BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780410|ref|YP_003064823.1| hypothetical protein
CLIBASIA_01475 [Candidatus Liberibacter asiaticus str. psy62]
         (362 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780410|ref|YP_003064823.1| hypothetical protein CLIBASIA_01475 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040087|gb|ACT56883.1| hypothetical protein CLIBASIA_01475 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 362

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/362 (100%), Positives = 362/362 (100%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG
Sbjct: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE
Sbjct: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID
Sbjct: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID
Sbjct: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK
Sbjct: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300

Query: 301 FLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
           FLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF
Sbjct: 301 FLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360

Query: 361 VN 362
           VN
Sbjct: 361 VN 362


>gi|315122147|ref|YP_004062636.1| hypothetical protein CKC_01985 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495549|gb|ADR52148.1| hypothetical protein CKC_01985 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 368

 Score =  557 bits (1435), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 265/362 (73%), Positives = 304/362 (83%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           ++  L +KIV+LIK+NGQ+T+DQYF+LC++D EFGYY TCNPFG  GDFVTAPEISQIFG
Sbjct: 3   VKTGLYQKIVDLIKRNGQITIDQYFSLCLSDSEFGYYKTCNPFGVDGDFVTAPEISQIFG 62

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EMLAIFLI AWEQHGFP CVRL+E+GPGRG MMLD+LR ICKL+PDFF++LSIYM+E SE
Sbjct: 63  EMLAIFLIFAWEQHGFPRCVRLIEMGPGRGTMMLDVLRTICKLRPDFFAILSIYMIENSE 122

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  IQKK L+ YGDKINW   ++DVP GFTFL+ANEFFDSLPIKQFV+T  G+RERMID
Sbjct: 123 RLVSIQKKNLSFYGDKINWCVGISDVPPGFTFLMANEFFDSLPIKQFVITNDGMRERMID 182

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           ID H+ LVF IG + I S     +DYF G I E SPCRD  +QSI+DRL C+GGTAIVID
Sbjct: 183 IDHHELLVFGIGKNAITSPVSPFNDYFPGMILETSPCRDSAIQSIADRLVCEGGTAIVID 242

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG+LQS +GDTLQAVKGH Y  PL++PGQADLSSHVDFQRLSSI+IL KLYING   QGK
Sbjct: 243 YGHLQSGMGDTLQAVKGHKYDPPLMHPGQADLSSHVDFQRLSSISILRKLYINGCVKQGK 302

Query: 301 FLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
           FLE LGIWQR FSLMK T R DILLDSV+RLV   +D KSMGELFK+LVVSH KV+L+PF
Sbjct: 303 FLECLGIWQRVFSLMKNTDRADILLDSVRRLVGMPSDDKSMGELFKVLVVSHRKVDLVPF 362

Query: 361 VN 362
           VN
Sbjct: 363 VN 364


>gi|222086587|ref|YP_002545121.1| hypothetical protein Arad_3178 [Agrobacterium radiobacter K84]
 gi|221724035|gb|ACM27191.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 365

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/363 (50%), Positives = 249/363 (68%), Gaps = 5/363 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG +++  YF+LC+ADP+ GYY T  PFG+VGDFVTAPEISQ+FG
Sbjct: 1   MTTPLGEKIKAIIRANGPVSITDYFSLCLADPQHGYYKTREPFGSVGDFVTAPEISQLFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ IF++ AW++HG PS V+LVE+GPGRG MM D+LRVI KL P  +  +S+++VETS+
Sbjct: 61  EMIGIFMVHAWQRHGAPSEVQLVEIGPGRGTMMADMLRVISKLAPPLYDAMSVHLVETSD 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL   Q++ LA +GDK++W++   DVP GFT L ANE FD++PI+QFV T +G RER + 
Sbjct: 121 RLQEFQRQTLADHGDKVSWHSDFNDVPAGFTLLAANELFDAIPIRQFVRTANGFRERTVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDY-FLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
           +D +D L F +G   + S FL       +G IFE +P R   M ++ DR+A  GGTA+ I
Sbjct: 181 LDANDELTFAVGVAGLDSAFLPDGQLPPIGTIFEIAPARQAVMTTVCDRIAAHGGTALAI 240

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG++ +  GDTLQAV+ H Y  PL +PG+ADL+SHVDFQ L++ A    L ING   QG
Sbjct: 241 DYGHMATGFGDTLQAVRMHEYDPPLEHPGEADLTSHVDFQHLAATAAASGLQINGCCHQG 300

Query: 300 KFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
            FL GLG+ +RA +L   +  A +D +  +V+RL    A +  MGELFK+L VS   ++L
Sbjct: 301 DFLIGLGLLERAAALGRDRDAATQDGIRAAVERLA--GAGEGKMGELFKVLAVSSPAIDL 358

Query: 358 MPF 360
            PF
Sbjct: 359 QPF 361


>gi|218463849|ref|ZP_03503940.1| hypothetical protein RetlK5_32579 [Rhizobium etli Kim 5]
          Length = 366

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 244/364 (67%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG ++V  YF+LC+ADPE GYY T  PFG  GDFVTAPEISQIFG
Sbjct: 1   MSTALGEKIKAIIQANGPISVTDYFSLCLADPEHGYYRTREPFGRSGDFVTAPEISQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRLVE+GPGRG M+ D+LRVI ++ P  F  +++++VETSE
Sbjct: 61  EMIGVFIVHAWQRHGTPADVRLVEIGPGRGTMISDMLRVISRIAPPLFDTMTVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +QK+ L  YG+KI W+    +VP GFT + ANE FD++PI+QF+ T+ G RERM+ 
Sbjct: 121 RLRDVQKQTLEDYGEKIAWHDGFDEVPAGFTLIAANELFDAIPIRQFIRTQTGFRERMVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D    L F  G   +    L     +  LG +FE SP R   M +I +RL   GGTA+V
Sbjct: 181 LDADGELTFAAGVAGLDPALLPEPVQNLPLGTLFEISPARQAVMMAICERLRAFGGTALV 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+   L++NG   Q
Sbjct: 241 IDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALAAGLHLNGALHQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA +L   ++   + ++  +V RL    A +  MGELFK + VSH  V+
Sbjct: 301 GDFLTGLGILERAAALGRDREPQTQQVIQTAVDRLA--GAGEGRMGELFKAMAVSHPAVD 358

Query: 357 LMPF 360
           LMPF
Sbjct: 359 LMPF 362


>gi|227822833|ref|YP_002826805.1| putative transcriptional regulator, TetR family [Sinorhizobium
           fredii NGR234]
 gi|227341834|gb|ACP26052.1| putative transcriptional regulator, TetR family [Sinorhizobium
           fredii NGR234]
          Length = 367

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/364 (50%), Positives = 238/364 (65%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M N L  KI  LI+ NG ++V  YF+LC+ADP+ GYY    PFG  GDF TAPEISQ+FG
Sbjct: 1   MTNPLADKIKALIRTNGPISVTDYFSLCLADPQHGYYRVREPFGRAGDFTTAPEISQLFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ IFL+ AW++HG P+ V + E+GPGRG MM D+LRVI +L PD ++   +++VETSE
Sbjct: 61  EMIGIFLVHAWQEHGSPAQVVIAEIGPGRGTMMSDMLRVIGRLAPDLYAAADVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + LAS+  KI W+ S   +P GF  L ANE FD++PI+QFV T  G RERM+ 
Sbjct: 121 RLRKVQAETLASHDGKIQWHASFDSLPSGFLLLAANELFDAIPIRQFVRTAQGFRERMVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D  D L F  G   I S+ L      +  G I E +P RD  M ++ +RL  D GTAI+
Sbjct: 181 LDADDELTFAAGVAGIDSSLLPTPAQSVAEGTILEVAPARDAVMAALCERLRADAGTAIL 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H Y  PL NPG+ADL+SHVDF++L+  A    L +NGL  Q
Sbjct: 241 IDYGHLATGYGDTLQAVRNHRYDPPLANPGRADLTSHVDFEQLALRAKTEGLQVNGLARQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLG+  RA +L   K  A ++ + D V+RL    A K  MGELFK+L VS  +V 
Sbjct: 301 GDFLIGLGLLDRAAALGRDKDLATQERIRDDVERLAGAGAGK--MGELFKVLAVSSPEVA 358

Query: 357 LMPF 360
           L PF
Sbjct: 359 LAPF 362


>gi|190892761|ref|YP_001979303.1| hypothetical protein RHECIAT_CH0003177 [Rhizobium etli CIAT 652]
 gi|190698040|gb|ACE92125.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 366

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/364 (48%), Positives = 244/364 (67%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG ++V  YF+LC+ADPE GYY T  PFG  GDFVTAPEISQIFG
Sbjct: 1   MNTALGEKIKAIIQANGPISVTDYFSLCLADPEHGYYRTREPFGRSGDFVTAPEISQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRLVE+GPGRG M+ D+LRVI ++ P  F  +++++VETSE
Sbjct: 61  EMIGVFIVHAWQRHGTPADVRLVEIGPGRGTMISDMLRVISRIAPPLFDTMTVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + L +YG+KI W+    +VP GFT + ANE FD++PI+QFV T+ G RER + 
Sbjct: 121 RLRDVQNQTLEAYGEKIAWHDGFDEVPPGFTLIAANELFDAIPIRQFVRTQTGFRERTVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D    L F  G   +    L     +  LG +FE SP R   M +I +RL   GGTA+V
Sbjct: 181 LDADGELTFAAGVAGLDPALLPEPVQNLPLGTLFEISPARQAVMMAICERLRAFGGTALV 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+   L++NG   Q
Sbjct: 241 IDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALTAGLHLNGALHQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA +L   ++   + ++  +V RL    A +  MGELFK++ VSH  V+
Sbjct: 301 GDFLTGLGILERAAALGRDREPQTQQVIQTAVDRLA--GAGEGRMGELFKVMAVSHPAVD 358

Query: 357 LMPF 360
           LMPF
Sbjct: 359 LMPF 362


>gi|327188366|gb|EGE55583.1| hypothetical protein RHECNPAF_900038 [Rhizobium etli CNPAF512]
          Length = 366

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/364 (48%), Positives = 244/364 (67%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG ++V  YF+LC+ADPE GYY T  PFG  GDFVTAPEISQIFG
Sbjct: 1   MNTALGEKIKAIIQANGPISVTDYFSLCLADPEHGYYRTREPFGRSGDFVTAPEISQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRLVE+GPGRG M+ D+LRVI ++ P  F  +++++VETSE
Sbjct: 61  EMIGVFIVHAWQRHGTPADVRLVEIGPGRGTMISDMLRVISRIAPPLFDAMTVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + L +YG+KI W+    +VP GFT + ANE FD++PI+QFV T+ G RERM+ 
Sbjct: 121 RLRDVQNQTLEAYGEKIAWHDGFDEVPPGFTLIAANELFDAIPIRQFVRTQTGFRERMVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D    L F  G   +    L     +  LG +FE SP R   M +I +RL   GGTA+V
Sbjct: 181 LDADGELTFAAGVAGLDPALLPEPVQNLPLGTLFEISPARQAVMMAICERLRAFGGTALV 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+   L++NG   Q
Sbjct: 241 IDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALTSGLHLNGALHQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA +L   ++   + ++  +V RL    A +  MGELFK++ VSH  V+
Sbjct: 301 GDFLTGLGILERAAALGRDREPQTQQVIQTAVDRLA--GAGEGRMGELFKVMAVSHPAVD 358

Query: 357 LMPF 360
           L PF
Sbjct: 359 LTPF 362


>gi|86358621|ref|YP_470513.1| hypothetical protein RHE_CH03019 [Rhizobium etli CFN 42]
 gi|86282723|gb|ABC91786.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 366

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/364 (48%), Positives = 243/364 (66%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG ++V  YF+LC+ADPE GYY T  PFG  GDFVTAPE+SQIFG
Sbjct: 1   MTTALGEKIKAIIQANGPISVTDYFSLCLADPEHGYYRTREPFGRSGDFVTAPEVSQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRLVE+GPGRG MM D+LRVI ++ P  F  +S+++VETSE
Sbjct: 61  EMIGVFVVHAWQRHGTPADVRLVEIGPGRGTMMADMLRVIARIAPPLFDTMSVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + L +YG++I W+    +VP GFT + ANE FD++PI+QFV T+ G RERM+ 
Sbjct: 121 RLRDVQSQTLEAYGERIAWHGGFDEVPPGFTLIAANELFDAIPIRQFVRTQTGFRERMVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D    L F  G   +    L     +  LG +FE SP R   M +I +RL   GGTA++
Sbjct: 181 LDADGELTFAAGVAGLDPALLPEPVQNLPLGTLFEISPARQAVMMAICERLRAYGGTALI 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A    L++NG   Q
Sbjct: 241 IDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETARAAGLHLNGALHQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA +L   ++   + ++  +V RL    A +  MGELFK++ VS   V+
Sbjct: 301 GDFLTGLGILERAAALGRDREPQTQQVIQSAVDRLA--GAGEGRMGELFKVMAVSDPAVD 358

Query: 357 LMPF 360
           LMPF
Sbjct: 359 LMPF 362


>gi|209550338|ref|YP_002282255.1| hypothetical protein Rleg2_2759 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536094|gb|ACI56029.1| protein of unknown function DUF185 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 366

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 177/364 (48%), Positives = 241/364 (66%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG ++V  YF+LC+ADPE GYY T  PFG  GDFVTAPE+SQIFG
Sbjct: 1   MTTALGEKIKAIIQANGPISVTDYFSLCLADPEHGYYRTREPFGRSGDFVTAPEVSQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRLVE+GPGRG MM D+LRVI ++ P     +++++VETSE
Sbjct: 61  EMIGVFIVHAWQRHGTPAGVRLVEIGPGRGTMMADMLRVISRIAPPLLDAMTVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + L +YG+KI W+    +VP GFT + ANE FD++PI+QFV    G RERMI 
Sbjct: 121 RLRDVQSQTLEAYGEKIAWHDGFDEVPPGFTLIAANELFDAIPIRQFVRMPTGFRERMIG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           ID    L F  G   +    L     +  LG +FE SP R   M +I +RL   GGTA+ 
Sbjct: 181 IDADGELTFAAGVAGLDPALLPEPVQNLPLGTLFEISPARQAVMIAICERLRAFGGTALA 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+   +++NG   Q
Sbjct: 241 IDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALAAGVHLNGALHQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA +L   ++   + ++  +V RL    A +  MGELFK++ VSH  V+
Sbjct: 301 GDFLAGLGILERAAALGHDREPQTQQVIQAAVDRL--AGAGEGRMGELFKVMAVSHPAVD 358

Query: 357 LMPF 360
           LMPF
Sbjct: 359 LMPF 362


>gi|241205722|ref|YP_002976818.1| hypothetical protein Rleg_3022 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859612|gb|ACS57279.1| protein of unknown function DUF185 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 366

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 176/364 (48%), Positives = 243/364 (66%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG ++V  YF+LC+ADPE GYY T  PFG  GDFVTAPE+SQIFG
Sbjct: 1   MTTALGEKIKAIIQANGPISVTDYFSLCLADPEHGYYRTREPFGRSGDFVTAPEVSQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRLVE+GPGRG M+ D+LRVI ++ P  F V+++++VETSE
Sbjct: 61  EMIGVFIVHAWQRHGTPTDVRLVEIGPGRGTMISDMLRVISRIAPPLFDVMTVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + L  +G+KI W+    +VP GFT + ANE FD++PI+QFV    G RERM+ 
Sbjct: 121 RLRDVQSQTLEPHGEKITWHNGFDEVPPGFTLIAANELFDAIPIRQFVRMATGFRERMVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           ID    L F  G   I    L     +  +G +FE SP R   M +I +RL   GGTA+ 
Sbjct: 181 IDADGELTFAPGVAGIDPTLLPEPVQNVPVGTLFEISPARQAVMMAICERLRAFGGTALA 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+   LY+NG   Q
Sbjct: 241 IDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALAAGLYLNGALHQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA +L   ++   + ++  +V+RL    A +  MGELFK++ VS+  ++
Sbjct: 301 GDFLTGLGILERATALGRDREPHTQQVIQAAVERLA--GAGEGRMGELFKVMAVSYPAID 358

Query: 357 LMPF 360
           LMPF
Sbjct: 359 LMPF 362


>gi|150397453|ref|YP_001327920.1| hypothetical protein Smed_2253 [Sinorhizobium medicae WSM419]
 gi|150028968|gb|ABR61085.1| protein of unknown function DUF185 [Sinorhizobium medicae WSM419]
          Length = 367

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 237/364 (65%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M N L  KI  LI+ NG ++V  YF+LC+ADP+ GYY    PFGA GDF TAPEISQ+FG
Sbjct: 1   MTNPLADKIKALIRANGPISVTDYFSLCLADPQHGYYRVREPFGAAGDFTTAPEISQLFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ IFL+ AW+QHG P+   + E+GPGRG MM D+LRVI +L P  +   ++++VETS+
Sbjct: 61  EMIGIFLVHAWQQHGAPANAIISEIGPGRGTMMSDMLRVIRRLAPTLYGTATVHLVETSD 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q K LA +  KI W+ S   +P GF  L ANE FD++PI+QFV T  G RERMI 
Sbjct: 121 RLREVQAKGLAEHEGKIRWHESFDSLPSGFLLLAANELFDAIPIRQFVRTPQGFRERMIG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D  D L F  G   I    L      +  G IFE +P RD  M ++ +RL   GGTA++
Sbjct: 181 LDTEDRLTFAAGAGGIDPTLLPTPAASVPEGTIFEIAPARDAVMAALCERLRAGGGTALI 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H Y  PL NPG AD++SHVDF++L+S A    + +NGL  Q
Sbjct: 241 IDYGHLATGYGDTLQAVRNHEYDPPLANPGFADMTSHVDFEQLASRAKAEGVQVNGLVRQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLG+ +RA +L   K  + ++ + D V+RL  +   K  MGELFK+LVVS  +V 
Sbjct: 301 GDFLVGLGLLERAAALGRDKGESTQEGIRDDVERLAGSGPGK--MGELFKVLVVSSPEVA 358

Query: 357 LMPF 360
           L PF
Sbjct: 359 LAPF 362


>gi|15966097|ref|NP_386450.1| hypothetical protein SMc02682 [Sinorhizobium meliloti 1021]
 gi|15075367|emb|CAC46923.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 372

 Score =  361 bits (927), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 234/364 (64%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M N L  KI  LI+ NG ++V  YF+LC+ADP+ GYY    PFG  GDF TAPEISQ+FG
Sbjct: 6   MTNPLADKIEALIRTNGPISVTDYFSLCLADPQHGYYRVREPFGRAGDFTTAPEISQLFG 65

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ IFL+ AW+QHG P    + E+GPGRG MM D+LRVI +L P  +   ++++VETS+
Sbjct: 66  EMIGIFLVHAWQQHGTPGDAIIAEIGPGRGTMMSDMLRVIRRLAPALYRTATVHLVETSD 125

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + LA +  K+ W+ S   +P GF  L ANE FD++PI+QFV T  G RERM+ 
Sbjct: 126 RLRRLQAETLAEHEGKVRWHESFDSLPSGFLLLAANELFDAIPIRQFVRTAQGFRERMVG 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D    L F  G   I    L      +  G IFE SP RD  M ++ +RL   GGTAI+
Sbjct: 186 LDAEGRLTFAAGIAGIDPALLPSPAPAVAEGTIFEISPARDAVMAALCERLRAGGGTAII 245

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H Y  PL NPG ADL+SHVDF++L+S A    + INGL  Q
Sbjct: 246 IDYGHLATGYGDTLQAVRNHEYDPPLANPGLADLTSHVDFEQLASRAKAEGVQINGLARQ 305

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLG+ +RA +L   K    ++ + D V+RL  + A K  MGELFK+LVVS  +V 
Sbjct: 306 GDFLVGLGLLERASTLGRDKDETTQESIRDDVERLAGSGAGK--MGELFKVLVVSSPEVA 363

Query: 357 LMPF 360
           L PF
Sbjct: 364 LAPF 367


>gi|307305651|ref|ZP_07585398.1| protein of unknown function DUF185 [Sinorhizobium meliloti BL225C]
 gi|307317654|ref|ZP_07597093.1| protein of unknown function DUF185 [Sinorhizobium meliloti AK83]
 gi|306896812|gb|EFN27559.1| protein of unknown function DUF185 [Sinorhizobium meliloti AK83]
 gi|306902354|gb|EFN32950.1| protein of unknown function DUF185 [Sinorhizobium meliloti BL225C]
          Length = 367

