SIERIEKSKMKELVITDSIQPTDLVKSSAKIRILTIAQLMGEAINRT  299 (310)
Q Consensus       234 ~~GA~~V~~~~THgifs-------------~~-a~e~l~~s~i~~iv~TnTi~~~~~~~~~~ki~visva~llA~aI~~i  299 (310)
T Consensus        81 rasA~~It~ViPY~~YaRQDrk~~~repIsaklvA~lL~~~G~d~vitvDlH~~qiqgfF~iPvd~l~a~~~l~~~i~~~  160 (327)
T PRK02270         81 RASAKEINVILSYYGYARQDRKSSGRQPIGAKLVADLLEKAGATKIISVDLHNPSIQGFFDIPVDDIKGQYILAKELKKK  160 (327)
T ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHCCCCCCCEEEECCHHHHHHHHHC
T ss_conf             73887258971254434477766899863399999988524786478843576888504699730477427879988640


Q ss_pred             H
Q ss_conf             1
Q gi|254780409|r  300 F  300 (310)
Q Consensus       300 ~  300 (310)
T Consensus       161 ~  161 (327)
T PRK02270        161 N  161 (327)
T ss_pred             C
T ss_conf             6