HHsearch results for GI: 254780409 and protein with PDBid: 2yzk_A

>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix}
Probab=99.37  E-value=3.1e-12  Score=100.06  Aligned_cols=114  Identities=21%  Similarity=0.253  Sum_probs=86.9

Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCCCCCCCCEEEEECHHHCCHHH
Q ss_conf             37777876530585551885166563578999999709979998326767632100002454557428995213203366
Q gi|254780409|r  145 LPILERDIKERNDISNLMVVSPDVGGVVRARALAKRLGCLLAIVDKRREHPGKIEVMNIIGKVEGKDCILIDDIVDTGGT  224 (310)
Q Consensus       145 ~~~l~~~l~~~~~~~~~vVVaPD~G~~~ra~~~a~~L~~~~~~~~K~R~~~~~v~~~~~~gdV~gr~vIIVDDii~TGgT  224 (310)
                      ..++++.+.+.. .+..+|++|+.||++.|..+|..|+.|+.++.|++...++.  ....|.++|++|+||||+++||+|
T Consensus        45 ~~~~~e~~~~~~-~~~d~Vvg~~~gGip~a~~~A~~l~~p~~~iRk~~k~~g~~--~~~~g~~~g~~VlIVDDvitTG~S  121 (178)
T 2yzk_A           45 LDLLLEVGGQDL-ARSSAVIGVATGGLPWAAMLALRLSKPLGYVRPERKGHGTL--SQVEGDPPKGRVVVVDDVATTGTS  121 (178)
T ss_dssp             HHHHHHHHHHHH-HHCSEEEEETTTTHHHHHHHHHHHTCCEEEECCCCTTSCCC--CCCBTCCCSSEEEEEEEEESSSHH
T ss_pred             HHHHHHHHHHHC-CCCCEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCC--CEEEEECCCCEEEEEEEEECCCCC
T ss_conf             999999987544-65898998737741566777886458720223103566544--148852489579999744735746


Q ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHCCC
Q ss_conf             88898987526875217872055557168988863699
Q gi|254780409|r  225 LCGAADALYEQGALSVTAYITHGVLSSSSIERIEKSKM  262 (310)
Q Consensus       225 i~~aa~~Lk~~GA~~V~~~~THgifs~~a~e~l~~s~i  262 (310)
                      +.++++.+++.|++-+.+++---- ++++.|.+++.++
T Consensus       122 ~~~~i~~l~~~G~~v~~v~vlvdr-~~~~~e~~~~~gi  158 (178)
T 2yzk_A          122 IAKSIEVLRSNGYTVGTALVLVDR-GEGAGELLARMGV  158 (178)
T ss_dssp             HHHHHHHHHHTTCEEEEEEEEEEC-CSSHHHHHHTTTC
T ss_pred             HHHHHHHHHHCCCEEEEEEEEEEC-CCCHHHHHHHCCC
T ss_conf             899999999889979999999978-7676899997699