 Score =  361 bits (927), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 234/364 (64%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M N L  KI  LI+ NG ++V  YF+LC+ADP+ GYY    PFG  GDF TAPEISQ+FG
Sbjct: 1   MTNPLADKIEALIRTNGPISVTDYFSLCLADPQHGYYRVREPFGRAGDFTTAPEISQLFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ IFL+ AW+QHG P    + E+GPGRG MM D+LRVI +L P  +   ++++VETS+
Sbjct: 61  EMIGIFLVHAWQQHGTPGDAIIAEIGPGRGTMMSDMLRVIRRLAPALYRTATVHLVETSD 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + LA +  K+ W+ S   +P GF  L ANE FD++PI+QFV T  G RERM+ 
Sbjct: 121 RLRRLQAETLAEHEGKVRWHESFDSLPSGFLLLAANELFDAIPIRQFVRTAQGFRERMVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D    L F  G   I    L      +  G IFE SP RD  M ++ +RL   GGTAI+
Sbjct: 181 LDAEGRLTFAAGIAGIDPALLPSPAPAVAEGTIFEISPARDAVMAALCERLRAGGGTAII 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H Y  PL NPG ADL+SHVDF++L+S A    + INGL  Q
Sbjct: 241 IDYGHLATGYGDTLQAVRNHEYDPPLANPGLADLTSHVDFEQLASRAKAEGVQINGLARQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLG+ +RA +L   K    ++ + D V+RL  + A K  MGELFK+LVVS  +V 
Sbjct: 301 GDFLVGLGLLERASTLGRDKDETTQESIRDDVERLAGSGAGK--MGELFKVLVVSSPEVA 358

Query: 357 LMPF 360
           L PF
Sbjct: 359 LAPF 362


>gi|116253206|ref|YP_769044.1| hypothetical protein RL3464 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257854|emb|CAK08952.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 366

 Score =  358 bits (919), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 174/364 (47%), Positives = 241/364 (66%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  +I+ NG ++V  YF+LC+ADPE GYY T  PFG  GDFVTAPE+SQIFG
Sbjct: 1   MTTALGEKIKAIIQANGPISVTDYFSLCLADPEHGYYRTREPFGRSGDFVTAPEVSQIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRLVE+GPGRG M+ D+LRVI ++ P  F  +++++VETSE
Sbjct: 61  EMIGVFIVHAWQRHGTPTDVRLVEIGPGRGTMISDMLRVISRIAPPLFDAMTVHLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q + L  YG+KI W+    +VP GFT + ANE FD++PI+QFV    G RERM+ 
Sbjct: 121 RLRDVQSQTLEPYGEKITWHDGFDEVPPGFTLIAANELFDAIPIRQFVRMPTGFRERMVG 180

Query: 181 IDQHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           ID    L F  G   +    L     +  +G +FE SP R   M +I +RL   GGTA+ 
Sbjct: 181 IDADGELTFAAGVAGLDPAVLPEPVQNVPVGTLFEISPARQAVMIAICERLRAFGGTALT 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+   L++NG   Q
Sbjct: 241 IDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALAAGLHLNGALHQ 300

Query: 299 GKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA  L   ++   + ++  +V+RL    A +  MGELFK++ VS+  ++
Sbjct: 301 GDFLTGLGILERATVLGRDREPQTQHLIQAAVERLA--GAGEGRMGELFKVMAVSYPALD 358

Query: 357 LMPF 360
           LMPF
Sbjct: 359 LMPF 362


>gi|15889490|ref|NP_355171.1| hypothetical protein Atu2214 [Agrobacterium tumefaciens str. C58]
 gi|15157362|gb|AAK87956.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 366

 Score =  358 bits (919), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 169/364 (46%), Positives = 240/364 (65%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L ++I +LI+ NG ++V  +F+LC+ADPE GYY +  PFG  GDF+TAPE+SQ+FG
Sbjct: 1   MTTPLAQRIKSLIRLNGPLSVTDFFSLCLADPEHGYYKSREPFGRSGDFITAPEVSQLFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EML +F++ AW++HG P+  +LVE+GPGRG MM D+LRVI ++ P  +  + +++VETS 
Sbjct: 61  EMLGVFVVHAWQRHGAPAQTQLVEIGPGRGTMMSDMLRVIRRIAPPLYETMRVHLVETSP 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL+ IQK+ L ++ D++ W+ S  DVP GF  LVANE FD++PI+QFV T  G RER++ 
Sbjct: 121 RLSAIQKETLTAHADRLTWHDSFDDVPEGFLLLVANELFDAIPIRQFVRTPQGFRERVVS 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYF--LGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D +  LVF+ G   I    L        LG +FE SP R+  M +I  RL+  GGTA+ 
Sbjct: 181 LDANGELVFSTGLAGIDPTLLPPQPERQQLGTVFEVSPAREAVMTAICQRLSVHGGTALA 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQA++ H +  PL +PG+ADL+SHVDF+ L   A    +++NG   Q
Sbjct: 241 IDYGHLVAGYGDTLQAMRNHAFDPPLAHPGEADLTSHVDFESLVKTAQATGVHVNGALRQ 300

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLG+ +RA +L  +      L   ++V RL    A K  MGELFK++ VS   + 
Sbjct: 301 GDFLHGLGLKERASALAAKATPDQTLEIAEAVNRLAGEGAGK--MGELFKVIAVSSPALH 358

Query: 357 LMPF 360
           L+PF
Sbjct: 359 LLPF 362


>gi|325293572|ref|YP_004279436.1| hypothetical protein AGROH133_07719 [Agrobacterium sp. H13-3]
 gi|325061425|gb|ADY65116.1| hypothetical protein AGROH133_07719 [Agrobacterium sp. H13-3]
          Length = 366

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 240/364 (65%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L ++I +LI+ NG ++V  +F+LC+ADPE GYY +  PFG +GDF+TAPE+SQ+FG
Sbjct: 1   MTTPLAQRIKSLIRLNGPLSVTDFFSLCLADPEHGYYRSREPFGRLGDFITAPEVSQLFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EML +F++ AW++HG P+ +RLVE+GPGRG MM D+LRVI ++ P  +  + +++VETS 
Sbjct: 61  EMLGVFVVHAWQRHGAPADIRLVEIGPGRGTMMSDMLRVIRRIAPPLYETMRVHLVETSP 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  IQK+ LA++ +++ W+ S   VP GF  LVANE FD++PI+QFV T  G RER++ 
Sbjct: 121 RLCAIQKETLAAHAERLTWHDSFDAVPEGFLLLVANELFDAIPIRQFVKTPQGFRERVVS 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSD--YFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +     LVF+ G   I    L        +G+IFE +P R+  M +I  RL+  GGTA+ 
Sbjct: 181 LGTDGELVFSTGLAGIDPTLLPPGPERQPIGSIFEIAPAREAVMTAICQRLSAYGGTALA 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQA++ H +  PL +PGQADL+SHVDF+ L   A    +++NG   Q
Sbjct: 241 IDYGHLVAGYGDTLQAMRNHAFDPPLSHPGQADLTSHVDFESLIRTAEANGVHVNGGIRQ 300

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLG+ +RA +L  +      L   ++V RL    A +  MGELFK++ VS   + 
Sbjct: 301 GDFLYGLGLKERATALAAKATPDQTLEIAEAVNRLAGEGAGR--MGELFKVIAVSSPALH 358

Query: 357 LMPF 360
           LMPF
Sbjct: 359 LMPF 362


>gi|222149326|ref|YP_002550283.1| hypothetical protein Avi_3172 [Agrobacterium vitis S4]
 gi|221736310|gb|ACM37273.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 377

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 171/364 (46%), Positives = 232/364 (63%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  KI  LI+ NG ++V  YFALC+ADPEFGYY T  PFG  GDF+T PEISQIFG
Sbjct: 8   MTTTLGDKIKALIRLNGPLSVTDYFALCLADPEFGYYKTREPFGTSGDFITGPEISQIFG 67

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +F++ AW++HG P+ VRL E+GPGRG MM D+LRVI +L PD +   ++++VETS+
Sbjct: 68  EMIGVFIVHAWQRHGLPAPVRLAEVGPGRGTMMSDMLRVIARLAPDLYRDSTVHLVETSD 127

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  IQ+  L  + +KI+W+ S  DVP GF  +VANE FD++PI+QFV      RERM+ 
Sbjct: 128 RLRQIQRNSLEPHIEKIDWHDSFGDVPEGFVLVVANELFDAIPIRQFVKLGPHYRERMVS 187

Query: 181 IDQHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +   D L+F+ G   +    L    S    G +FE SP R   M ++ +RL  +GG A++
Sbjct: 188 LGLDDELIFSTGVATLDPALLPPGASAQPDGTVFEFSPARRAVMAAMCERLKAEGGAALI 247

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG++ +  GDTLQA++ H Y  PL NPG ADL+SHVDF+ L+  A+   +  +G   Q
Sbjct: 248 IDYGHISTGFGDTLQALRAHDYDPPLANPGIADLTSHVDFEDLARTALAAGITPSGCLRQ 307

Query: 299 GKFLEGLGIWQRA--FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL GLGI +RA      K  A +  L ++V RL      +  MGELFK+L +S   + 
Sbjct: 308 GDFLLGLGIKERAGILGRGKDEATQLELAEAVNRLAGAGVGR--MGELFKVLALSSPTLS 365

Query: 357 LMPF 360
           L PF
Sbjct: 366 LAPF 369


>gi|163761592|ref|ZP_02168663.1| hypothetical protein HPDFL43_13802 [Hoeflea phototrophica DFL-43]
 gi|162281188|gb|EDQ31488.1| hypothetical protein HPDFL43_13802 [Hoeflea phototrophica DFL-43]
          Length = 378

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 161/364 (44%), Positives = 235/364 (64%), Gaps = 6/364 (1%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +   L  K+  +I++ G + +  +FALC+ADP+ GYY T  PFG  GDF+TAPE+SQ+FG
Sbjct: 12  LRTPLAEKMARIIEQAGPLKISDFFALCLADPDHGYYKTREPFGRSGDFITAPEVSQLFG 71

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ +FL+ AW+  G P  VR+ E+GPGRG +M D LRVI KL PD ++  +I+MVETS+
Sbjct: 72  EMIGVFLVHAWQAQGAPDQVRIAEIGPGRGTLMSDALRVIAKLAPDLYANATIHMVETSD 131

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL   Q++ L    D+I W+ +  ++P GFT +VANE FD++PI QFV T +G RER++ 
Sbjct: 132 RLRNEQRQTLVRIKDRICWHQAFEEIPAGFTLMVANELFDAIPIHQFVKTPNGFRERVVG 191

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIV 238
           +D++  L F IG      + L   +  +  G IFE +P R   MQ+++ +L  DGGTA+ 
Sbjct: 192 LDENGRLAFGIGTGSFDPSLLPVDEAAVPEGEIFELAPARSAVMQAVASKLVRDGGTALS 251

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L +  GDTLQAV  H + +PL  PG+ADL+SHVDFQ L+  A+    +++   TQ
Sbjct: 252 IDYGHLVTGFGDTLQAVYRHEFDTPLARPGEADLTSHVDFQALAEAAVAAGAHLHRPLTQ 311

Query: 299 GKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G+FL GLG+ +RA +L   +    +  + D+V RL      +  MG LFK+L +S  +V 
Sbjct: 312 GEFLVGLGLVERAGALGSGRDALTQAAIRDAVNRLAGEGEGR--MGALFKVLAISGAQVR 369

Query: 357 LMPF 360
           + PF
Sbjct: 370 IAPF 373


>gi|323136895|ref|ZP_08071975.1| protein of unknown function DUF185 [Methylocystis sp. ATCC 49242]
 gi|322397656|gb|EFY00178.1| protein of unknown function DUF185 [Methylocystis sp. ATCC 49242]
          Length = 360

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 215/359 (59%), Gaps = 6/359 (1%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N L ++I   I  +G MT++ + +LC+  P  GYY T +PFGA GDF+TAPEISQ+FGE+
Sbjct: 2   NPLKQEIAAAIAHDGPMTLEHFMSLCLGHPLHGYYMTRDPFGAGGDFITAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++   AW   G PS  RL+ELGPGRG +M D+LRV  ++ P F   ++ ++VE S  L
Sbjct: 62  IGVWASEAWRAAGSPSPARLIELGPGRGTLMSDVLRV-ARISPQFLDAITAHLVEMSPAL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             IQ++ LAS    ++W T  A  P G  F++ANEFFD+LP++ FV T  G RER++ +D
Sbjct: 121 RDIQRQTLASAAKPVDWATDFAHTPHGPAFILANEFFDALPVRHFVKTIGGWRERLVGLD 180

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
               L F + D  ++      +    G+I E  P   R M  I+ RL  +GG  +VIDYG
Sbjct: 181 AGAELAFGLSD-RVEPTLTAAARE--GSIIEVCPAGQRLMGDIAARLVAEGGAMLVIDYG 237

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           Y Q+ +GD+LQAV  HTYV PL  PG+ADL++HVDF  L   A      + G  TQ  FL
Sbjct: 238 YTQTSLGDSLQAVARHTYVDPLSAPGEADLTAHVDFAALGRAARAQGAKVMGPVTQAHFL 297

Query: 303 EGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             LGI +RA SL K+    + + +  +  RL  T   ++ MG LFK++ V+H  +  +P
Sbjct: 298 LQLGIERRAQSLSKKATAEQAEEIASAFDRLTGTQDPRRHMGALFKVMAVTHPDMPDLP 356


>gi|319781893|ref|YP_004141369.1| hypothetical protein Mesci_2167 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167781|gb|ADV11319.1| protein of unknown function DUF185 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 362

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/365 (43%), Positives = 226/365 (61%), Gaps = 11/365 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            +L  +IV+LI+  G + V++Y ALC+ DP  GYY+T  PFGA GDFVTAPEISQ+FGE+
Sbjct: 2   TRLKTRIVDLIEALGPLPVNEYMALCLFDPADGYYTTREPFGAGGDFVTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +A+++   W   G P  V + E+GPGRG +M D+LR + +L PD  +  +  M+ETS RL
Sbjct: 62  VAVWMYQVWAASGRPLPVTIAEIGPGRGTLMKDMLRTLSRLDPDLANGATFAMIETSPRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           T +QKK L      + W+ ++  +P    F+V NE FD++PI+QF+    G RERM+ +D
Sbjct: 122 TEVQKKTLGVTPFAVGWHETIETLPQQSLFIVGNELFDAVPIRQFIRAGAGWRERMVGLD 181

Query: 183 QHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           + + L F  G   +    L    +D   GAI E +P R   M +I++R++  GG  + +D
Sbjct: 182 ETNDLCFFAGAGSVDPTLLPADAADAPQGAIAEVAPARTALMATIAERISRHGGAGLFLD 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG+ Q  VGDTLQA++ H +   L NPG+ADL+SHVDF  L++IA  + L  + LTTQG 
Sbjct: 242 YGHFQPGVGDTLQALRSHDHEDVLANPGEADLTSHVDFAALAAIARAHGLEAH-LTTQGD 300

Query: 301 FLEGLGIWQRAFSL---MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
           FL G+GI +RA  L     Q AR+ I  D V+RL    A  ++MGELFK+L V    V +
Sbjct: 301 FLLGMGILERAGRLGADAGQAARERIAGD-VERL----AGPQAMGELFKVLAVLPRGVAV 355

Query: 358 MPFVN 362
            PF  
Sbjct: 356 RPFAE 360


>gi|260467107|ref|ZP_05813286.1| protein of unknown function DUF185 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029119|gb|EEW30416.1| protein of unknown function DUF185 [Mesorhizobium opportunistum
           WSM2075]
          Length = 362

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 222/365 (60%), Gaps = 11/365 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            +L  +IV+LI+  G + V++Y ALC+ DP  GYY+T  PFGA GDF+TAPEISQ+FGE+
Sbjct: 2   TRLKTRIVDLIEATGPIPVNEYMALCLFDPADGYYTTREPFGAAGDFITAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +A++L  AW   G P  V + E+GPGRG +M D+LR + +L+PD  +  +  MVETS RL
Sbjct: 62  VAVWLYQAWAAIGRPMPVTIAEIGPGRGTLMKDMLRTLSRLEPDLANGAAFAMVETSPRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             IQK+ L++    + W+ ++  +P     +V NE FD++PI+QFV    G RERM+ +D
Sbjct: 122 AEIQKQTLSATPFAVGWHETIDTLPRQPLLIVGNELFDAVPIRQFVRAGSGWRERMVGLD 181

Query: 183 QHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
             D L F  G   +    L     +   GAI E +P R   M +I+ R++  GG  +  D
Sbjct: 182 DKDELCFFAGAGSVDPTLLPADAGEAPQGAIAEVAPARSALMAAIAARISSHGGAGLFPD 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG+L+  VGDTLQA++ H +   L NPG+ADL+SHVDF  L++I   + L  + L+ QG 
Sbjct: 242 YGHLRPGVGDTLQALRKHNHEDVLANPGEADLTSHVDFAALAAIVRAHGLDAH-LSRQGD 300

Query: 301 FLEGLGIWQRAFSL---MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
           FL G+GI +RA  L     Q AR  I  D V+RL    A  ++MG+LFK+L +    V +
Sbjct: 301 FLLGMGILERAGRLGADAGQAARDKIASD-VERL----AGPQAMGDLFKVLAIVPRGVTI 355

Query: 358 MPFVN 362
            PF  
Sbjct: 356 RPFAT 360


>gi|110634500|ref|YP_674708.1| hypothetical protein Meso_2151 [Mesorhizobium sp. BNC1]
 gi|110285484|gb|ABG63543.1| protein of unknown function DUF185 [Chelativorans sp. BNC1]
          Length = 358

 Score =  295 bits (756), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 155/362 (42%), Positives = 212/362 (58%), Gaps = 9/362 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            +L  +I+ LI+  G M +D Y ALC+ DP+ GYY+T  PFGA GDF TAPE+SQ+FGE+
Sbjct: 2   TRLHERILRLIEATGPMGIDAYMALCLFDPDDGYYTTREPFGAAGDFTTAPEVSQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +A++L  AW+  G P      E+GPGRG +M DILR + KL P   S     M+E S RL
Sbjct: 62  VAVWLYAAWKACGTPDSPLFAEIGPGRGTLMKDILRTLSKLDPQLVSTHRFAMIEVSPRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           T IQKK L     K  W++ + D+P G  F+V NE FD++PIK++V T  G RER++   
Sbjct: 122 TAIQKKTLEEAQAKPAWFSRVEDLPDGPLFIVGNELFDAVPIKEYVKTPAGWRERVVGHT 181

Query: 183 QHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
              +L F IG   +  + L         G IFE +P R+  M  I++RL+   G  + ID
Sbjct: 182 DDGALAFGIGPGALDPSLLPKDAEQAPEGTIFETAPAREALMDVIAERLSRQFGAGLFID 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YGY    +GDTLQAV+ H Y  PL +PG+ADL++HVDF  L S+A  + L    L  QG+
Sbjct: 242 YGYSDPALGDTLQAVRRHAYDDPLAHPGEADLTAHVDFAALGSVARTHGLETR-LMPQGE 300

Query: 301 FLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           FL  LG+ +RA  L   K    +  +   V+RL    A  + MGELFK + V    +E+ 
Sbjct: 301 FLLDLGLLERAGRLGAGKSAEEQQRIRGEVERL----AGPQEMGELFKAMAVLPVGIEVP 356

Query: 359 PF 360
           PF
Sbjct: 357 PF 358


>gi|296447398|ref|ZP_06889324.1| protein of unknown function DUF185 [Methylosinus trichosporium
           OB3b]
 gi|296255101|gb|EFH02202.1| protein of unknown function DUF185 [Methylosinus trichosporium
           OB3b]
          Length = 359

 Score =  288 bits (738), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 147/359 (40%), Positives = 218/359 (60%), Gaps = 7/359 (1%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +I+ +I++ G +T+++Y ++ +A P  GYY T +PFGA GDF+TAPEISQ+FGE+
Sbjct: 2   SALRDEIIAMIEQEGPITLERYMSIALAHPTLGYYMTRDPFGAGGDFITAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L ++   AW   G PS V+L+ELGPGRG +M D+LRV  ++ P F     +++VETS  L
Sbjct: 62  LGLWAQEAWRAAGSPSPVQLIELGPGRGTLMSDVLRV-ARIAPSFLFSSEVHLVETSPVL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q++ LA     ++W   +A +P G   ++ANEFFD+LP++ +V T  G  ER++ +D
Sbjct: 121 EAAQRRTLAE-ATNVSWSADIAAIPPGPAIILANEFFDALPVRHYVRTARGWSERLLGLD 179

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
              +L F +G  E     LT  D   G+I E      R M  I+ RL   GG  +VIDYG
Sbjct: 180 DAGALAFGVG--EAIEPGLTV-DAPEGSIIEIGAVGARLMSEIAARLVAHGGAMLVIDYG 236

