HHsearch results for GI: 254780409 and protein with PDBid: 3dmp_A

>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei}
Probab=98.15  E-value=1.9e-05  Score=55.01  Aligned_cols=112  Identities=19%  Similarity=0.194  Sum_probs=83.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHC-CCCEEEEECCCCCCC-CCEEECCCCCCCCCEEEEECHHHCCHHHHHHHHHHHHHC
Q ss_conf             555188516656357899999970-997999832676763-210000245455742899521320336688898987526
Q gi|254780409|r  158 ISNLMVVSPDVGGVVRARALAKRL-GCLLAIVDKRREHPG-KIEVMNIIGKVEGKDCILIDDIVDTGGTLCGAADALYEQ  235 (310)
Q Consensus       158 ~~~~vVVaPD~G~~~ra~~~a~~L-~~~~~~~~K~R~~~~-~v~~~~~~gdV~gr~vIIVDDii~TGgTi~~aa~~Lk~~  235 (310)
                      .+++++|+.--.|......+.+.+ +++.+.+.-.|+... ...-.....+++++.|+|+|.|+.||||++.|.+.|++.
T Consensus        76 ~~~i~~V~IlRAGl~m~~~~~~~~p~a~~g~i~i~r~~~t~~~~y~~~~p~~~~~~villDPmlATG~s~~~ai~~L~~~  155 (217)
T 3dmp_A           76 GKKLAIVPVLRAGVGMSDGLLELIPSARVGHIGVYRADDHRPVEYLVRLPDLEDRIFILCDPMVATGYSAAHAIDVLKRR  155 (217)
T ss_dssp             GGGEEEEEEETTTHHHHHHHHHHCTTSEECEEECSCCCSSSCCCSEEECCCCTTCEEEEECSEESSSHHHHHHHHHHHTT
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             78349988613542478889986777520057401257886300765087734460999944025775799999999984


Q ss_pred             CC--CCEEEEEECCCCCHHHHHHHHHC-CCCEEEECCCCC
Q ss_conf             87--52178720555571689888636-998999817887
Q gi|254780409|r  236 GA--LSVTAYITHGVLSSSSIERIEKS-KMKELVITDSIQ  272 (310)
Q Consensus       236 GA--~~V~~~~THgifs~~a~e~l~~s-~i~~iv~TnTi~  272 (310)
                      |+  ++|.+++  -+-+..+++++.+. +--+|| |-.|.
T Consensus       156 Gv~~~~I~~v~--~iaa~~Gi~~i~~~~P~v~I~-ta~iD  192 (217)
T 3dmp_A          156 GVPGERLMFLA--LVAAPEGVQVFQDAHPDVKLY-VASLD  192 (217)
T ss_dssp             TCCGGGEEEEC--SEECHHHHHHHHHHCTTCEEE-ESEEC
T ss_pred             CCCCCEEEEEE--EEECHHHHHHHHHHCCCCEEE-EEEEC
T ss_conf             99845289999--875479999999879397899-99706