HHsearch results for GI: 254780409 and protein with PDBid: 1a3c_A

>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A*
Probab=98.89  E-value=9.3e-09  Score=77.02  Aligned_cols=105  Identities=24%  Similarity=0.386  Sum_probs=73.1

Q ss_pred             HHHHHHHHHHH-CCCCCEEEEECCCCHHHHHHHHHHHCC----CC--EEEEEC--CCCCC-------CCC-EEECCCCCC
Q ss_conf             37777876530-585551885166563578999999709----97--999832--67676-------321-000024545
Q gi|254780409|r  145 LPILERDIKER-NDISNLMVVSPDVGGVVRARALAKRLG----CL--LAIVDK--RREHP-------GKI-EVMNIIGKV  207 (310)
Q Consensus       145 ~~~l~~~l~~~-~~~~~~vVVaPD~G~~~ra~~~a~~L~----~~--~~~~~K--~R~~~-------~~v-~~~~~~gdV  207 (310)
                      ...++..+.+. .+.+++++++.-.||...+..+.+.|.    .+  ...++-  .|...       +.. ....+..++
T Consensus        17 i~~lA~qI~e~~~~~~~~vligil~Gg~~fa~~L~~~l~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~d~~~~l   96 (181)
T 1a3c_A           17 LTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRDDLSKKTSNDEPLVKGADIPVDI   96 (181)
T ss_dssp             HHHHHHHHHHHCC----CEEEEESHHHHHHHHHHHHHHHHHHSSCCEEEEEEEECCC--------CCCCEEEEEECSSCC
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCEEEHHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCCCCEEECCCCCCCC
T ss_conf             99999999986689998899987353997288999864221288741101344677425654556763478614576212


Q ss_pred             CCCEEEEECHHHCCHHHHHHHHHHHHHCC-CCCEEEEEECCCCCHH
Q ss_conf             57428995213203366888989875268-7521787205555716
Q gi|254780409|r  208 EGKDCILIDDIVDTGGTLCGAADALYEQG-ALSVTAYITHGVLSSS  252 (310)
Q Consensus       208 ~gr~vIIVDDii~TGgTi~~aa~~Lk~~G-A~~V~~~~THgifs~~  252 (310)
                      +||+|+||||++|||.||..+.+.|++.| |++|.+++   ++..+
T Consensus        97 ~gk~VliVDDIlDTG~TL~~~~~~l~~~~~~~~v~~av---L~dk~  139 (181)
T 1a3c_A           97 TDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAV---LVDRG  139 (181)
T ss_dssp             TTSEEEEEEEEESSSHHHHHHHHHHHHHCCCSEEEEEE---EEECC
T ss_pred             CCCEEEEEECHHHHHHHHHHHHHHHHHCCCCCEEEEEE---EECCC
T ss_conf             59789999400112189999999997438986899999---98287