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           Y Q+ +G++LQAV  H YV PL  PG+ADL++HVDF  L+  A      + G  TQG FL
Sbjct: 237 YTQTALGESLQAVARHAYVDPLEAPGEADLTAHVDFAALARAATAAGARVQGPVTQGAFL 296

Query: 303 EGLGIWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             LG+ QRA +L K+   +    +  +++RL      K+ MGELFK++ V+H  +  +P
Sbjct: 297 TNLGVVQRAEALQKRATPEQAADIAAALQRLTGADDHKRDMGELFKVMAVTHPAMPELP 355


>gi|319408906|emb|CBI82563.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 362

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 155/362 (42%), Positives = 214/362 (59%), Gaps = 9/362 (2%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  KI  +I  NG +TV QY  L + DP+FGYY T  PFG+ GDF+TAPEISQ+FGEM+ 
Sbjct: 4   LKEKIKEIIAANGPITVSQYMTLALTDPQFGYYQTQEPFGSTGDFITAPEISQLFGEMIG 63

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I++  +W+  G P+   L E+GPGRG +M D+LR I KL    F+   I++VE S+RL  
Sbjct: 64  IWVFASWKAQGSPNPFILAEIGPGRGTLMDDVLRTIQKLCKTAFNAAEIFLVEISQRLAT 123

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
            QKK+L+SY   I+       +P G  FL+ANE FD+LPI Q++      RER I +DQ 
Sbjct: 124 EQKKRLSSYQKHIHTIEHFNQIPSGPLFLIANELFDALPIHQYIKINGEWRERCITLDQD 183

Query: 185 DSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
               F  G H+  S  L   C+    G I+E +P R++ MQ IS+RL  D G+A++IDYG
Sbjct: 184 GHFTFIAGAHKFSSGDLPVYCAQMPDGTIWEYAPLRNQLMQQISNRLIQDKGSALLIDYG 243

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
                 GDTLQA+  H +     NPG+ DL+SHVDF  L +IA+    +   L  QG FL
Sbjct: 244 ASDCAFGDTLQAISKHKFRDVFANPGENDLTSHVDFFTLKTIALQEGCFAEIL-EQGDFL 302

Query: 303 EGLGIWQRA--FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
             +GI +RA   S+ K T  ++ +   ++RLVS       MG+LFK+L VS +   +  F
Sbjct: 303 VKMGILERAKQLSINKDTLIQNKIRQDIERLVSPD----QMGKLFKVLHVSDQSTTISNF 358

Query: 361 VN 362
            +
Sbjct: 359 FD 360


>gi|13472396|ref|NP_103963.1| hypothetical protein mlr2680 [Mesorhizobium loti MAFF303099]
 gi|14023142|dbj|BAB49749.1| mlr2680 [Mesorhizobium loti MAFF303099]
          Length = 362

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 155/364 (42%), Positives = 220/364 (60%), Gaps = 9/364 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            +L  +IV+LI   G + V++Y A+C+ DP  GYY+T  PFGA GDFVTAPEISQ+FGE+
Sbjct: 2   TRLKTRIVDLIDALGPLPVNEYMAMCLFDPADGYYTTREPFGAAGDFVTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +A++L  AW     P  V + E+GPGRG +M D+LR + +L P   +     M+ETS RL
Sbjct: 62  VAVWLYQAWAAIARPMPVTIAEIGPGRGTLMKDMLRTLSRLDPALANGAVFAMIETSPRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             IQK+ L +    + W+ ++  +P     +V NE FD++PI+QFV T  G RERM+ +D
Sbjct: 122 AEIQKQTLGATPFAVRWHETIETLPDQPLLIVGNELFDAVPIRQFVRTATGWRERMVSLD 181

Query: 183 QHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
             D L F  G   I    L    ++   GAI E +P R   M +I+ R+A +GG  + +D
Sbjct: 182 DKDELRFFAGAGSIDPTLLPLDAAEAPQGAIVEVAPARAALMAAIAGRMARNGGAGLFLD 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG+LQ  VGDTLQA++ H +   L NPG+ADL+SHVDF  L++    + L ++ L+TQG 
Sbjct: 242 YGHLQPGVGDTLQALRRHNHEDVLANPGEADLTSHVDFAALAATVRAHGLDVH-LSTQGS 300

Query: 301 FLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           FL G+GI +RA  L      A +D +   V+RL    A  ++MGELFK+L V    V + 
Sbjct: 301 FLLGMGILERAGRLGADGDQAARDKITGEVERL----AGPQAMGELFKVLAVLPRGVPIR 356

Query: 359 PFVN 362
           PF  
Sbjct: 357 PFAT 360


>gi|328542815|ref|YP_004302924.1| ATP synthase beta subunit/transription termination factor rho
           [polymorphum gilvum SL003B-26A1]
 gi|326412561|gb|ADZ69624.1| ATP synthase beta subunit/transription termination factor rho
           [Polymorphum gilvum SL003B-26A1]
          Length = 364

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 149/364 (40%), Positives = 211/364 (57%), Gaps = 16/364 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGAVGDFVTAPEISQIFGE 61
           ++LIR+I       G +TV  Y A C+ DP+ GYY+T   PFG  GDF+TAPE+SQ+FGE
Sbjct: 8   DRLIRRIA----LYGPITVADYMAACLGDPDHGYYTTAAEPFGRAGDFITAPEVSQMFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++  + + AW+  G P+ VRLVELGPGRG +M D+LR    L+PDF +  ++++VETS R
Sbjct: 64  LIGAWTVAAWQAMGAPASVRLVELGPGRGTLMADLLRT-AALRPDFLAAATLHLVETSPR 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L  +Q K LA       W+  L DVP G   LVANEFFD+LPI Q+V T  G RER + +
Sbjct: 123 LGAVQAKTLAGAALAPIWHDRLDDVPDGPLLLVANEFFDALPIHQYVRTPTGWRERCVGL 182

Query: 182 DQHDSLVFNIG-----DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
            +  SL F IG     D  I        D   GAI E +P      + I  RL   GG A
Sbjct: 183 SEEGSLAFGIGVARLPDTAIPGTARAAPD---GAILETAPMAAGIARRIGARLKAQGGAA 239

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           +++DYG++ +  GDTLQA++ H +   L +PG ADL++HVDF+ L+  A     +  G  
Sbjct: 240 LIVDYGHMHTAPGDTLQALRRHAHDDVLASPGVADLTAHVDFESLAQAARDGGAHSFGPL 299

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
            QG FL  LG+ +RA +L     +   + + ++  V   A  + MG LFK+L ++  +  
Sbjct: 300 EQGDFLLRLGLLERAGAL--GAGKSPDVQERIRADVERLAAPERMGSLFKVLALTDGRFV 357

Query: 357 LMPF 360
            +PF
Sbjct: 358 PVPF 361


>gi|90422923|ref|YP_531293.1| hypothetical protein RPC_1412 [Rhodopseudomonas palustris BisB18]
 gi|90104937|gb|ABD86974.1| protein of unknown function DUF185 [Rhodopseudomonas palustris
           BisB18]
          Length = 375

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 146/355 (41%), Positives = 212/355 (59%), Gaps = 14/355 (3%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I  LIK  G M V +Y  LC+  PEFGYY + +P G  GDF TAPE+SQ+FGE+L ++  
Sbjct: 11  IKKLIKSAGPMPVWRYMELCLTHPEFGYYVSRDPLGREGDFTTAPEVSQMFGELLGLWAA 70

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
             W   G P  VRL+E GPGRG MM D LR + ++ P  F  L ++++E +  L   QK 
Sbjct: 71  SVWRSIGSPQLVRLIEFGPGRGTMMADALRAL-RVVPPLFQALHVHLIEINPVLREKQKA 129

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            LA     ++W+ SL +VP G T + ANE+FD LPI Q V  EHG  ER ++ID  + LV
Sbjct: 130 TLAG-AQNLHWHASLDEVPGGSTIIFANEYFDVLPIHQMVRGEHGWHERTVEIDAAERLV 188

Query: 189 FNIGDHEIKSNFLTCSDYFL-----GAIFENSPCRDREMQSISDRLACDGGTAIVIDYGY 243
           F +    +  +F       +     GA+FE  P  D E+  I+ R+  +GG A++IDYG+
Sbjct: 189 FGVAPEPV-PHFEQLLPPLVRAAPQGAVFEWRP--DAEIMKIASRVRDEGGAALIIDYGH 245

Query: 244 LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLE 303
            +S  GDT QA+  H++  PL NPG+AD+++HVDFQ L+  A      ++G  TQG+FL+
Sbjct: 246 PRSDAGDTFQAIARHSFADPLQNPGRADVTAHVDFQALARGAQDVGARVHGPVTQGEFLK 305

Query: 304 GLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
            LGI  RA +LM + + +  + +  ++KRLV     +  MG +FK++ VS  ++E
Sbjct: 306 RLGIENRAVALMAKASLEVSEDVASALKRLV--EGGRGGMGSMFKVMAVSEPEIE 358


>gi|118591907|ref|ZP_01549302.1| hypothetical protein SIAM614_20945 [Stappia aggregata IAM 12614]
 gi|118435550|gb|EAV42196.1| hypothetical protein SIAM614_20945 [Stappia aggregata IAM 12614]
          Length = 362

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 146/357 (40%), Positives = 211/357 (59%), Gaps = 9/357 (2%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           +I   I   G ++V QY ++C+ DP+ GYY T  PFG+ GDF+TAPE+SQ+FGE++    
Sbjct: 7   RIKARIATEGPLSVAQYMSVCLGDPDAGYYMTREPFGSEGDFITAPEVSQMFGELIGAAC 66

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           + AW+  G P+  +LVELGPGRG +M D+LR +  L+P F     + MVETS RL  IQ 
Sbjct: 67  LSAWQALGEPAEFQLVELGPGRGTLMADLLR-MASLRPAFIKAARLNMVETSPRLREIQT 125

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L+      ++     DVP G   LVANEFFD+LPI QFV T  G +ER I + Q   L
Sbjct: 126 ATLSRGPLTPHFRNRFQDVPGGPLILVANEFFDALPIHQFVKTARGWQERQIGLSQDGEL 185

Query: 188 VFNIGDHEIKSNFLTC--SDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ 245
           +F +G   +  + +    S    GAIFE  P  +   + I  R+A +GG AI+IDYGYL 
Sbjct: 186 MFGVGTARLPDDAIPADLSSAPEGAIFETQPAANAIAEEIGHRIAGNGGAAILIDYGYLN 245

Query: 246 SRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGL 305
           +  GDTLQA+  H Y   L +PG+ADL++HV+F+ L++  +          TQG+FL   
Sbjct: 246 TAAGDTLQALYKHAYDDVLAHPGEADLTAHVNFEALAAATVRAGAQALAPLTQGEFLLRS 305

Query: 306 GIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
           G+ +RA +L   K  + ++ + D+V+RL +       MG+LFK+L V++  +   PF
Sbjct: 306 GLLERAGALGAGKSHSEQEAIRDAVERLAAPG----QMGDLFKVLAVTNSGISFPPF 358


>gi|239832410|ref|ZP_04680739.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824677|gb|EEQ96245.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 364

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 207/365 (56%), Gaps = 11/365 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           E+ L  ++  LI  +G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE
Sbjct: 3   ESSLKDRLKRLIAASGPISVADYMAACLGDREAGYYTTREPFGRDGDFITAPEVSQMFGE 62

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ I+ +  W+  G P  V L E+GPGRG +M D+LR I +L P       I MVETS R
Sbjct: 63  LIGIWCVSEWDALGRPDNVVLCEIGPGRGTLMSDMLRTIGRLAPQMLGAARIAMVETSPR 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   QK++LA  G KI+W+   +D+  G   LV NE FD++P +QFV       ERMI +
Sbjct: 123 LVERQKEKLAGAGVKIDWFERFSDIADGPLILVTNELFDAIPFRQFVKVGGRFVERMIAL 182

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAIV 238
           D  D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+ 
Sbjct: 183 DDKDEFHFVSGLGGIDPALLP-QDHATAEEGAIFEAAPARTALMQEIASRIATTRGAALN 241

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+L+S  GDTLQA+  H++     +PG+ADL+SHVDF  L   A        G  TQ
Sbjct: 242 IDYGHLESGFGDTLQAMLKHSFDDVFAHPGEADLTSHVDFDMLEKAARASNCK-TGTMTQ 300

Query: 299 GKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L +S    +
Sbjct: 301 GEFLLAMGLIDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAISDSDTK 356

Query: 357 LMPFV 361
           L+PF 
Sbjct: 357 LIPFA 361


>gi|49473977|ref|YP_032019.1| hypothetical protein BQ03330 [Bartonella quintana str. Toulouse]
 gi|49239480|emb|CAF25833.1| hypothetical protein BQ03330 [Bartonella quintana str. Toulouse]
          Length = 363

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 214/359 (59%), Gaps = 9/359 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  KI  +I  NG + V QY  L + DP+FGYY T  PFG  GDF+TAPEISQ+FGEM
Sbjct: 2   DTLKEKIEEIIALNGPIPVSQYITLALTDPQFGYYQTQTPFGRAGDFITAPEISQLFGEM 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + I+ +  W+  G P    L E+GPGRG +M DILR I KL P  F    I+++E S++L
Sbjct: 62  IGIWALANWKVQGCPHPFILAEIGPGRGTLMDDILRTIQKLSPKAFDAAEIFLIEISKKL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
            + Q+++L+SY  +I+   + + +PL   FL+ANEFFD+LPI Q++      +ER I ++
Sbjct: 122 AVEQQERLSSYQKQIHSIENFSQIPLSPLFLIANEFFDTLPINQYIKINGEWKERRITVN 181

Query: 183 QHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           Q  + +F    H + S +L  + S+   G IFE++P R + MQ ISDRL    G+A++ID
Sbjct: 182 QDGNFMFIATPHTLPSYYLQFSLSEVPDGTIFEHAPSRYQFMQQISDRLVQIKGSALLID 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG      GDTLQA+  H +      PG+ DL+SHVDF  L +IA+    +   +  QG 
Sbjct: 242 YGSSDLAFGDTLQALSKHRFRDIFEAPGEHDLTSHVDFSFLKTIALEQGCFAE-ILEQGD 300

Query: 301 FLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
           FL  +G+ +RA  L   K  A +D +   VKRL    A    MG+LFK+L V+ + + L
Sbjct: 301 FLFTMGLLERARQLGVNKSAALQDKICQDVKRL----AGPDQMGKLFKVLHVNDKNIPL 355


>gi|121602661|ref|YP_989273.1| hypothetical protein BARBAKC583_0995 [Bartonella bacilliformis
           KC583]
 gi|120614838|gb|ABM45439.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 366

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 151/361 (41%), Positives = 211/361 (58%), Gaps = 9/361 (2%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  KI  +I   G +TV Q+ +L + D +FGYY T  PFG  GDF+TAPEISQ+FGEM+ 
Sbjct: 4   LKHKIQKIIALEGPITVSQFMSLVLTDSQFGYYQTQTPFGRTGDFITAPEISQLFGEMIG 63

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I++I  WE  G P    L E+GPGRGI+M D+LR I KL    F+   I++VE S+ L  
Sbjct: 64  IWIIANWEAQGCPHPFILAEIGPGRGILMDDVLRTIQKLCITAFNAAEIFLVEISQNLAT 123

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
            QKK+L+SY  KI+   S   +P G   L+ANE FD+LPI Q++  +   RER+I ++  
Sbjct: 124 EQKKRLSSYQKKIHNIESFDQIPPGLLILIANELFDALPIHQYIKIDGEWRERLITLNPS 183

Query: 185 DSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
             L+F    H++ S  L   C++   G I+E +P R++ MQ IS RL    G+A++IDYG
Sbjct: 184 GHLIFIADSHKLSSESLPNYCAEMPDGTIWEYAPLRNQLMQKISSRLMQTQGSALLIDYG 243

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
                 GDTLQA+  H +      PG+ DL+SHVDF  L  IA L K     +  QG FL
Sbjct: 244 ASDIAFGDTLQAISKHQFRDIFSAPGEHDLTSHVDFFSLKEIA-LQKGCFATILEQGDFL 302

Query: 303 EGLGIWQRA--FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
             +GI +RA   S  K  A ++ +   ++RL S +     MG+LFK+L  S + + L  F
Sbjct: 303 FKMGILERAKKLSSHKNVAIQNKIHQDIERLTSPN----QMGKLFKVLYASDKNIPLFSF 358

Query: 361 V 361
           +
Sbjct: 359 L 359


>gi|27382556|ref|NP_774085.1| hypothetical protein blr7445 [Bradyrhizobium japonicum USDA 110]
 gi|27355728|dbj|BAC52710.1| blr7445 [Bradyrhizobium japonicum USDA 110]
          Length = 371

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 145/361 (40%), Positives = 211/361 (58%), Gaps = 14/361 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           E  L+ +I  LIK +G M V +Y  LC+  P +GYY + +P G  GDF TAPE+SQ+FGE
Sbjct: 3   EQPLLNEIKALIKSSGPMPVWRYMELCLMHPRYGYYVSRDPLGREGDFTTAPEVSQMFGE 62

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L ++    W+Q G P  +RL+ELGPGRG MM D LR + ++ P  +  L I++VE +  
Sbjct: 63  LLGLWTASVWKQMGSPQSLRLIELGPGRGTMMADALRAL-RVLPPLYQALQIHLVEVNPV 121

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q   L S    + W+ S+ DVP G + ++ANE+FD LPI Q V  E+G  ER+I+I
Sbjct: 122 LRERQSATL-SGARNVAWHDSIDDVPEGPSIILANEYFDVLPIHQMVKRENGWHERVIEI 180

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQSISDRLACDGGTAI 237
           D +  L F           +          +GA+FE  P  D E+  ++ R+    G A+
Sbjct: 181 DPNGKLQFGAASEPTPRFDVLLPPLVRAAPVGAVFEWRP--DGEVMKLATRVRDQDGAAL 238

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           +IDYG+L+S  GDT QA+  HT+  PL  PGQAD+++HVDFQ L+  A      ++G  T
Sbjct: 239 IIDYGHLRSDAGDTFQAIARHTFTDPLKAPGQADVTAHVDFQALARAAEDVGARVHGPVT 298

Query: 298 QGKFLEGLGIWQRAFSLMKQTARKDILLD---SVKRLVSTSADKKSMGELFKILVVSHEK 354
           QG FL+ +GI  RA +LM Q A  ++  D   ++KRL  T   +  MG +FK+L +S  +
Sbjct: 299 QGDFLKRVGIDTRAAALM-QKATPEVATDISVALKRLTDTG--RSGMGSMFKVLGISEPR 355

Query: 355 V 355
           +
Sbjct: 356 L 356


>gi|153008968|ref|YP_001370183.1| hypothetical protein Oant_1638 [Ochrobactrum anthropi ATCC 49188]
 gi|151560856|gb|ABS14354.1| protein of unknown function DUF185 [Ochrobactrum anthropi ATCC
           49188]
          Length = 363

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 204/356 (57%), Gaps = 5/356 (1%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           ++  LI  +G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ I+ 
Sbjct: 9   RLKRLIATSGPISVADYMAACLGDRESGYYTTREPFGRDGDFITAPEVSQMFGELIGIWC 68

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           +  W+  G P  + L E+GPGRG +M D+LR I +L P     + + MVETS RL   QK
Sbjct: 69  VSEWDALGRPDNIVLCEIGPGRGTLMSDMLRTIGRLAPQMLGHVRVAMVETSPRLAEKQK 128

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
           ++L+  G KI+W+   +++  G   LV NE FD++P +QFV  +    ERMI +D+    
Sbjct: 129 EKLSDAGAKIDWFERFSNIADGPLILVTNELFDAIPFRQFVKVDGRFVERMIALDEKGEF 188

Query: 188 VFNIGDHEIKSNFLTC--SDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ 245
            F  G   I    L    ++   GAIFE +P R   MQ I+ R+A   G A+ IDYG+L+
Sbjct: 189 HFVSGLGGIDPALLPAGHAEAPEGAIFEAAPARTALMQEIASRIATTRGAALNIDYGHLK 248

Query: 246 SRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGL 305
           +  GDTLQA+  H +     NPG ADL+SHVDF  L   A        G+TTQG+FL  +
Sbjct: 249 AGFGDTLQAMLKHGFDDVFANPGIADLTSHVDFDILDKTARASGCK-TGMTTQGEFLLAM 307

Query: 306 GIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFV 361
           G+  RA  L   T +     + +++ V   A    MG LFK+L +S    +L+PF 
Sbjct: 308 GLLDRAGRL--GTGKDAAFQEKIRQDVERLAAPDQMGTLFKVLAISDSDTKLIPFA 361


>gi|86751272|ref|YP_487768.1| hypothetical protein RPB_4165 [Rhodopseudomonas palustris HaA2]
 gi|86574300|gb|ABD08857.1| Protein of unknown function DUF185 [Rhodopseudomonas palustris
           HaA2]
          Length = 376

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 214/360 (59%), Gaps = 12/360 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           ++ L+ +I  LI+  G M V +Y  LC+A PE+GYY + +P G  GDF T+PEISQ+FGE
Sbjct: 4   DSPLLAEIKRLIETAGPMPVWRYMELCLAHPEYGYYVSRDPLGREGDFTTSPEISQMFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ ++    W+  G P  +RL+E+GPGRG M+ D LR + ++ P  +  LS+++VE +  
Sbjct: 64  LIGLWTASVWKAVGEPGVLRLIEIGPGRGTMIADALRAL-RVLPPLYQSLSVHLVEINPV 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q+  LA     ++W+   A+VP G   ++ANE+FD LPI Q V  + G  ER+I+I
Sbjct: 123 LRAKQQATLAGI-RNVHWHEDFAEVPEGPAVVLANEYFDVLPIHQAVKRDGGWHERVIEI 181

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQSISDRLACDGGTAI 237
                LVF + D  I    +           G +FE  P  D E+ +I+ RL   GG A+
Sbjct: 182 SASGDLVFGVADDPIPRFEVLLPPLVQMAPAGTVFEWRP--DNEIMAIAARLRDQGGAAL 239

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           +IDYG+++S VGDT QA+  H++  PL +PG ADL++HVDFQ L   A      I+G  T
Sbjct: 240 IIDYGHVRSDVGDTFQAIARHSFADPLQHPGGADLTAHVDFQALGRAAETIGARIHGPVT 299

Query: 298 QGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL+ LGI  RA SLM + + +  + +  ++KRL  T   +  MG +FK++ VS   +
Sbjct: 300 QGEFLKRLGIETRALSLMAKASAQVSEDIAGALKRL--TGEGRGGMGAMFKVIGVSDPSI 357


>gi|154246490|ref|YP_001417448.1| hypothetical protein Xaut_2549 [Xanthobacter autotrophicus Py2]
 gi|154160575|gb|ABS67791.1| protein of unknown function DUF185 [Xanthobacter autotrophicus Py2]
          Length = 368

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 143/368 (38%), Positives = 207/368 (56%), Gaps = 19/368 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L ++I  LI   G M + +Y ALC+  P  GYY T +P GA GDF TAPEISQ+FG
Sbjct: 1   MTTPLSKEISALIAAEGPMPLSRYMALCLGHPRHGYYMTRDPLGARGDFTTAPEISQMFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+L ++ +  W+  G P   RLVELGPGRG +M D LR   +L PDF +   I++VETS 
Sbjct: 61  ELLGLWAVAQWQAMGSPPAFRLVELGPGRGTLMADALRA-ARLVPDFGAAARIHLVETSP 119

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            L   Q + LA++ D+++W+  + +VP G   ++ANEFFD+LPI Q+V       ER + 
Sbjct: 120 VLRAAQARTLAAHADRVSWHDRVEEVPDGPALVLANEFFDALPIDQYVFHAGHWHERRVG 179

Query: 181 IDQHDSLVFNIGDHEIK------SNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGG 234
           +D    LV  +     +      ++    ++  +    E+ P R     ++S+RL   GG
Sbjct: 180 LDDGGRLVLGLDPAPSRAAPAFAAHLPPPAEGVVLEHLESGPAR-----ALSERLKTQGG 234

Query: 235 TAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
            A++IDYG+     GDT QA++ H +  PL  PG ADL++HVDF  L+ I     L   G
Sbjct: 235 AALIIDYGHAGG-YGDTFQALEQHRFADPLAAPGNADLTAHVDFSALARIGRAAGLRAFG 293

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQTARKDILLD---SVKRLVSTSADKKSMGELFKILVVS 351
              QG FL  LG+ QRA  L K+ A  ++      + +RL    A +  MG LFK+LV++
Sbjct: 294 PLEQGAFLARLGLAQRAERL-KRDATDELRAGVDAAARRLAGDGAGE--MGRLFKVLVLA 350

Query: 352 HEKVELMP 359
           H ++ L P
Sbjct: 351 HPEIGLPP 358


>gi|254504952|ref|ZP_05117103.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222441023|gb|EEE47702.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 362

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 144/362 (39%), Positives = 211/362 (58%), Gaps = 9/362 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            +L  K+   I   G +TV  Y A C+ DPE+GYY+T  PFG  GDF+TAPE+SQ+FGE+
Sbjct: 2   TELKEKLRQQIAAEGPITVATYMARCLGDPEYGYYTTREPFGRKGDFITAPEVSQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +    + A+E  G PS  +LVELGPGRG +M D LRV    +P+F    ++ +VE S RL
Sbjct: 62  IGAVCLKAYETLGAPSNFQLVELGPGRGTLMADFLRVAFH-RPEFLEAATLNLVEISPRL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             +Q + L +     N+  +  DVP G   ++ANEFFD+LPI QFV T +G  ERM+ +D
Sbjct: 121 RQVQTQTLRNTQLPPNFRNTFQDVPDGPLIVIANEFFDALPIHQFVKTVNGWNERMVGLD 180

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIVID 240
               L F +G  ++ ++ +  +      G+I E  P  +   + I+ R+   GG A+ ID
Sbjct: 181 ASGRLEFGVGPAQLPTDAIPPAAMKAPEGSILETQPAANAVAEEIATRIVEHGGFALFID 240

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YGY Q+  GDTLQA+  H Y   L +PG+ADL++HV+F+ L++ A         L +QG 
Sbjct: 241 YGYAQTAPGDTLQALYRHAYNDVLAHPGEADLTAHVNFEALATAARRAGAVPLPLLSQGT 300

Query: 301 FLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           FL   G+ +RA +L   K  A +D + D+V+RL    A    MG+LFK+L ++ +     
Sbjct: 301 FLLQSGLLERAGALGAGKSPAEQDAIRDAVERL----AAPDQMGDLFKVLAIAPKGHVFA 356

Query: 359 PF 360
           PF
Sbjct: 357 PF 358


>gi|240850150|ref|YP_002971543.1| hypothetical protein Bgr_05410 [Bartonella grahamii as4aup]
 gi|240267273|gb|ACS50861.1| hypothetical protein Bgr_05410 [Bartonella grahamii as4aup]
          Length = 359

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 145/357 (40%), Positives = 207/357 (57%), Gaps = 5/357 (1%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  KI  +I  NG +TV QY  L + DP+FGYY T  PFG  GDF+TAPEISQ+FGEM+ 
Sbjct: 4   LKEKIKEIIALNGPITVSQYMTLALTDPQFGYYQTQTPFGRTGDFITAPEISQLFGEMIG 63

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+++ +W  HG P    L E+GPGRG +M D+LR I KL    F    ++++E S++L  
Sbjct: 64  IWVLASWNAHGCPRPFILAEIGPGRGTLMDDVLRTIQKLSTTAFESSEVFLLEISKKLAE 123

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
            QKK+L+SY  +I+   S   +P    FL+ANEF D+LPI Q++  +   RER I IDQ+
Sbjct: 124 EQKKRLSSYQKQIHSIESFDQIPSKPLFLIANEFLDTLPINQYIKIKGEWRERRITIDQN 183

Query: 185 DSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
               F    H++ S++L   CS    G IFE +P R + MQ IS  L    G+A++IDYG
Sbjct: 184 GDFTFIAALHKLPSSYLQTYCSKVPDGTIFEYAPLRHQFMQQISHHLVQVTGSALLIDYG 243

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
                 GDTLQA+  H +      PG+ DL+SHV F  L +IA+    +   +  QG FL
Sbjct: 244 AADLAFGDTLQALSKHRFRDIFDAPGEHDLTSHVGFSFLKNIALEQGCFAE-IFEQGDFL 302

Query: 303 EGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             +G+ +RA  L     +   L D +++ +   A +  MG+LFK+L  S + + + P
Sbjct: 303 LKMGLLERAKQL--GVGKSAPLQDKIRQDIERLAGQDQMGKLFKVLHFSDKNISIPP 357


>gi|192293202|ref|YP_001993807.1| hypothetical protein Rpal_4843 [Rhodopseudomonas palustris TIE-1]
 gi|192286951|gb|ACF03332.1| protein of unknown function DUF185 [Rhodopseudomonas palustris
           TIE-1]
          Length = 379

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 211/364 (57%), Gaps = 14/364 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L  +I  LIK  G M V +Y  LC+  PE GYY T +P G  GDF T+PEISQ+FGE
Sbjct: 4   QTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L ++    W+    P  +RL+E+GPGRG MM D LR + ++ P  +  LS+++VE +  
Sbjct: 64  LLGLWSASVWKAADEPQTLRLIEIGPGRGTMMADALRAL-RVLPILYQSLSVHLVEINPV 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q+  LA   + I+W+ S  DVP G   ++ANE+FD LPI Q +  E G  ER+I+I
Sbjct: 123 LRQKQQTLLAGIRN-IHWHDSFEDVPEGPAVILANEYFDVLPIHQAIKRETGWHERVIEI 181

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFL-----GAIFENSPCRDREMQSISDRLACDGGTA 236
                LVF +    I   F       +     GA+FE  P  D E+  I+ R+   GG A
Sbjct: 182 GASGELVFGVAADPI-PGFEALLPPLVRLSPPGAVFEWRP--DTEILKIASRVRDQGGAA 238

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           ++IDYG+L+S VGDT QA+  H+Y  PL +PG+ADL++HVDF  L   A       +G  
Sbjct: 239 LIIDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPV 298

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
           TQG FL+ LGI  RA SLM +   +  + +  +++RL  T   + +MG +FK++ VS  K
Sbjct: 299 TQGAFLKRLGIETRALSLMAKATPQVSEDIAGALQRL--TGEGRGAMGSMFKVIGVSDPK 356

Query: 355 VELM 358
           +E +
Sbjct: 357 IETL 360


>gi|75676687|ref|YP_319108.1| hypothetical protein Nwi_2503 [Nitrobacter winogradskyi Nb-255]
 gi|74421557|gb|ABA05756.1| Protein of unknown function DUF185 [Nitrobacter winogradskyi
           Nb-255]
          Length = 390

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 145/364 (39%), Positives = 213/364 (58%), Gaps = 18/364 (4%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L+  I  LIK +G + V +Y  LC+  PE GYY   +P G  GDFVT+PE+SQ+FGE+L
Sbjct: 21  PLLTYIKKLIKTSGPLPVWRYMQLCLTHPEHGYYIARDPLGREGDFVTSPEVSQMFGELL 80

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            ++    W   G P  +RL+ELGPGRG +M D LR + ++ P  +  LS++MVE +  L 
Sbjct: 81  GLWAASVWRMMGSPDPLRLIELGPGRGTLMADALRAL-RVLPPMYESLSVHMVEINPVLV 139

Query: 124 LIQKKQLASYGD--KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
              +KQ+A+  D   I W+TSL  VP G   ++ANE+FD LP+ Q V  + G  ER++DI
Sbjct: 140 ---EKQMAALSDAPNIEWHTSLDQVPQGPAIILANEYFDVLPVHQMVRRDGGWHERVVDI 196

Query: 182 DQHDSLVFNIGDHEIKSNF-----LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
           D    LVF +   E    F            +GAIFE  P  D EM SI+ R+  +GG A
Sbjct: 197 DGSGQLVFGV-SAEPTPRFDVLLPPLVRAAPVGAIFEWRP--DAEMMSIATRVRDNGGAA 253

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           ++IDYG+++S  GDT QA+  H++  PL  PG+ D+++HVDF+ L+  A      ++G  
Sbjct: 254 LIIDYGHVRSDAGDTFQAISRHSFADPLKYPGRVDVTAHVDFEALARAAEDVGARVHGPV 313

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
            QG+FL  LGI  RA +LM +   +  D +  ++KRL  T   +  MG +FK++ VS   
Sbjct: 314 PQGEFLRRLGIEARAVNLMAKATPELSDDIATALKRL--TEGGRGGMGSMFKVIGVSDPS 371

Query: 355 VELM 358
           + ++
Sbjct: 372 LSVL 375


>gi|299134263|ref|ZP_07027456.1| protein of unknown function DUF185 [Afipia sp. 1NLS2]
 gi|298591010|gb|EFI51212.1| protein of unknown function DUF185 [Afipia sp. 1NLS2]
          Length = 369

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/354 (40%), Positives = 201/354 (56%), Gaps = 13/354 (3%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
            LI   G M V +Y  LC+  PE+GYY   +P G  GDF TAPEISQ+FGE++ ++    
Sbjct: 15  QLIATAGPMPVSRYMQLCMTHPEYGYYVNRDPLGRGGDFTTAPEISQMFGELIGLWAASV 74

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL 130
           W   G P  V+L+ELGPGRG MM D LR I ++ P FF  + +++VE S  L  IQ+  L
Sbjct: 75  WNAMGMPEHVQLIELGPGRGTMMADALRAI-RILPAFFDAIDVHLVEVSPSLRAIQRDTL 133

Query: 131 ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFN 190
           A       W+  L+DVP G   ++ANE+FD LPI Q V  + G  ERM+D+D  D  VF 
Sbjct: 134 ADV-KPFQWHHLLSDVPDGPAIILANEYFDVLPIHQMVKKDTGWHERMVDVDD-DIFVFT 191

Query: 191 IGDHEIKSNFLTCSDYFL----GAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQS 246
                     ++   +      G IFE       E+ +++ R+   GG A++IDYG+++S
Sbjct: 192 TAPEPTPRFEVSVPPHVRNAPNGTIFEWR--ETNEIMALARRIREFGGAALLIDYGHIRS 249

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
             GDT QAV  H Y  PL  PG ADL++HVDFQ L+  A    +  +G   QG FL  LG
Sbjct: 250 DAGDTFQAVAKHKYTDPLRAPGTADLTAHVDFQALADAAQSMGVLAHGPVEQGTFLGHLG 309

Query: 307 IWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           I  RA +L+K +A +    +  ++KRLV +    K+MG LFK+L +SH  +  +
Sbjct: 310 IETRAQTLIKHSASQSAGDVASALKRLVESG--PKAMGSLFKVLGLSHPSIPAL 361


>gi|49475904|ref|YP_033945.1| hypothetical protein BH11810 [Bartonella henselae str. Houston-1]
 gi|49238712|emb|CAF27964.1| hypothetical protein BH11810 [Bartonella henselae str. Houston-1]
          Length = 359

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 208/359 (57%), Gaps = 9/359 (2%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +KI  +I  NG +TV QY  L + DP+FGYY T  PFG  GDF+TAPEISQ+FGEM+ 
Sbjct: 4   LKQKIKEMIALNGPITVSQYMTLALTDPQFGYYKTQTPFGRTGDFITAPEISQLFGEMIG 63

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+ HG P+   L E+GPGRG +M DILR I KL    F+   I+++E S++L  
Sbjct: 64  IWALANWKAHGCPAPFILAEIGPGRGTLMDDILRTIQKLSIKAFNAAEIFLIEISKKLAK 123

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
            QKK+LA Y  +I    +   +PL    L+ANEF D+LPI Q++      RER I ++Q+
Sbjct: 124 EQKKRLAPYQKEIYSIENFDQLPLKPLLLIANEFLDTLPINQYIKINGEWRERRITVNQN 183

Query: 185 DSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
              VF     +    FL   D  +  G IFE++P R + MQ IS+RL    G+A++IDYG
Sbjct: 184 GDFVFIAAPGKFSFPFLQFCDSEIPDGKIFEHAPSRHQFMQQISNRLIQVKGSALLIDYG 243

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
                 GDTLQA+  H +      PG+ DL++HV F  L  IA+    +   +  QG FL
Sbjct: 244 ASNLAFGDTLQALSKHRFRDIFDAPGEHDLTTHVGFSFLKKIALEQGCFAK-ILEQGDFL 302

Query: 303 EGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             +G+ +RA  L   K  A +D +   ++RL    A    MG+LFK+L VS++ + L P
Sbjct: 303 VKMGLLERAKQLAADKNAALQDKIHQDIERL----AGPDQMGKLFKVLHVSNQNIPLPP 357


>gi|316935878|ref|YP_004110860.1| hypothetical protein Rpdx1_4577 [Rhodopseudomonas palustris DX-1]
 gi|315603592|gb|ADU46127.1| protein of unknown function DUF185 [Rhodopseudomonas palustris
           DX-1]
          Length = 379

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 209/364 (57%), Gaps = 14/364 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L  +I  LIK  G M V +Y  LC+  PE GYY T +P G  GDF T+PEISQ+FGE
Sbjct: 4   QTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L ++    W+    P  +RL+E+GPGRG MM D LR + ++ P  +  LS+++VE +  
Sbjct: 64  LLGLWSASVWKAADEPQTLRLIEIGPGRGTMMADALRAL-RVLPILYQSLSVHLVEINPV 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q+  LA     I+W+ S  DVP G   ++ANE+FD LPI Q +  E G  ER+I+I
Sbjct: 123 LRQKQQTTLAGI-RNIHWHDSFDDVPEGPAVVLANEYFDVLPIHQAIKRETGWHERVIEI 181

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFL-----GAIFENSPCRDREMQSISDRLACDGGTA 236
                LVF +    I   F       +     GA+FE  P  D E+  I+ R+   GG A
Sbjct: 182 GSAGELVFGVAADPIP-GFEALLPPLVRLAPPGAVFEWRP--DAEILKIASRVRDQGGAA 238

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           ++IDYG+L+S VGDT QA+  H+Y  PL +PG+ADL++HVDF  L   A       +G  
Sbjct: 239 LIIDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESVGARAHGPV 298

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
           TQG FL  LGI  RA SLM +   +  + +  +++RL  T   + +MG +FK++ VS  K
Sbjct: 299 TQGTFLRRLGIETRALSLMAKATPQVSEDIAGALQRL--TGEGRGAMGSMFKVIGVSDPK 356

Query: 355 VELM 358
           +E +
Sbjct: 357 IETL 360


>gi|39937419|ref|NP_949695.1| hypothetical protein RPA4359 [Rhodopseudomonas palustris CGA009]
 gi|39651278|emb|CAE29800.1| DUF185 [Rhodopseudomonas palustris CGA009]
          Length = 379

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/363 (40%), Positives = 210/363 (57%), Gaps = 12/363 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L  +I  LIK  G M V +Y  LC+  PE GYY T +P G  GDF T+PEISQ+FGE
Sbjct: 4   QTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L ++    W+    P  +RL+E+GPGRG MM D LR + ++ P  +  LS+++VE +  
Sbjct: 64  LLGLWSASVWKAADEPQTLRLIEIGPGRGTMMADALRAL-RVLPILYQSLSVHLVEINPV 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q+  LA     I+W+ S  DVP G   ++ANE+FD LPI Q +  E G  ER+I+I
Sbjct: 123 LRQKQQTLLAGI-RNIHWHDSFEDVPEGPAVILANEYFDVLPIHQAIKRETGWHERVIEI 181

Query: 182 DQHDSLVFNIGDHEIKS-NFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
                LVF +    I     L      L   GA+FE  P  D E+  I+ R+   GG A+
Sbjct: 182 GASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRP--DTEILKIASRVRDQGGAAL 239

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           +IDYG+L+S VGDT QA+  H+Y  PL +PG+ADL++HVDF  L   A       +G  T
Sbjct: 240 IIDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVT 299

Query: 298 QGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG FL+ LGI  RA SLM +   +  + +  +++RL  T   + +MG +FK++ VS  K+
Sbjct: 300 QGAFLKRLGIETRALSLMAKATPQVSEDIAGALQRL--TGEGRGAMGSMFKVIGVSDPKI 357

Query: 356 ELM 358
           E +
Sbjct: 358 ETL 360


>gi|92118562|ref|YP_578291.1| hypothetical protein Nham_3094 [Nitrobacter hamburgensis X14]
 gi|91801456|gb|ABE63831.1| protein of unknown function DUF185 [Nitrobacter hamburgensis X14]
          Length = 375

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 142/357 (39%), Positives = 211/357 (59%), Gaps = 16/357 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L+  I  LIK +G + V +Y  LC+  PE GYY   +P G  GDF+T+PE+SQ+FGE+
Sbjct: 5   SPLLPDIKKLIKTSGPLPVWRYMQLCLTHPEHGYYIARDPLGREGDFITSPEVSQMFGEL 64

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++    W   G P+ +RL+ELGPGRG MM D LR + ++ P     LS+++VE +   
Sbjct: 65  IGLWAASVWRAMGSPTTLRLIELGPGRGTMMADALRAL-RVLPPMHQALSVHLVEIN--- 120

Query: 123 TLIQKKQLASYGDK--INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            ++++KQ A+  D   I W+ SL +VP G   ++ANE+FD LP+ Q V  + G  ER++D
Sbjct: 121 PVLREKQKAALSDARTIQWHASLDEVPQGPAIILANEYFDVLPVHQMVKRDDGWYERVVD 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQSISDRLACDGGTA 236
           ID    LVF                      +GAIFE  P  D EM +I+ R+   GG A
Sbjct: 181 IDGSGQLVFGTTAAPTPRFDALLPPLVRAAPVGAIFEWRP--DAEMMTIATRVRDHGGAA 238

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           ++IDYG+++S  GDT QA+ GH++  PL  PGQAD+++HVDFQ L+  A      ++G  
Sbjct: 239 LIIDYGHVRSDAGDTFQAIAGHSFADPLKYPGQADVTAHVDFQALARAAEDIGARVHGPV 298

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVS 351
           TQG+FL+ LGI  RA +LM +   +  + +  ++KRL  T   +  MG +FK + VS
Sbjct: 299 TQGEFLQRLGIEARAVNLMAKATPEISEGISTALKRL--TEGGRGGMGSMFKAIGVS 353


>gi|91978339|ref|YP_570998.1| hypothetical protein RPD_3876 [Rhodopseudomonas palustris BisB5]
 gi|91684795|gb|ABE41097.1| protein of unknown function DUF185 [Rhodopseudomonas palustris
           BisB5]
          Length = 376

 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 143/360 (39%), Positives = 215/360 (59%), Gaps = 14/360 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L+ +I  LIK  G M V +Y  LC+  P +GYY + +P G  GDF T+PEISQ+FGE+
Sbjct: 5   SPLLAEIKRLIKSTGPMPVWRYMELCLNHPLYGYYVSRDPLGREGDFTTSPEISQMFGEL 64

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++    W+  G P  +RL+E+GPGRG M+ D LR + ++ P  +  LS+++VE +  L
Sbjct: 65  IGLWAASVWKATGEPDVLRLIEIGPGRGTMIADALRAL-RVLPPLYQSLSVHLVEINPVL 123

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QK  LA     I+W+ + ADVP G   ++ANE+FD LPI Q V  + G  ER+I+I 
Sbjct: 124 REKQKATLAGI-RNIHWHDTFADVPDGPAVILANEYFDVLPIHQAVKRDGGWHERVIEIS 182

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYFL-----GAIFENSPCRDREMQSISDRLACDGGTAI 237
               LVF +    I   F     + +     GA+FE     D E+ +I+ RL   GG A+
Sbjct: 183 ASGELVFGVAPDPIP-RFDILLPHLVRMAPAGAVFEWR--SDAEIMAIATRLRDQGGAAL 239

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           +IDYG+++S VGDT QA+  H++  PL NPG+ADL++HVDFQ L   A      ++G  T
Sbjct: 240 IIDYGHIRSDVGDTFQAIARHSFADPLQNPGRADLTAHVDFQALGRAAEDVGARLHGPVT 299

Query: 298 QGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL+ LGI  RA SLM + + +  + +  +++RL  T   + +MG +FK++ VS   +
Sbjct: 300 QGEFLKRLGIETRALSLMAKASPQVSEDISGALRRL--TGEGRGAMGSMFKVIGVSDPNI 357


>gi|146342824|ref|YP_001207872.1| hypothetical protein BRADO6003 [Bradyrhizobium sp. ORS278]
 gi|146195630|emb|CAL79657.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 375

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 211/362 (58%), Gaps = 12/362 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +I  LIK +G M V +Y  LC+  PE GYY + +P G  GDF TAPE+SQ+FGE+
Sbjct: 5   SPLQPEIKRLIKASGPMPVWRYMELCLMHPEHGYYISRDPLGREGDFTTAPEVSQMFGEL 64

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L ++    W+  G P   RL+ELGPGRG MM D LR + ++ P  +  +S+++VE +  L
Sbjct: 65  LGLWAASIWKAAGSPQQFRLIELGPGRGTMMSDALRAL-RVLPPLYQTISVHLVEINPVL 123

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QK  L    + + W+ S  +VP G + + ANE+FD LP+ Q V  E G  ER++++D
Sbjct: 124 REKQKATLTGLRN-VTWHDSFDEVPEGPSVIFANEYFDVLPVHQMVRRETGWHERVVELD 182

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQSISDRLACDGGTAIV 238
             ++ V+           L  S        GAIFE  P  D +M +I+ RL    G A++
Sbjct: 183 DDENFVYGTAADPTPGFELLLSPLVRAAPAGAIFEWRP--DTQMMAIARRLREQRGAAVI 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+++S VGDT QA+  H++  PL  PG AD+++HVDF  LS  A      ++G  TQ
Sbjct: 241 IDYGHVRSDVGDTFQAIARHSFADPLKTPGLADITAHVDFDALSRTAEAVGARVHGPITQ 300

Query: 299 GKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G+FL+ LGI  RA +LM++ + +  + +   +KRL  TS  +  MG LFK+L VS   + 
Sbjct: 301 GEFLQRLGIETRALTLMQKASPEVSEDIASGLKRL--TSGGRGGMGSLFKVLGVSDPSIP 358

Query: 357 LM 358
           ++
Sbjct: 359 VL 360


>gi|254470484|ref|ZP_05083888.1| ATP synthase beta subunit/transription termination factor rho
           [Pseudovibrio sp. JE062]
 gi|211960795|gb|EEA95991.1| ATP synthase beta subunit/transription termination factor rho
           [Pseudovibrio sp. JE062]
          Length = 363

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 218/362 (60%), Gaps = 11/362 (3%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  KI   I  +G MTV +Y ALC++DPE GYY    PFGA GDF TAPEISQ+FGE++ 
Sbjct: 9   LQEKIKKRIADHGPMTVAEYMALCLSDPEHGYYMRQQPFGAKGDFTTAPEISQLFGELIG 68

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
            + +  W        V LVE+GPGRG +M DILRVI  L+P   + + I++VETS  L  
Sbjct: 69  AWFLHQWLSQDLKGPVHLVEMGPGRGTLMKDILRVIS-LRPQMLANIQIHLVETSPSLRK 127

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
            Q+K L +Y   I W+ +L  +P G T LVANE FD+LPI Q+ +T+ G RER + +D+ 
Sbjct: 128 AQRKLLKAY--SIKWHDTLETIPEGPTLLVANELFDALPIHQYQLTDTGWRERCVGLDED 185

Query: 185 DSLVFNIGDHEIKSNFLTCSDY--FLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
            +L F IG   +    +  ++    +G   E SP  +     I  RL  +GG A++IDYG
Sbjct: 186 GNLTFGIGSGTLSPADVAKANLQAKIGDTLELSPASNAIASQIGHRLKANGGAALLIDYG 245

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           Y ++  GDT QA+K H YVS L + G+ADL++HV+FQ L++ A       +G   QG+FL
Sbjct: 246 YAKTATGDTFQALKKHEYVSTLEHCGEADLTAHVNFQALANAAAAEGATAHGPIGQGQFL 305

Query: 303 EGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
            GLG+ +RA  L   K T  +D +   V+RL   +AD + MG LFK+L +S+   + +PF
Sbjct: 306 LGLGLLERAGQLGAGKSTLDQDQIRKDVERL---AADDQ-MGTLFKVLCISNTSEQPIPF 361

Query: 361 VN 362
            N
Sbjct: 362 QN 363


>gi|319405266|emb|CBI78880.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 374

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 208/362 (57%), Gaps = 9/362 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +I  +I  NG ++V QY AL + DP+FGYY    PFG  GDF+TAPEISQ+FGE+
Sbjct: 2   SNLKERIKEIIILNGPISVSQYMALALTDPQFGYYKKQKPFGHDGDFITAPEISQLFGEI 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + I+ I +W  HG P+   L E+GPGRG +M D+LR I K+    F+   I+++E S+RL
Sbjct: 62  IGIWAIMSWRAHGSPNSFILAEIGPGRGTLMDDVLRTIRKICMTAFNAADIFLIEISQRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QKK+L SY  +I    +   +PL    ++ANE FD+LPI Q++      RER I ++
Sbjct: 122 AAKQKKRLLSYQKQIYSIENFEQIPLKPLIIIANELFDALPINQYIKINEEWRERRITLN 181

Query: 183 QHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           Q     F I  H+  + FL   C+    G I E +P R++  Q IS RL    G+A++ID
Sbjct: 182 QEGDFTFTIDVHKFPATFLPPHCAQMPNGTIVEYAPLRNQLAQKISSRLMQTQGSALLID 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG      GDTLQAV  H +      PG+ DL+SHVDF  L +IAI    +   L  Q  
Sbjct: 242 YGASDFAFGDTLQAVSKHKFCDIFSAPGEHDLTSHVDFFSLKTIAIQQGCFAEIL-EQRD 300

Query: 301 FLEGLGIWQRA--FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           FL  +G+ +RA   S+ K T  K  +   ++RL       K MG+LFK+L +S++ +++ 
Sbjct: 301 FLFKMGVLERAKKLSINKSTVMKKKIHQDIERLTGL----KQMGKLFKVLHISNKNLQIP 356

Query: 359 PF 360
            F
Sbjct: 357 YF 358


>gi|209886306|ref|YP_002290163.1| Aby [Oligotropha carboxidovorans OM5]
 gi|209874502|gb|ACI94298.1| Aby [Oligotropha carboxidovorans OM5]
          Length = 369

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 202/351 (57%), Gaps = 13/351 (3%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
           +LI   G M V +Y  LC+  P++GYY + +P G  GDF+TAPEISQ+FGE++ ++    
Sbjct: 13  HLIATAGPMPVARYMQLCMTHPDYGYYVSRDPLGRGGDFITAPEISQMFGELIGLWAASV 72

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL 130
           W   G P  V+L+ELGPGRG MM D LR I ++ P F+  + ++++E S  L  +Q+  L
Sbjct: 73  WNAMGMPERVQLIELGPGRGTMMADALRAI-RILPAFYEAIEVHLIELSPSLRAVQRDTL 131

Query: 131 ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFN 190
           A       W+  L DVP G   ++ANE+FD+LPI Q V  E G  ERM+ +   D+  + 
Sbjct: 132 ADV-KPFQWHHLLGDVPDGPAIILANEYFDALPIHQMVKQETGWHERMVGLVD-DAFAYT 189

Query: 191 IGDHEIKSNFLTCSDYFL----GAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQS 246
           I         ++   +      G IFE       E+ +I+ R+   GG A++IDYG+++S
Sbjct: 190 IAPEPTPRFGVSVPPHVRNAPNGTIFEWR--ETNEIMAIARRIREFGGAALLIDYGHIRS 247

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
             GDT QAV  H Y  PL  PG ADL++HVDFQ L+  A    +  +G   QG FL  LG
Sbjct: 248 DAGDTFQAVARHEYADPLRTPGTADLTAHVDFQALADAAQTMGVLTHGPVEQGAFLTQLG 307

Query: 307 IWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           I  RA +L+K +A +    +  ++KRLV +    K+MG LFK+L +SH  +
Sbjct: 308 IETRAQTLIKHSASQSASDVASALKRLVESG--PKAMGSLFKVLGLSHPSI 356


>gi|115523453|ref|YP_780364.1| hypothetical protein RPE_1433 [Rhodopseudomonas palustris BisA53]
 gi|115517400|gb|ABJ05384.1| protein of unknown function DUF185 [Rhodopseudomonas palustris
           BisA53]
          Length = 372

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 210/356 (58%), Gaps = 12/356 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L   I  LI+  G M V +Y  LC+  PE GYY + +P G  GDF+T+PE+SQ+FGE
Sbjct: 3   DQPLHDTIKKLIRSAGPMPVWRYMELCLTHPEHGYYVSRDPLGREGDFITSPEVSQMFGE 62

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L ++    W+  G P  VRL+ELGPGRG +M D +R + ++ P  +  +S+++VE +  
Sbjct: 63  LLGLWAASVWKAIGSPQQVRLIELGPGRGTLMADAMRAL-RVLPPLYQAISVHLVEINPV 121

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q+  LA+  + + W+  L +VP G + + ANE+FD LP+ Q V  EHG  ER+I+I
Sbjct: 122 LRDKQRDTLANLSN-VAWHADLDEVPGGTSIIFANEYFDVLPVHQAVRGEHGWHERVIEI 180

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFL----GAIFENSPCRDREMQSISDRLACDGGTAI 237
           D    L F      I    +           GA+FE     D E+  I+ R+  +GG A+
Sbjct: 181 DAEGDLTFGAAAEPIPQFEVLLPPLVRAAPPGAVFEWR--ADSEIMKIASRVRDEGGAAL 238

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           +IDYG+L+S  GDT QA+  H++  PL NPGQAD+++HVDFQ L+  A      ++G  T
Sbjct: 239 IIDYGHLRSDAGDTFQAIAKHSFADPLANPGQADVTAHVDFQALAQAAEAVGARVHGPVT 298

Query: 298 QGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVS 351
           QG+FL  LGI  RA +LM + + +  + + +++KRL  T   +  MG +FK++ VS
Sbjct: 299 QGEFLRRLGIETRALALMAKASHEISEDVANALKRL--TGGGRGGMGSMFKVIGVS 352


>gi|254719562|ref|ZP_05181373.1| hypothetical protein Bru83_08465 [Brucella sp. 83/13]
 gi|265984571|ref|ZP_06097306.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264663163|gb|EEZ33424.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 365

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 201/365 (55%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLREWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            Q+++LA     I W+   AD+P     G   LV NE FD++P +QFV  +    ERM+ 
Sbjct: 126 KQRQKLAGTKAHIEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMVA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFHFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+  H Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKHAYDDVFAHPGAADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGQLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|256160255|ref|ZP_05457949.1| hypothetical protein BcetM4_14706 [Brucella ceti M490/95/1]
 gi|256255461|ref|ZP_05460997.1| hypothetical protein BcetB_14478 [Brucella ceti B1/94]
 gi|261222667|ref|ZP_05936948.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265998631|ref|ZP_06111188.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260921251|gb|EEX87904.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262553255|gb|EEZ09089.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 365

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 201/365 (55%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I++R+A   G A+
Sbjct: 186 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIANRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|254694204|ref|ZP_05156032.1| hypothetical protein Babob3T_05979 [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214511|ref|ZP_05928792.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260916118|gb|EEX82979.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 365

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 200/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSKWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGAQIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|62290414|ref|YP_222207.1| hypothetical protein BruAb1_1518 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700337|ref|YP_414911.1| hypothetical protein BAB1_1545 [Brucella melitensis biovar Abortus
           2308]
 gi|237815921|ref|ZP_04594918.1| Protein of unknown function DUF185 [Brucella abortus str. 2308 A]
 gi|254689714|ref|ZP_05152968.1| hypothetical protein Babob68_05974 [Brucella abortus bv. 6 str.
           870]
 gi|254697857|ref|ZP_05159685.1| hypothetical protein Babob28_09140 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730748|ref|ZP_05189326.1| hypothetical protein Babob42_06004 [Brucella abortus bv. 4 str.
           292]
 gi|256257965|ref|ZP_05463501.1| hypothetical protein Babob9C_11581 [Brucella abortus bv. 9 str.
           C68]
 gi|260546950|ref|ZP_05822689.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260755247|ref|ZP_05867595.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758468|ref|ZP_05870816.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762293|ref|ZP_05874636.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884262|ref|ZP_05895876.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297248800|ref|ZP_06932518.1| hypothetical protein BAYG_01766 [Brucella abortus bv. 5 str. B3196]
 gi|62196546|gb|AAX74846.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616438|emb|CAJ11501.1| Protein of unknown function DUF185 [Brucella melitensis biovar
           Abortus 2308]
 gi|237789219|gb|EEP63430.1| Protein of unknown function DUF185 [Brucella abortus str. 2308 A]
 gi|260096000|gb|EEW79877.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260668786|gb|EEX55726.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672725|gb|EEX59546.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675355|gb|EEX62176.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873790|gb|EEX80859.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297175969|gb|EFH35316.1| hypothetical protein BAYG_01766 [Brucella abortus bv. 5 str. B3196]
          Length = 365

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 200/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGAQIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|148559414|ref|YP_001259406.1| hypothetical protein BOV_1478 [Brucella ovis ATCC 25840]
 gi|148370671|gb|ABQ60650.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 365

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 200/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYIAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|23502397|ref|NP_698524.1| hypothetical protein BR1529 [Brucella suis 1330]
 gi|161619475|ref|YP_001593362.1| hypothetical protein BCAN_A1566 [Brucella canis ATCC 23365]
 gi|225627970|ref|ZP_03786006.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225853007|ref|YP_002733240.1| hypothetical protein BMEA_A1583 [Brucella melitensis ATCC 23457]
 gi|254704782|ref|ZP_05166610.1| hypothetical protein Bsuib36_12849 [Brucella suis bv. 3 str. 686]
 gi|254708195|ref|ZP_05170023.1| hypothetical protein BpinM_14884 [Brucella pinnipedialis
           M163/99/10]
 gi|254710565|ref|ZP_05172376.1| hypothetical protein BpinB_09916 [Brucella pinnipedialis B2/94]
 gi|256032059|ref|ZP_05445673.1| hypothetical protein BpinM2_15688 [Brucella pinnipedialis
           M292/94/1]
 gi|256045151|ref|ZP_05448050.1| hypothetical protein Bmelb1R_11716 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061582|ref|ZP_05451723.1| hypothetical protein Bneo5_14615 [Brucella neotomae 5K33]
 gi|256114091|ref|ZP_05454856.1| hypothetical protein Bmelb3E_14912 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263513|ref|ZP_05466045.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369945|ref|YP_003107456.1| hypothetical protein BMI_I1543 [Brucella microti CCM 4915]
 gi|260169194|ref|ZP_05756005.1| hypothetical protein BruF5_12698 [Brucella sp. F5/99]
 gi|260565251|ref|ZP_05835735.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260565975|ref|ZP_05836445.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261315700|ref|ZP_05954897.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318138|ref|ZP_05957335.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261325589|ref|ZP_05964786.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261755476|ref|ZP_05999185.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758707|ref|ZP_06002416.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265989169|ref|ZP_06101726.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991583|ref|ZP_06104140.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995419|ref|ZP_06107976.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|23348382|gb|AAN30439.1| conserved hypothetical protein [Brucella suis 1330]
 gi|161336286|gb|ABX62591.1| protein of unknown function DUF185 [Brucella canis ATCC 23365]
 gi|225617133|gb|EEH14179.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225641372|gb|ACO01286.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|256000108|gb|ACU48507.1| hypothetical protein BMI_I1543 [Brucella microti CCM 4915]
 gi|260151319|gb|EEW86413.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155493|gb|EEW90573.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261297361|gb|EEY00858.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301569|gb|EEY05066.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261304726|gb|EEY08223.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261738691|gb|EEY26687.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261745229|gb|EEY33155.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262766532|gb|EEZ12321.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002367|gb|EEZ14942.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093534|gb|EEZ17568.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661366|gb|EEZ31627.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|326409547|gb|ADZ66612.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539253|gb|ADZ87468.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 365

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 200/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|319403826|emb|CBI77413.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 358

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 141/362 (38%), Positives = 207/362 (57%), Gaps = 9/362 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +I  +I  +G ++V QY  L + DP+FGYY    PFG  GDF+TAPEISQ+FGEM
Sbjct: 2   SNLKERIKEIIILDGPISVSQYMTLALTDPQFGYYQKQKPFGRAGDFITAPEISQLFGEM 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + I+ I +W+  G P+   L E+GPGRG +M DILR I K+    F+   I+++E S+RL
Sbjct: 62  IGIWAIMSWQAQGCPNPFILAEIGPGRGTLMDDILRTIRKICITAFNAADIFLIEISQRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QKK+L ++  KI    +   +PL    ++ANE FD+LPI Q+V      +ER I ++
Sbjct: 122 ATEQKKRLFAHQKKIYSVENFEQIPLKPLIVIANELFDALPINQYVKVNGEWKERRITLN 181

Query: 183 QHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           +     F    H+  S FL   C+    G I E  P R++  Q IS RL    G+A++ID
Sbjct: 182 KEGGFTFTTDIHKFPSTFLPPQCAQMPNGTILEYGPSRNQLAQKISSRLMQTQGSALLID 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG      GDTLQA+  H +      PG+ DL+SHVDF  L +IA     ++  +  QG 
Sbjct: 242 YGASDFAFGDTLQAISRHKFCDIFSAPGEHDLTSHVDFFSLKTIAAQQGCFVE-ILEQGN 300

Query: 301 FLEGLGIWQRA--FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           FL  +G+ +RA   S+ K T  K  + + +KRL     D K MG+LFK+L ++ + +++ 
Sbjct: 301 FLIKMGVLERAEKLSINKSTIIKKKIYEDIKRLT----DPKQMGKLFKVLHINDKNIQIP 356

Query: 359 PF 360
            F
Sbjct: 357 YF 358


>gi|306843125|ref|ZP_07475747.1| Hypothetical protein BIBO2_2887 [Brucella sp. BO2]
 gi|306286730|gb|EFM58283.1| Hypothetical protein BIBO2_2887 [Brucella sp. BO2]
          Length = 365

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 200/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     I W+   AD+P     G   LV NE FD++P +QFV  +    ERM+ 
Sbjct: 126 KQKQKLAGTKAHIEWFERFADIPADTVNGPLILVTNELFDAIPFRQFVKADGRFVERMVA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFHFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+  H Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKHAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S  + 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDGQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|17986770|ref|NP_539404.1| ATP synthase beta subunit/transription termination factor Rho
           [Brucella melitensis bv. 1 str. 16M]
 gi|17982399|gb|AAL51668.1| ATP synthase beta subunit/transription termination factor rho
           [Brucella melitensis bv. 1 str. 16M]
          Length = 401

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 200/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 42  LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 101

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 102 IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 161

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 162 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 221

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 222 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 280

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 281 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 339

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 340 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 395

Query: 356 ELMPF 360
            L+PF
Sbjct: 396 RLLPF 400


>gi|85716018|ref|ZP_01046995.1| hypothetical protein NB311A_14415 [Nitrobacter sp. Nb-311A]
 gi|85697216|gb|EAQ35097.1| hypothetical protein NB311A_14415 [Nitrobacter sp. Nb-311A]
          Length = 374

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 144/355 (40%), Positives = 210/355 (59%), Gaps = 17/355 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L+  I  LIK +G + V +Y  LC+  PE GYY   +P G  GDF+T+PE+SQ+FGE+L 
Sbjct: 7   LLADIKRLIKTSGPLPVWRYMQLCLTHPEHGYYIARDPLGREGDFITSPEVSQMFGELLG 66

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           ++    W   G P  +RL+ELGPGRG MM D LR + ++ P  +  LS++MVE +    +
Sbjct: 67  LWGASVWRTIGSPLTLRLIELGPGRGTMMADALRAL-RVLPPMYESLSVHMVEIN---PV 122

Query: 125 IQKKQLASYGD--KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           +++KQ+A+  D   I W+ SL +VP G   + ANE+FD LP+ Q V  + G  ER++DID
Sbjct: 123 LREKQMAALSDAPNIQWHASLDEVPQGPAIIFANEYFDVLPVHQMVKGDDGWHERVVDID 182

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQSISDRLACDGGTAIV 238
               LVF +         +          +GAIFE  P  D E+ SI+ R+   GG A++
Sbjct: 183 G-GQLVFGVSATPTPRFDVLLPPLVRAAPVGAIFEWRP--DAEIMSIATRVRDQGGAALI 239

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+ +S  GDT QA+  H++  PL  PG+ D+++HVDF+ L+  A      ++G  TQ
Sbjct: 240 IDYGHERSDAGDTFQAIARHSFADPLKYPGRVDVTAHVDFEALARAAEDVGARVHGPVTQ 299

Query: 299 GKFLEGLGIWQRAFSLM-KQTAR-KDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           G+FL  LGI  RA +LM K TA   D +  ++KRL  T   +  MG +FK++ VS
Sbjct: 300 GEFLRRLGIEARAVNLMAKATAEVSDGIASALKRL--TEGGRGGMGSMFKVIGVS 352


>gi|148253293|ref|YP_001237878.1| hypothetical protein BBta_1764 [Bradyrhizobium sp. BTAi1]
 gi|146405466|gb|ABQ33972.1| hypothetical protein BBta_1764 [Bradyrhizobium sp. BTAi1]
          Length = 375

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 141/363 (38%), Positives = 207/363 (57%), Gaps = 14/363 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +I  +IK +G M V +Y  LC+  PE GYY + +P G  GDF TAPE+SQ+FGE+
Sbjct: 5   SPLHSEIKRVIKASGPMPVWRYMELCLMHPEHGYYISRDPLGREGDFTTAPEVSQMFGEL 64

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L ++    W+  G P   RL+ELGPGRG MM D LR + ++ P  +  +S++MVE +  L
Sbjct: 65  LGLWAASVWKASGSPQQFRLIELGPGRGTMMSDALRAL-RVLPPLYQTISVHMVEINPVL 123

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QK  L    + I W+ S  DVP G + + ANE+FD LPI Q +  E G  ER++++D
Sbjct: 124 REKQKATLTGLRN-ITWHESFDDVPEGPSVIFANEYFDVLPIHQMLKRETGWHERVVELD 182

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQSISDRLACDGGTAIV 238
             ++  +           L          LGAIFE  P  + E+ +I+ R+    G A++
Sbjct: 183 AEENFAYGTAAEPTPGFELLLPPLVRAAPLGAIFEWRP--NNEIMAIAKRIREQRGAAVI 240

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+++S VGDT QA+  H++  PL  PG AD+++HVDF+ L+  A      ++G  TQ
Sbjct: 241 IDYGHVRSDVGDTFQAIARHSFADPLKTPGLADITAHVDFEALARAADAVGARVHGPITQ 300

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDILLD---SVKRLVSTSADKKSMGELFKILVVSHEKV 355
            +FL  LGI  RA +LM Q A  DI  D    +KRL+     +  MG LFK+L +S   +
Sbjct: 301 SEFLRRLGIETRALTLM-QKASPDISRDIASGLKRLI--EGGRGGMGSLFKVLGLSDASI 357

Query: 356 ELM 358
            ++
Sbjct: 358 PVL 360


>gi|163867945|ref|YP_001609149.1| hypothetical protein Btr_0732 [Bartonella tribocorum CIP 105476]
 gi|161017596|emb|CAK01154.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 359

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 206/357 (57%), Gaps = 5/357 (1%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  KI  +I  +G +TV +Y  L + D +FGYY T  PFG  GDF+TAPEISQ+FGEM+ 
Sbjct: 4   LKEKIKEIIASHGPITVSEYMTLALTDHQFGYYQTQRPFGRTGDFITAPEISQLFGEMIG 63

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ + +W+  G P    L E+GPGRG +M DILR I KL    F+   I+++E S++L  
Sbjct: 64  IWALASWKAQGCPHPFILAEIGPGRGTLMDDILRTIQKLSAIAFNAAEIFLIEISKKLAK 123

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
            QK++L SY  KI+   +L  +P    FL+ NEF D+LPI Q++      +ER I I+Q 
Sbjct: 124 EQKQRLFSYQKKIHSIENLNQIPPKPLFLIGNEFLDTLPINQYIKVNGEWKERCITINQD 183

Query: 185 DSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
              +F    H++ S+ L   CS    G IFE++P R + MQ IS+ L    G+A++IDYG
Sbjct: 184 GDFIFIAAPHKLPSSCLQTYCSKVPDGTIFEHAPLRHQFMQQISNHLVQVTGSALLIDYG 243

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
                 GDTLQA+  H +      PG+ DL+SHVDF  L +IA+    +   +  QG+FL
Sbjct: 244 ARDLAFGDTLQALSKHRFRDVFDAPGEHDLTSHVDFSFLKNIALEQGCFAE-IFEQGEFL 302

Query: 303 EGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             +G+ +RA  L     +   L D +++ +   A    MG+LFK+L  S + + + P
Sbjct: 303 LKMGLLERAQQL--GAGKSASLQDKIRQDIERLASPDQMGKLFKVLHFSDKNIPIPP 357


>gi|163843785|ref|YP_001628189.1| hypothetical protein BSUIS_A1588 [Brucella suis ATCC 23445]
 gi|163674508|gb|ABY38619.1| protein of unknown function DUF185 [Brucella suis ATCC 23445]
          Length = 365

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 200/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D + GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIAITGPISVADYMAACLGDRKAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|254714748|ref|ZP_05176559.1| hypothetical protein BcetM6_15699 [Brucella ceti M644/93/1]
 gi|254717808|ref|ZP_05179619.1| hypothetical protein BcetM_15676 [Brucella ceti M13/05/1]
 gi|261219656|ref|ZP_05933937.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261322544|ref|ZP_05961741.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260924745|gb|EEX91313.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261295234|gb|EEX98730.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 365

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 199/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 186 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 244

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +P  ADL+SHVDF  L   A        G  T
Sbjct: 245 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPSVADLTSHVDFDILQKTAKACGCK-TGTMT 303

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 304 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 359

Query: 356 ELMPF 360
            L+PF
Sbjct: 360 RLLPF 364


>gi|319406834|emb|CBI80469.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 358

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 206/362 (56%), Gaps = 9/362 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +I  +I  +G ++V QY  L + DP+FGYY    PFG  GDF+TAPEISQ+FGEM
Sbjct: 2   SNLKERIKEIIILDGPISVSQYMTLALTDPQFGYYQKQKPFGRTGDFITAPEISQLFGEM 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + I+ I +W+  G P+   L E+GPGRG +M DILR I K+    F+   I+++E S+RL
Sbjct: 62  IGIWAIMSWQAQGCPNPFILAEIGPGRGTLMDDILRTIRKICITAFNAADIFLIEISQRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QKK+L ++  KI    S   +PL    ++ANE FD+LPI Q+V      +ER I ++
Sbjct: 122 ATEQKKRLFAHQKKIYSVESFEQIPLKPLIVIANELFDALPINQYVKVNGEWKERRITLN 181

Query: 183 QHDSLVFNIGDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           +     F    H+  S FL   C+    G I E  P R++  Q IS RL    G+A++ID
Sbjct: 182 KEGGFTFTTDIHKFPSTFLLPQCAQMPNGTILEYGPSRNQLAQKISSRLMQTQGSALLID 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG      GDTLQA+  H +      PG+ DL+SHVDF  L +IA     ++  L  Q  
Sbjct: 242 YGASDFAFGDTLQAISRHKFCDIFSAPGEHDLTSHVDFFSLKTIAAQQGCFVEIL-EQRD 300

Query: 301 FLEGLGIWQRA--FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           FL  +G+ +RA   S+ K T  K  + + +KRL     D K MG+LFK+L ++ + +++ 
Sbjct: 301 FLIKMGVLERAEKLSINKSTIIKKKIYEDIKRLT----DPKQMGKLFKVLHINDKNIQIP 356

Query: 359 PF 360
            F
Sbjct: 357 YF 358


>gi|158425607|ref|YP_001526899.1| hypothetical protein AZC_3983 [Azorhizobium caulinodans ORS 571]
 gi|158332496|dbj|BAF89981.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 367

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 147/359 (40%), Positives = 210/359 (58%), Gaps = 18/359 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M N L  +I  LI+  G ++V +Y ALC+  P  GYY T +PFGA GDF+TAPEISQ+FG
Sbjct: 1   MTNPLKDEIRALIEVEGPISVGRYMALCLGHPRHGYYVTRDPFGAGGDFITAPEISQMFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++ +  W+Q G PS  RLVELGPGRG +M D LR   +L P F + + +++VE S 
Sbjct: 61  ELIGLWAVACWQQMGEPSSFRLVELGPGRGTLMADALRA-ARLVPAFGAAMRLHLVEMSP 119

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            L   Q + L  +  +  W+  + DVP G   ++ANEFFD+LP+ QFV    G  ER + 
Sbjct: 120 VLRRRQAETLKDHAPQ--WHDRIEDVPEGPAIVIANEFFDALPVDQFVRGPTGWHERRVG 177

Query: 181 IDQHDSLVFNIGDHEIK------SNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGG 234
           +D   SLVF +     +      + F   ++  L    E+ P      ++++ RLA  GG
Sbjct: 178 LDVTGSLVFGLDPRPFRPIEAFAAGFPRPAEGDLLERMESGP-----ARALAARLAAQGG 232

Query: 235 TAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           TA+ +DYG+ +S  GDTLQA+K H + +PL  PG+ADL++HVDF  L+ +A        G
Sbjct: 233 TALALDYGHARSGFGDTLQAMKDHRFTNPLAEPGEADLTAHVDFAALAGMARAAGARAFG 292

Query: 295 LTTQGKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
             TQG FL  LGI  RA +LM     A+K  +  ++ RL  T A    MG LFK+L ++
Sbjct: 293 PLTQGDFLRRLGIEARAATLMGSASAAQKAAIGSALTRL--TGAGTGEMGTLFKVLALA 349


>gi|294852846|ref|ZP_06793519.1| ATP synthase beta subunit/transcription termination factor Rho
           [Brucella sp. NVSL 07-0026]
 gi|294821435|gb|EFG38434.1| ATP synthase beta subunit/transcription termination factor Rho
           [Brucella sp. NVSL 07-0026]
          Length = 404

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 199/365 (54%), Gaps = 15/365 (4%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 45  LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 104

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 105 IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 164

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+      G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 165 KQKQKLAGTKAHVEWFERFADISADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 224

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
           +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A   G A+
Sbjct: 225 LNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIAATRGAAL 283

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A        G  T
Sbjct: 284 NIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGCK-TGTMT 342

Query: 298 QGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L  S E+ 
Sbjct: 343 QGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVLAFSDEQT 398

Query: 356 ELMPF 360
            L+PF
Sbjct: 399 RLLPF 403


>gi|84683545|ref|ZP_01011448.1| hypothetical protein 1099457000264_RB2654_19268 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668288|gb|EAQ14755.1| hypothetical protein RB2654_19268 [Rhodobacterales bacterium
           HTCC2654]
          Length = 352

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 194/356 (54%), Gaps = 9/356 (2%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L  K+   I+  G M+V  + A C+ DPE GYY+T +PFG+ GDF TAPEISQ+FGE++
Sbjct: 2   SLADKLRARIEGTGPMSVADFMAECLLDPEHGYYTTRDPFGSAGDFTTAPEISQMFGELV 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            + L   W   G P+   L ELGPGRG +M DILR    + P F     I +VE S RL 
Sbjct: 62  GLCLAQGWMDQGSPAPFVLAELGPGRGTLMADILRATRGV-PGFHDAARIVLVEASPRLR 120

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
             Q+  L  YG  + W  SL D P G  FLVANEFFD+LP++QF       RER + + +
Sbjct: 121 ERQQATLTGYG--VTWVDSLEDAPDGPLFLVANEFFDALPVRQFQRDADDWRERQVGL-K 177

Query: 184 HDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGY 243
             +L F +G     +     +D   G + E  P  D  M  I  R+A  GG A+VIDYG 
Sbjct: 178 DGALTFGLGGPTAHAPLDRWTDAQPGDLVELRPAADAVMAEIDRRIAAQGGAALVIDYGD 237

Query: 244 LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLE 303
             S +GDTLQAV  H    PL NPG ADL++HVDF+ L+  A   +L  + LT QG FLE
Sbjct: 238 WHS-LGDTLQAVAKHEAADPLANPGAADLTAHVDFEALALAAT--RLTHSRLTPQGVFLE 294

Query: 304 GLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
            LGI  RA +L  +   + +          T  D+  MG LFK L    E   ++P
Sbjct: 295 RLGITARAQALAARLEGEPLTRHVAAHRRLTHPDE--MGTLFKTLAFVPEGAAMLP 348


>gi|218507142|ref|ZP_03505020.1| hypothetical protein RetlB5_05735 [Rhizobium etli Brasil 5]
          Length = 271

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 174/265 (65%), Gaps = 4/265 (1%)

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA 131
           ++HG P+ VRLVE+GPGRG M+ D+LRVI ++ P  F  +++++VETSERL  +Q + L 
Sbjct: 4   QRHGTPADVRLVEIGPGRGTMVSDMLRVISRIAPPLFDTMTVHLVETSERLRDVQNQTLE 63

Query: 132 SYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNI 191
           +YG+KI W+    +VP GFT + ANE FD++PI+QFV T+ G RERM+ +D    L F  
Sbjct: 64  AYGEKIAWHDGFDEVPPGFTLIAANELFDAIPIRQFVRTQTGFRERMVGLDADGELTFAA 123

Query: 192 GDHEIKSNFL--TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVG 249
           G   +    L     +  LG +FE SP R   M +I +RL   GGTA+VIDYG+L +  G
Sbjct: 124 GVAGLDPALLPEPVQNLPLGTLFEISPARQAVMMAICERLRAFGGTALVIDYGHLVTGFG 183

Query: 250 DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQ 309
           DTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+   L++NG   QG FL GLGI +
Sbjct: 184 DTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALTSGLHLNGALHQGDFLTGLGILE 243

Query: 310 RAFSLM--KQTARKDILLDSVKRLV 332
           RA +L   ++   + ++  +V RL 
Sbjct: 244 RAAALGRDREPQTQQVIQTAVDRLA 268


>gi|319898499|ref|YP_004158592.1| hypothetical protein BARCL_0325 [Bartonella clarridgeiae 73]
 gi|319402463|emb|CBI76006.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 361

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 209/362 (57%), Gaps = 9/362 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +I  +I  +G ++V QY AL + DP+ GYY    PFG  GDF+TAPEISQ+FGEM
Sbjct: 2   SNLKERIKEIIILDGPISVSQYMALALTDPQSGYYQKQKPFGHTGDFITAPEISQLFGEM 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + I+ I +W+  G P+   L E+GPGRG +M D+LR I K+    ++   I+++E S+RL
Sbjct: 62  IGIWTIMSWQAQGCPNPFILAEIGPGRGTLMDDVLRTIRKICMAAYNAADIFLIEISQRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QKK+L+S+  +I+   +   +P     L+ANE FD+LPI Q++      RER I ++
Sbjct: 122 ATEQKKRLSSHKKQIHNIENFEQIPCKPLILIANELFDALPIDQYIKVNEEWRERRITLN 181

Query: 183 QHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           Q  +  F +  H+  S  L   C+    G I E +P R++ +Q IS  L    G+A++ID
Sbjct: 182 QEGNFTFIVDAHKFPSTDLPAHCAQMPNGTILEYAPSRNQLIQKISSHLIHTKGSALLID 241

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG      GDTLQA+  H +      PG+ DL+SHV+F  L +IAI    +   +  QG 
Sbjct: 242 YGTSDFAFGDTLQAISKHKFCDIFSAPGKHDLTSHVNFFSLKTIAIQQGCFAE-ILEQGD 300

Query: 301 FLEGLGIWQRA--FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           FL  +G+ +RA   S+ K    K+ +   ++RL    A  K MG+LFK+L VS + +++ 
Sbjct: 301 FLFKMGLLERAKQLSINKSIVIKEKIYQDIERL----AGPKQMGKLFKVLHVSDKNIQIP 356

Query: 359 PF 360
            F
Sbjct: 357 HF 358


>gi|304391301|ref|ZP_07373245.1| hypothetical protein R2A130_2682 [Ahrensia sp. R2A130]
 gi|303296657|gb|EFL91013.1| hypothetical protein R2A130_2682 [Ahrensia sp. R2A130]
          Length = 383

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 199/357 (55%), Gaps = 21/357 (5%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAV-------GDFVTAPEI 55
           + L  +I + I+++G +++ +Y ALC+  PE+GYY+T  P G         GDF+TAPEI
Sbjct: 2   SPLETEIRSRIEQDGPLSIAEYMALCLLHPEYGYYTTGTPVGGRASASREGGDFITAPEI 61

Query: 56  SQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYM 115
           SQ+FGEM+ ++ +  W+  G PS   LVELGPGRG +M D+LRV  K  P F +   IY+
Sbjct: 62  SQMFGEMIGVWCMEVWQALGEPSPFALVELGPGRGTLMADLLRV-AKALPGFAAAADIYL 120

Query: 116 VETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIR 175
           VE S  L   Q   L   G  + W      +P     ++ NEF D+LP +Q+V  E    
Sbjct: 121 VEVSGTLAEQQSLTLEKSGASLKWLRDTGQLPDMPAIIIGNEFLDALPFRQWVRLEGQWL 180

Query: 176 ERMIDIDQHDSLVFNIGDHEIKSNFLTCSD-----YFLGAIFENSPCRDREMQSISDRLA 230
           ER I I + D L F       K+N L   D     +  G IFE +P R+ ++  I+  L 
Sbjct: 181 ERAIGI-RDDKLAFVA-----KANVLPQEDEPEGEHEDGTIFETAPAREAQIAQIAAHLK 234

Query: 231 CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
              G A+ IDYG+L+S  GDT QAV+ H Y  PL  PGQ+DL+SHVDF+ L +IA     
Sbjct: 235 QHNGAALFIDYGHLKSGTGDTFQAVRDHAYADPLAAPGQSDLTSHVDFETLLAIAKTAGC 294

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKI 347
            +   T QGKFL  LG+ +RA +L   + + D + + ++  V   A   +MG LFK+
Sbjct: 295 AVPPATAQGKFLVELGLLERAGTL--GSGKNDHIQNQLRSAVERLAGPDAMGNLFKV 349


>gi|67464609|pdb|1ZKD|A Chain A, X-Ray Structure Of The Putative Protein Q6n1p6 From
           Rhodopseudomonas Palustris At The Resolution 2.1 A ,
           Northeast Structural Genomics Consortium Target Rpr58
 gi|67464610|pdb|1ZKD|B Chain B, X-Ray Structure Of The Putative Protein Q6n1p6 From
           Rhodopseudomonas Palustris At The Resolution 2.1 A ,
           Northeast Structural Genomics Consortium Target Rpr58
          Length = 387

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 203/363 (55%), Gaps = 12/363 (3%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L  +I  LIK  G   V +Y  LC+  PE GYY T +P G  GDF T+PEISQ FGE
Sbjct: 4   QTALATEIKRLIKAAGPXPVWRYXELCLGHPEHGYYVTRDPLGREGDFTTSPEISQXFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L ++    W+    P  +RL+E+GPGRG    D LR + ++ P  +  LS+++VE +  
Sbjct: 64  LLGLWSASVWKAADEPQTLRLIEIGPGRGTXXADALRAL-RVLPILYQSLSVHLVEINPV 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L   Q+  LA     I+W+ S  DVP G   ++ANE+FD LPI Q +  E G  ER+I+I
Sbjct: 123 LRQKQQTLLAGI-RNIHWHDSFEDVPEGPAVILANEYFDVLPIHQAIKRETGWHERVIEI 181

Query: 182 DQHDSLVFNIGDHEIKS-NFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
                LVF +    I     L      L   GA+FE  P  D E+  I+ R+   GG A+
Sbjct: 182 GASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRP--DTEILKIASRVRDQGGAAL 239

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           +IDYG+L+S VGDT QA+  H+Y  PL +PG+ADL++HVDF  L   A       +G  T
Sbjct: 240 IIDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVT 299

Query: 298 QGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG FL+ LGI  RA SL  +   +  + +  +++RL  T   + + G  FK++ VS  K+
Sbjct: 300 QGAFLKRLGIETRALSLXAKATPQVSEDIAGALQRL--TGEGRGAXGSXFKVIGVSDPKI 357

Query: 356 ELM 358
           E +
Sbjct: 358 ETL 360


>gi|154252708|ref|YP_001413532.1| hypothetical protein Plav_2261 [Parvibaculum lavamentivorans DS-1]
 gi|154156658|gb|ABS63875.1| protein of unknown function DUF185 [Parvibaculum lavamentivorans
           DS-1]
          Length = 356

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 206/358 (57%), Gaps = 19/358 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M + L R+I  LI++ G + + QY AL +  PE GYY T +P GA GDFVTAPEISQ+FG
Sbjct: 1   MTSPLARQIARLIEQTGPIPLSQYMALALGHPEHGYYMTRDPLGARGDFVTAPEISQMFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++L   W + G P    L ELGPGRG +M D LR I  + P      SI++VETS 
Sbjct: 61  ELVGLWLADQWLEQGSPKPFVLAELGPGRGTLMADALRAIAAV-PHMVEAASIHLVETSP 119

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            L   Q K++     + +W+  + D+P    FLVANEFFD+LP+ Q+  TE G  ER + 
Sbjct: 120 VLRNAQSKRI----PQAHWHEHVDDLPDLPLFLVANEFFDALPVTQYQRTERGWCERFVS 175

Query: 181 IDQHD-----SLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           + +       + V    D  + +      +   G+I E SP      ++I+ R+A  GG 
Sbjct: 176 MAEGRFVPVLAPVPLADDSGLPAAMKAAQE---GSIAEVSPASTSITETIAHRIARRGGA 232

Query: 236 AIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGL 295
           A+VIDYG++ S  GDTLQA++ H +  P   PG+ADL++HVDF+ LS  A       +G 
Sbjct: 233 ALVIDYGHVSSAPGDTLQALRDHKFADPFEAPGEADLTAHVDFEALSHAASAAGAAAHGA 292

Query: 296 TTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
             QG+FL  LGI  RA +L +    A+++ +  +++RL +    +  MG LFK+L ++
Sbjct: 293 VEQGRFLMALGIEARAEALSRNATPAQREDIASAMQRLTA----RDGMGSLFKVLGIT 346


>gi|307944195|ref|ZP_07659536.1| putative C2orf56-like protein [Roseibium sp. TrichSKD4]
 gi|307772541|gb|EFO31761.1| putative C2orf56-like protein [Roseibium sp. TrichSKD4]
          Length = 366

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 207/364 (56%), Gaps = 9/364 (2%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L+ K+   I   G ++V  Y + C+ADP+ GYY+T  PFG +GDF TAPE+SQ+FG
Sbjct: 1   MTTPLLAKLKKRIVATGPLSVVDYMSACLADPDHGYYTTKEPFGEMGDFTTAPEVSQMFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+L  F + A +        +LVELGPG G +M D LR +  L+P F     + +VE S 
Sbjct: 61  ELLGAFCLQASDILQLGEPFQLVELGPGGGTLMADFLR-MAALQPGFMENAQLNLVEMSP 119

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL   Q   L        +    ++VP G   ++ANEFFD+LPI+QF+ TE G  ERM+ 
Sbjct: 120 RLREKQADTLKHAPLAPTFRDMFSEVPDGPLIVIANEFFDALPIRQFIKTELGWSERMVG 179

Query: 181 IDQHDSLVFNIGDHEIKSNFLTC--SDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           ++   +L F IG  +++ + L    +     A+ E  P  +     I++R+   GG A+ 
Sbjct: 180 LNDEGNLSFGIGVAQLEQSALPAYAAHAHRDAVLETQPAANAIASQIAERITRFGGLALF 239

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYGY +S +GDTLQA+  H Y     +PG AD+++HV+F+ L+  A     +++   TQ
Sbjct: 240 IDYGYTKSALGDTLQALYKHAYDDVFAHPGAADITAHVNFEALARSAAQAGAHVHAPLTQ 299

Query: 299 GKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
           G FL  LG+ +RA +L   K    ++ + D+V+RL    A    MG+LFK+L ++H+ + 
Sbjct: 300 GDFLVKLGLLERAGALGYGKDPKTQECIRDAVERL----AAPDQMGDLFKVLAITHKPLA 355

Query: 357 LMPF 360
           L PF
Sbjct: 356 LPPF 359


>gi|90418278|ref|ZP_01226190.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337950|gb|EAS51601.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 380

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/364 (36%), Positives = 200/364 (54%), Gaps = 8/364 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N L RKI   ++  G + VD+Y+   + D E GYY+  +PFG  GDFVTAPE+SQ+FGE+
Sbjct: 2   NALARKIAEHVRVEGPLGVDRYWNFALYDREHGYYARRDPFGRAGDFVTAPEVSQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L  ++  AW   G P    LVE GPGRG MM D+LR +    PD      + +VETS+RL
Sbjct: 62  LGAWVASAWTGLGGPDAFLLVECGPGRGTMMADMLRALRSAAPDCMRAADVRLVETSDRL 121

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q + L  +   I     + D+      +VANE FD++ ++Q+V      RER +   
Sbjct: 122 ADEQMQTLGRFDLPIRRVRRIEDLERRPMVVVANELFDAVAVRQYVFDGSEWRERCVSTT 181

Query: 183 QHDSLVFNIGDHEIKSN----FLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
                 F + +   + +     +   +   GA+ E SP R+R    +++RLA DGG ++ 
Sbjct: 182 DSGRFEFVLCEARPQVSDAVRAMGLVEPKAGAVLEVSPARERIAAGLAERLATDGGASLF 241

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+ +S  GDTLQA+ GH +  PL  PG+ D++SHVDF R+++      LY++   TQ
Sbjct: 242 IDYGHSRSGYGDTLQAMHGHAFADPLDRPGENDITSHVDFDRIAAPFRASGLYVSPTVTQ 301

Query: 299 GKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
             FL  LG+ +RA +L   +    +  ++ +V+RL  T      MG++FK+L  +   + 
Sbjct: 302 SDFLLTLGLLERAGALGAARDEKTRTEIIGAVQRLAGTG--PGDMGQVFKVLCAASRPMR 359

Query: 357 LMPF 360
           L PF
Sbjct: 360 LSPF 363


>gi|217977318|ref|YP_002361465.1| protein of unknown function DUF185 [Methylocella silvestris BL2]
 gi|217502694|gb|ACK50103.1| protein of unknown function DUF185 [Methylocella silvestris BL2]
          Length = 369

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 138/363 (38%), Positives = 208/363 (57%), Gaps = 11/363 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N L   +  +I ++G ++V++Y AL +  P +GYY T    GA GDF+TAPEISQ+FGE+
Sbjct: 2   NPLETLLQEMILESGPISVERYMALALGHPVYGYYRTHVAVGAEGDFITAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++ +  W   G P  ++LVELGPGRG +M D LR + K+ PDF   +S+++VE S  L
Sbjct: 62  IGLWAVEVWRLMGAPKELKLVELGPGRGTLMADALRAV-KIAPDFRDAISVHLVEISLPL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q+  L   G KI W+ S+ +VP G    +ANEFFD+LP++ +V  + G RER I +D
Sbjct: 121 REKQRAALEGQGIKIVWHASVDEVPPGPAIFIANEFFDALPVRHYVHRDGGWRERQIGVD 180

Query: 183 QHDSLVFNI-GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
           +   L F + G HE         D     I E      R M  +  R+   GG  + IDY
Sbjct: 181 ESGRLFFGVSGAHESAIAAKGEPD----DILEVGAGAARLMTQLGVRVVTQGGAVLAIDY 236

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           GY +   G+TLQA++ H +V PL +PG+ADL++HV+F  L+  A      ++G  TQG F
Sbjct: 237 GYEEPARGETLQAMRAHKFVDPLESPGEADLTAHVNFSALARAARGAGAAVHGPVTQGDF 296

Query: 302 LEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSA--DKKS-MGELFKILVVSHEKVE 356
           L  LGI++RA +L      A++  +  +++RL       D+ + M  LFK+L V+  + +
Sbjct: 297 LARLGIFERASALERAAAPAQRAAINSALERLAGEGLGFDRATDMARLFKVLAVTRREFD 356

Query: 357 LMP 359
             P
Sbjct: 357 PPP 359


>gi|114707030|ref|ZP_01439929.1| hypothetical protein FP2506_03224 [Fulvimarina pelagi HTCC2506]
 gi|114537580|gb|EAU40705.1| hypothetical protein FP2506_03224 [Fulvimarina pelagi HTCC2506]
          Length = 370

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 202/369 (54%), Gaps = 14/369 (3%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M + L  KI   I++ G MTV++++ + + D   GYYS   PFG  GDF TAPEISQ+FG
Sbjct: 1   MTSVLSEKITQEIRERGPMTVERFWEIALFDRRHGYYSAHEPFGRAGDFTTAPEISQMFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++  +   AW Q G P    L E+GPGRG +M D+LR + +  PD  +   I +VETSE
Sbjct: 61  ELIGAWCAGAWVQLGRPVPFLLTEIGPGRGTLMADLLRTLRRTAPDCLAAARIRLVETSE 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL  +Q  +L  +   I     + ++      +VANE FD++PI+Q V  E    ER I+
Sbjct: 121 RLAALQASRLEGFDLPIKRVRRIGELEEMPAVVVANELFDAVPIRQTVFHEGRWHERTIE 180

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL------GAIFENSPCRDREMQSISDRLACDGG 234
           +    SL F +G  +   +   C           GAI E SP R+     +  RL    G
Sbjct: 181 LQNDGSLGFAMG--KTLDSLPACLSVIKMHGIEDGAIAEFSPAREGLAAELGARLRRTSG 238

Query: 235 TAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
             + IDYG+ Q+ VGDT QAV  H YV  L NPG+ADL+SHVDF+ L+       L  + 
Sbjct: 239 AGLFIDYGHAQTAVGDTFQAVAAHRYVPVLDNPGEADLTSHVDFESLTRRFGEAGLTSSP 298

Query: 295 LTTQGKFLEGLGIWQRAFSL---MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           + TQG+FL  LG+ +RA  L   + +  R  I +D V+RL  +  +   MG+LFK+  V+
Sbjct: 299 VRTQGEFLLSLGLLERAGRLGAPLDEAGRDRIRMD-VQRLAGSGPE--DMGDLFKVFAVA 355

Query: 352 HEKVELMPF 360
              +++ PF
Sbjct: 356 SAPLDIPPF 364


>gi|260576455|ref|ZP_05844445.1| protein of unknown function DUF185 [Rhodobacter sp. SW2]
 gi|259021338|gb|EEW24644.1| protein of unknown function DUF185 [Rhodobacter sp. SW2]
          Length = 351

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/365 (39%), Positives = 203/365 (55%), Gaps = 26/365 (7%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           + + LIR++    +  G +T+  + A C+  P+ GYYST +PFG  GDF TAPEISQ+FG
Sbjct: 4   LADLLIRRV----QATGPVTLADFMADCLMHPQHGYYSTRDPFGRAGDFTTAPEISQMFG 59

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+L + L  AW   G P+ + L ELGPGRG +M D+LR    + P F +   + ++E S 
Sbjct: 60  ELLGLCLAQAWLDQGSPAPITLAELGPGRGTLMADVLRATSGV-PGFHAAAQVVLLEASP 118

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            L  +Q + L +      W T++AD+P    F++ANEFFD+LPI QF   + G R+RM+ 
Sbjct: 119 TLRAVQAQTLGAR--AATWITTVADLPDQPLFVLANEFFDALPIHQFQRDDSGWRQRMVG 176

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL----GAIFENSPCRDREMQSISDRLACDGGTA 236
           + Q  SL F + D       L     F+    G + E  P     M  I+ RL   GG A
Sbjct: 177 V-QDGSLAFGLSD---PVPALMVGKAFVNDPPGTVVEVCPLARGIMDQIAHRLGNFGGAA 232

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           +++DYG  +S+ GDTLQA++GH    PL NPGQADL++HVDF+ L    I +    +GLT
Sbjct: 233 LIVDYGGWRSK-GDTLQALRGHAPEHPLANPGQADLTAHVDFEALCPPGIPH----SGLT 287

Query: 297 TQGKFLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
            QGK L+ LGI  RA  L  +   A  +  L + +RL     D + MG LFK L +    
Sbjct: 288 DQGKLLKRLGIDARAAKLATKLTGAALESHLAAHRRLT----DPEEMGTLFKALALHAPG 343

Query: 355 VELMP 359
               P
Sbjct: 344 TPPPP 348


>gi|126739895|ref|ZP_01755586.1| hypothetical protein RSK20926_14444 [Roseobacter sp. SK209-2-6]
 gi|126719127|gb|EBA15838.1| hypothetical protein RSK20926_14444 [Roseobacter sp. SK209-2-6]
          Length = 356

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 203/349 (58%), Gaps = 12/349 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L +++V  I++NG +++ +Y + C+  PEFGYYST +PFG  GDFVTAPEISQ+FGE+
Sbjct: 2   SSLEQQLVARIQENGPISLAEYMSECLLHPEFGYYSTRDPFGQSGDFVTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L + L   W   G PS   LVELGPGRG +M D+LR    +   F   + +++VE S +L
Sbjct: 62  LGLCLAQCWLDQGAPSPFALVELGPGRGTLMRDLLRATAGVT-GFHQAMQVFLVEASPKL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q K L  Y   ++W     ++P    FLVANEFFD+LP +QFV    G RER+I ++
Sbjct: 121 QREQAKALEEY--DVSWVAEPMELPNLPVFLVANEFFDALPARQFVRDSDGWRERLIGLE 178

Query: 183 QHDSLVFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
           +   L F +G    +        D   G + E        ++ I+DR++  GG A++IDY
Sbjct: 179 E-GKLGFGLGSATDQPALAYRLEDTRPGDLVELCSPAATLLEPIADRISTFGGAALIIDY 237

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G  +S +GDTLQA++ H    PL NPG+ADL+ HVDF+ L+          + +T QG F
Sbjct: 238 GDWRS-LGDTLQALRAHKSTPPLENPGKADLTLHVDFEFLAQSTKSTGCAHSRVTPQGVF 296

Query: 302 LEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           LE LGI +RA +L +  Q    D L+ + +RL       + MG LFK+L
Sbjct: 297 LERLGITERAQALSRALQGEALDTLIAAHRRLTH----PEEMGNLFKVL 341


>gi|56695809|ref|YP_166160.1| hypothetical protein SPO0907 [Ruegeria pomeroyi DSS-3]
 gi|56677546|gb|AAV94212.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 355

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 197/343 (57%), Gaps = 12/343 (3%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           ++  I + G +++  Y A C+  PE+GYY+T +P G  GDF TAPEISQ+FGE++ + L 
Sbjct: 7   LLERIAQQGPLSLADYMAECLLHPEYGYYTTRDPLGVAGDFTTAPEISQMFGELIGLALA 66

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G P+   LVELGPGRG +M D LR   +  P F     +++VE S  L   Q +
Sbjct: 67  QAWMDQGRPAPFTLVELGPGRGTLMADALRAT-RAVPGFHEAARLWLVEASPVLRATQAQ 125

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            LA  G    W  +++D+P G  F VANEFFD+LP++QF       RER++   +  +L 
Sbjct: 126 ALA--GHDPQWCDTVSDLPAGPLFGVANEFFDALPVRQFQRAGAVWRERLVGA-RDGALC 182

Query: 189 FNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           + +G   ++        D   G + E  P     +  ++ R+A DGG A+++DYG  +S 
Sbjct: 183 WGLGAEALQPALAHRLEDTREGDLVELCPAAGLILSELASRIAADGGAALIVDYGDWRS- 241

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
           +GDT+QA++ H    PL +PGQADL++HVDF+ L+  A       + L+TQG FLE LGI
Sbjct: 242 LGDTVQALRNHAPADPLADPGQADLTAHVDFEVLAMTARAAGCAHSRLSTQGVFLERLGI 301

Query: 308 WQRAFSLMKQT--ARKDILLDSVKRLVSTSADKKSMGELFKIL 348
            QRA +L +    A  D L+ + +RL       + MG LFK+L
Sbjct: 302 AQRAQALARHADEAALDRLITAHRRLTH----PEEMGNLFKVL 340


>gi|86136505|ref|ZP_01055084.1| hypothetical protein MED193_20319 [Roseobacter sp. MED193]
 gi|85827379|gb|EAQ47575.1| hypothetical protein MED193_20319 [Roseobacter sp. MED193]
          Length = 356

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 144/363 (39%), Positives = 203/363 (55%), Gaps = 12/363 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L  +++  I  +G +++  + A C+  PE GYY+T +PFG  GDF TAPEISQ+FGE+
Sbjct: 2   SPLTDQLLARISSDGPISLADFMAECLLHPEHGYYTTRSPFGTQGDFTTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L + L  +W   G P    L ELGPGRG +M D+LR    + P F + L +Y+VE S  L
Sbjct: 62  LGLSLAQSWLNQGAPDTFTLAELGPGRGTLMADLLRATRGV-PGFHTALQLYLVEASPNL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q K LA Y     W  +   +P    FLVANEFFD+LPI+QFV    G RE+ I + 
Sbjct: 121 QEQQAKALARY--DATWVDTADALPQQPLFLVANEFFDALPIRQFVRDGDGWREKRIGL- 177

Query: 183 QHDSLVFNIGDHEIKSNF-LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
               L F +G    +        D   G + E SP     + S++ R+A  GG A+++DY
Sbjct: 178 VDGGLGFGLGPAAPQPALEHRLRDTTDGDLVELSPGAAPILSSLAQRIASHGGAALIVDY 237

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G  +S +GDTLQA+K HT V PL  PG+ADL++HVDF+ L S+A       + +T QG F
Sbjct: 238 GDWRS-LGDTLQALKSHTPVEPLETPGEADLTAHVDFEVLCSVAAGAGCAHSKVTPQGVF 296

Query: 302 LEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           LE LGI  RA +L    +    + L+ + +RL   S     MG LFK+L ++   +   P
Sbjct: 297 LERLGITDRARNLAAGLEGEALESLIAAHRRLTHPS----EMGNLFKVLGLTPADIAPPP 352

Query: 360 FVN 362
            +N
Sbjct: 353 GLN 355


>gi|254486401|ref|ZP_05099606.1| ATP synthase beta subunit/transription termination factor rho
           [Roseobacter sp. GAI101]
 gi|214043270|gb|EEB83908.1| ATP synthase beta subunit/transription termination factor rho
           [Roseobacter sp. GAI101]
          Length = 354

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 200/343 (58%), Gaps = 14/343 (4%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I+  I   G M +D+Y A+C+  P  GYY+T +PFGA GDFVTAPEISQ+FGE++ + L 
Sbjct: 8   IIERIHTTGPMRIDEYMAMCLLHPTRGYYTTRDPFGAEGDFVTAPEISQMFGELIGLCLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
             W   G P+   L ELGPGRGI+M DILR   +  P F     I +VE S+ L  +Q+ 
Sbjct: 68  QTWLSQGAPARFTLAELGPGRGILMADILRA-TRAVPGFAQAAEITLVEASQTLRDVQRT 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            LA  G ++ W  S   +P    +LVANEFFD+LPI+QFV    G RER I +    +L 
Sbjct: 127 TLA--GHQVQWCDSADALPDQPLYLVANEFFDALPIRQFVRDGTGWRERQIGLTD-GALS 183

Query: 189 FNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           F +G    +  F     D   G + E+       +Q+I++R++  GG A++IDYG  +S 
Sbjct: 184 FGLGPMLPQPAFADRLEDTQDGDLIEDCAQLAPTVQAIANRISTHGGAALIIDYGDWRS- 242

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
           +GDT QA++GH  V PL  PG +DL++HVDF++L+  A   +   + +T QG FLE LGI
Sbjct: 243 LGDTFQALRGHQTVDPLSAPGSSDLTAHVDFEKLAIAAAPAQH--SRITPQGVFLERLGI 300

Query: 308 WQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKIL 348
            QRA +L      K  +  + + +RL   S     MG LFK++
Sbjct: 301 TQRAQTLATTMTGKVLEGHVAAHRRLTHPS----EMGNLFKVI 339


>gi|83854800|ref|ZP_00948330.1| hypothetical protein NAS141_08731 [Sulfitobacter sp. NAS-14.1]
 gi|83842643|gb|EAP81810.1| hypothetical protein NAS141_08731 [Sulfitobacter sp. NAS-14.1]
          Length = 354

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 151/354 (42%), Positives = 204/354 (57%), Gaps = 25/354 (7%)

Query: 6   IRKIVN-LIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           +R I++  I  NG M +D+Y A C+  P  GYY+T +PFG  GDF TAPEISQ+FGE+L 
Sbjct: 4   LRDILHSRIASNGPMRIDEYMATCLLHPTQGYYTTRDPFGTQGDFTTAPEISQMFGELLG 63

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           + L  +W     PS   L ELGPGRG +M DILR    + P F     I +VE S  L  
Sbjct: 64  LCLAQSWIAQDAPSAFTLAELGPGRGTLMADILRATRNV-PGFIEAAQITLVEASPTLRD 122

Query: 125 IQKKQLASYGDKINWY---TSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           +Q K LA +  ++ W     +L D PL   FLVANEFFD+LPI+QFV  E   RER + +
Sbjct: 123 VQAKTLAEH--QVIWADGTDALPDQPL---FLVANEFFDALPIRQFVRGETSWRERQVGL 177

Query: 182 DQHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
               +L F +G  E+    L    +D   G + E+       +  +S+R+A  GG A+++
Sbjct: 178 AD-GALSFGLGP-ELPQPALADRLADTTPGDLVEDCTQLAPILHPVSERIATHGGAALIV 235

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG   S +GDTLQA++GH    PLV PGQADL++HVDF++L ++A     Y   +T QG
Sbjct: 236 DYGDWHS-LGDTLQALQGHEKADPLVAPGQADLTAHVDFEKL-ALAAAPASYTR-ITPQG 292

Query: 300 KFLEGLGIWQRAFSLMKQTARKDILLDSV---KRLVSTSADKKSMGELFKILVV 350
            FLE LGI QRA +L K    +D L   V   +RL   S     MG LFK++ +
Sbjct: 293 VFLERLGITQRAQTLAKGMT-EDALNAHVAAHRRLTHPS----EMGNLFKVMGI 341


>gi|83941322|ref|ZP_00953784.1| hypothetical protein EE36_03798 [Sulfitobacter sp. EE-36]
 gi|83847142|gb|EAP85017.1| hypothetical protein EE36_03798 [Sulfitobacter sp. EE-36]
          Length = 354

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 151/354 (42%), Positives = 201/354 (56%), Gaps = 25/354 (7%)

Query: 6   IRKIVN-LIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           +R I++  I  NG M +D+Y A C+  P  GYY+T +PFG  GDF TAPEISQ+FGE+L 
Sbjct: 4   LRDILHSRIASNGPMRIDEYMATCLLHPTQGYYTTRDPFGTQGDFTTAPEISQMFGELLG 63

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           + L  +W     PS   L ELGPGRG +M DILR    + P F     I +VE S  L  
Sbjct: 64  LCLAQSWLAQDAPSAFTLAELGPGRGTLMADILRATRNV-PGFIEAARITLVEASPTLRD 122

Query: 125 IQKKQLASYGDKINWY---TSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           +Q K LA  G ++ W     +L D PL   FLVANEFFD+LPI+QFV  E   RER I +
Sbjct: 123 VQAKTLA--GHQVIWADGTDALPDQPL---FLVANEFFDALPIRQFVRGETSWRERQIGL 177

Query: 182 DQHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
               +L F +G  E+    L    +D   G + E+       +  +S+R+A  GG A+++
Sbjct: 178 AD-GALSFGLGP-ELPQPALADRLADTKPGDLVEDCTQLAPILHPVSERIATHGGAALIV 235

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG   S +GDTLQA++GH    PL  PGQADL++HVDF++L+  A         +T QG
Sbjct: 236 DYGDWHS-LGDTLQALQGHEKADPLAAPGQADLTAHVDFEKLALAAA--PASHTRITPQG 292

Query: 300 KFLEGLGIWQRAFSLMKQTARKDILLDSV---KRLVSTSADKKSMGELFKILVV 350
            FLE LGI QRA +L K    +D L   V   +RL   S     MG LFK++ +
Sbjct: 293 VFLERLGITQRAQTLAKGMT-EDALNAHVAAHRRLTHPS----EMGNLFKVMGI 341


>gi|110680664|ref|YP_683671.1| hypothetical protein RD1_3502 [Roseobacter denitrificans OCh 114]
 gi|109456780|gb|ABG32985.1| hypothetical membrane protein [Roseobacter denitrificans OCh 114]
          Length = 352

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 199/345 (57%), Gaps = 17/345 (4%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           +++  IK +G M+V +Y   C+  P  GYY+T +PFG  GDF+TAPE SQ+FGE++ + L
Sbjct: 6   QLIARIKAHGPMSVAEYMGDCLLHPTLGYYTTQHPFGGSGDFITAPETSQMFGELIGLCL 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           + AW   G PS   LVELGPGRG++M DILR   ++ PDF     + +VE S +L  IQ+
Sbjct: 66  VQAWVDQGRPSPFALVELGPGRGVLMADILRAAAQV-PDFARAAEVILVEASPKLQEIQR 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L ++   + +   +A +P    F+VANEFFD+LPI+QFV +    RER +  D  + L
Sbjct: 125 DTLKAHA--VTFVKDVASLPQCPLFVVANEFFDALPIRQFVRSGPHWRERQVGCDA-EQL 181

Query: 188 VFNIGDHEIKSNF-LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQS 246
           +F +G    +       SD     + E +P     M  +  R+   GG  ++IDYG  +S
Sbjct: 182 IFGMGAQTPQPALNARLSDTKEHDLVEYAPAAAPIMSELGSRIDTHGGAGLIIDYGDWRS 241

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
            +GDTLQAV+ H Y   L +PG++DL++HVDF+   ++A       + LT QG FLE LG
Sbjct: 242 -LGDTLQAVRQHEYTGVLDHPGESDLTAHVDFE---ALAQAVPCAFSRLTPQGVFLERLG 297

Query: 307 IWQRAFSLMKQTARKDILLDSVK---RLVSTSADKKSMGELFKIL 348
           I QRA  L  Q   KD+L   +K   RL       + MG LFK+L
Sbjct: 298 ITQRAQRL-AQNLPKDLLEQHIKAHRRLTH----PEEMGNLFKVL 337


>gi|46200845|ref|ZP_00207869.1| COG1565: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 357

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 194/354 (54%), Gaps = 19/354 (5%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           IK  G + V ++ A  +  PE+GYY   +PFG  GDF TAPEISQ+FGE++ ++    W+
Sbjct: 11  IKATGPIPVSEFMAEALGHPEYGYYRGRDPFGMAGDFTTAPEISQMFGELIGLWCALVWQ 70

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P  V L E+GPGRG +M D+LR    L P F   L ++++ETS  L   Q + LA 
Sbjct: 71  SMGSPERVVLAEIGPGRGTLMADLLRAAKALAP-FARALDVHLIETSPSLRNRQAQALAD 129

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
               + W+    D+P G   LVANE FD+LPI+Q         ER++ +D   +LV  +G
Sbjct: 130 --QSVTWHERFEDLPDGPLLLVANELFDALPIRQLEKVGGVWHERVVGLDDQGALVLALG 187

Query: 193 ----DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRV 248
               D  +    L   D   G++ E  P      ++++ RLA  GG A++IDYGY  S  
Sbjct: 188 PVVADPPLAPAVLNAPD---GSLAEVCPQGRVLAEAVARRLAHQGGAALIIDYGYETSAA 244

Query: 249 GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI-LYKLYINGLTTQGKFLEGLGI 307
           GD+LQAVK H +   L  PG AD+++HVDFQ L+  A  L ++Y  G   QG+FL  LG+
Sbjct: 245 GDSLQAVKSHRHHPVLSAPGTADITAHVDFQALAEAASGLARVY--GPVPQGRFLARLGL 302

Query: 308 WQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
            +R   LM+  + +    L    +RL+    D   MG LFK+L +++  +   P
Sbjct: 303 EERVRMLMQHASVEQAAHLASGARRLI----DPAEMGTLFKVLALANPLLPAPP 352


>gi|254464326|ref|ZP_05077737.1| ATP synthase beta subunit/transription termination factor rho
           [Rhodobacterales bacterium Y4I]
 gi|206685234|gb|EDZ45716.1| ATP synthase beta subunit/transription termination factor rho
           [Rhodobacterales bacterium Y4I]
          Length = 355

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 198/362 (54%), Gaps = 12/362 (3%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L+  +   I+ +G M+V +Y   C+  P+FGYY+T +P GA GDF TAPEISQ+FGE+L
Sbjct: 2   SLMDHLSARIRADGPMSVAEYMGDCLLHPQFGYYTTRDPLGAQGDFTTAPEISQMFGELL 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            + L  AW   G P+   L ELGPGRG +M D+LR    + P F + + I++VE S  L 
Sbjct: 62  GLALAQAWMDQGSPAPFTLAELGPGRGTLMADLLRATRSV-PGFHAAMQIHLVEASPALR 120

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
             Q K L  Y     W  S  ++P    FL+ANEFFD+LPI+QF+    G  E+ I +  
Sbjct: 121 AAQAKALEGYAPA--WLDSADNLPDQPLFLIANEFFDALPIRQFLRAGGGWSEKRIGLTD 178

Query: 184 HDSLVFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
             +L F +     +       +D   G + E         QSI+ R+A  GG A+++DYG
Sbjct: 179 -GALSFGLTPAAPQPALAHRLADTRDGDLVEICEPAAPITQSIAARIAAHGGAALIVDYG 237

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
             ++ +GDTLQA++ H    PL  PG+ADL++HVDF+ L++ A         LT QG FL
Sbjct: 238 DWRA-LGDTLQALRAHEPADPLQTPGEADLTAHVDFEALANAAKTAGCAFTRLTPQGVFL 296

Query: 303 EGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
           E LGI  RA +L    Q    + L+ + +RL       + MG LFK+L +   +    P 
Sbjct: 297 ERLGITDRARALAAPLQGGSLETLIAAHRRLTH----PEEMGNLFKVLGLYPSQAAPPPG 352

Query: 361 VN 362
           +N
Sbjct: 353 LN 354


>gi|220925101|ref|YP_002500403.1| hypothetical protein Mnod_5254 [Methylobacterium nodulans ORS 2060]
 gi|219949708|gb|ACL60100.1| protein of unknown function DUF185 [Methylobacterium nodulans ORS
           2060]
          Length = 367

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 135/359 (37%), Positives = 189/359 (52%), Gaps = 6/359 (1%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+ ++  LI +NG + V+ Y ALC+  P FGYY T +P GA GDF TAPEISQIFGE+
Sbjct: 4   TPLLAELRALIAENGPIPVEHYMALCLGHPRFGYYRTRDPLGAAGDFTTAPEISQIFGEL 63

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L ++    W + G PS  RLVELGPGRG +M D LR I    P F   + +++VETS  L
Sbjct: 64  LGLWAASVWHEMGRPSPCRLVELGPGRGTLMADALRAIRTALPAFAEAVDLHLVETSPSL 123

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q+++LA  G  I W+  + DVP G   ++ANEFFD+LP++Q+  T  G   R + + 
Sbjct: 124 RAAQRERLAPIGRPIAWHDRVEDVPAGPLLILANEFFDALPVRQYERTARGWCMRRVGLA 183

Query: 183 QHDS-LVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
              + L F +    +    +   +   GA+          M+ ++ RL  DGG  + IDY
Sbjct: 184 ADGTGLAFGLDPDPVPDLAVAAPE---GAVLTVPSVALALMRILAGRLVRDGGALLAIDY 240

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G     + DTLQAV  H  +  L  PG+ DL++ VDF  L+  A      I+G   Q  F
Sbjct: 241 GEAGLGLTDTLQAVSRHRRIGVLDAPGETDLTAQVDFGGLARAASEAGAAIHGPVMQRDF 300

Query: 302 LEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKS-MGELFKILVVSHEKVELMP 359
           L  LG+  R   L  + AR D            + D  + MG LFK+L VS   +  +P
Sbjct: 301 LLALGLGSRVERLSAR-ARPDQAAAIAAGAARLTDDAPTGMGRLFKVLGVSGPGLPSLP 358


>gi|221641076|ref|YP_002527338.1| hypothetical protein RSKD131_2977 [Rhodobacter sphaeroides KD131]
 gi|221161857|gb|ACM02837.1| Hypothetical Protein RSKD131_2977 [Rhodobacter sphaeroides KD131]
          Length = 353

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 164/278 (58%), Gaps = 6/278 (2%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           +   I   G +TV  Y A C+  PE GYYST  PFGA GDF TAPEISQ+FGE+L + L 
Sbjct: 8   LARRIGATGPVTVADYMAECLLHPEHGYYSTREPFGAAGDFTTAPEISQMFGELLGLCLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G PS V L ELGPGRG +M D+LR   +  P F     +++VE S RL  +Q++
Sbjct: 68  QAWLDQGQPSPVTLAELGPGRGTLMADLLRAT-RGVPGFHDAARVHLVEASPRLRALQRE 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            L   G    W    AD+P G  FLVANEFFD+LPI+QFV    G RERM+ + +   L 
Sbjct: 127 TLG--GHPAAWLDRAADLPEGPLFLVANEFFDALPIRQFVRGPEGWRERMVGLTE-GRLT 183

Query: 189 FNIG-DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           + +G +  + +      D   G + E  P     M  I+ R+A  GG A+ +DYG  +SR
Sbjct: 184 WGLGPETSLAALAYRLEDTAPGDVVELCPAAGPIMAEIARRIATAGGLALAVDYGGWRSR 243

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
            GDTLQA++ H +  PL  PG+ADL++HVDF+ L+  A
Sbjct: 244 -GDTLQALRAHRFDDPLAAPGEADLTAHVDFEALAQAA 280


>gi|259418837|ref|ZP_05742754.1| ATP synthase beta subunit/transcription termination factor rho
           [Silicibacter sp. TrichCH4B]
 gi|259345059|gb|EEW56913.1| ATP synthase beta subunit/transcription termination factor rho
           [Silicibacter sp. TrichCH4B]
          Length = 357

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/349 (39%), Positives = 196/349 (56%), Gaps = 12/349 (3%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L+  +   I  +G M+V +Y + C+ +PE GYY+T    GA GDF+TAPEISQ+FGE+L
Sbjct: 2   SLMDTLRRRIHLDGPMSVAEYMSECLLNPEQGYYTTATAIGAEGDFITAPEISQMFGELL 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            + L+ AW   G P+   L ELGPGRG +M D+LR   +  P F   + + ++E S RL 
Sbjct: 62  GLALVQAWLDQGSPAPFTLAELGPGRGTLMADMLRA-TRAVPGFHDAMDLTLIEASPRLR 120

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
            +Q+  LA Y  +  W  S+ D+P    FLVANEFFD+LPI+QF   E   RER + +  
Sbjct: 121 NLQEIALAPYAPR--WLPSVEDLPQQPLFLVANEFFDALPIRQFQRDETQWRERRVGLTD 178

Query: 184 HDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
             S +            L     D   G + E         ++I+ R+A  GG A+V+DY
Sbjct: 179 DASALALGLGAAAPQPALAHRIEDTKHGDLVEYCEIAAVVTEAIAQRIADHGGAALVVDY 238

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G  +S +GDTLQA++ H    PL NPGQADL++HVDF+ + + A +       LT QG F
Sbjct: 239 GDWRS-LGDTLQALRAHAPTDPLQNPGQADLTAHVDFEAICNAARISGCAHTRLTPQGVF 297

Query: 302 LEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           LE LGI +RA +L    + A  D ++ + +RL       + MG LFK+L
Sbjct: 298 LERLGITERARALASGLEGAPLDQIVSAHRRLTH----PEEMGNLFKVL 342


>gi|332560047|ref|ZP_08414369.1| hypothetical protein RSWS8N_13340 [Rhodobacter sphaeroides WS8N]
 gi|332277759|gb|EGJ23074.1| hypothetical protein RSWS8N_13340 [Rhodobacter sphaeroides WS8N]
          Length = 353

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 162/278 (58%), Gaps = 6/278 (2%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           +   I   G +TV  Y A C+  PE GYYST  PFGA GDF TAPEISQ+FGE+L + L 
Sbjct: 8   LARRIGAAGPVTVADYMAECLLHPEHGYYSTREPFGAAGDFTTAPEISQMFGELLGLCLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G PS V L ELGPGRG +M D+LR   +  P F     +++VE S RL  +Q++
Sbjct: 68  QAWLDQGQPSPVTLAELGPGRGTLMADLLRAT-RGVPGFHDAARVHLVEASPRLRALQRE 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            L   G    W    AD+P G  FLVANEFFD+LPI+QFV    G RERM+ + +   L 
Sbjct: 127 MLG--GHPAAWLDRAADLPEGPLFLVANEFFDALPIRQFVRGPEGWRERMVGLTE-GRLT 183

Query: 189 FNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           + +G     +       D   G + E  P     M  I+ R+A  GG A+ +DYG  +SR
Sbjct: 184 WGLGPETALAALAHRLEDTAPGDVVELCPAAGPIMAEIARRIATAGGLALAVDYGGWRSR 243

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
            GDTLQA++ H +  PL  PG+ADL++HVDF+ L+  A
Sbjct: 244 -GDTLQALRAHRFDDPLAAPGEADLTAHVDFEALAQAA 280


>gi|84515351|ref|ZP_01002713.1| hypothetical protein SKA53_01796 [Loktanella vestfoldensis SKA53]
 gi|84510634|gb|EAQ07089.1| hypothetical protein SKA53_01796 [Loktanella vestfoldensis SKA53]
          Length = 352

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 202/347 (58%), Gaps = 20/347 (5%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           ++  I ++G +++  +    +  P  GYY+T +PFGA GDF+TAPEISQ+FGE++ + L 
Sbjct: 8   LLTRIARDGPISIASFMTDALMHPAHGYYATRDPFGAAGDFITAPEISQMFGELIGLSLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G P  V L ELGPGRG +M DILR    + P F + ++++ VETS  L  +Q +
Sbjct: 68  QAWLDQGAPDPVTLAELGPGRGTLMADILRATAAV-PGFHAAVTVHFVETSPHLRALQAE 126

Query: 129 QL--ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDS 186
           ++  A++ D+I+   +L D PL    LVANEFFD+LPI+QFV    G RERM+   Q  +
Sbjct: 127 RVPQATWHDRID---TLPDAPL---LLVANEFFDALPIRQFVRAGAGWRERMVGA-QDGT 179

Query: 187 LVFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ 245
           L F + D    +       D   G + E+ P     + +I+ R+A +GG A+VIDYG  Q
Sbjct: 180 LCFGLSDAAALAVLTPRLDDTQDGDLVEHCPALPGIVAAIAGRIATNGGAALVIDYGDWQ 239

Query: 246 SRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGL 305
           S +GDT QA+ GH    PL  PG ADL++HVDF  +++ A   +   + LT QG FLE L
Sbjct: 240 S-LGDTFQALAGHAPTDPLAAPGAADLTAHVDFAAIAAHAAPARH--SRLTPQGVFLERL 296

Query: 306 GIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVV 350
           GI  RA  L      +  D  + + +RL   +     MG+LFK++ +
Sbjct: 297 GITARALKLASGLTGEALDAHVAAHRRLTHPA----EMGDLFKVMAL 339


>gi|197106320|ref|YP_002131697.1| hypothetical protein PHZ_c2859 [Phenylobacterium zucineum HLK1]
 gi|196479740|gb|ACG79268.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 359

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 196/351 (55%), Gaps = 16/351 (4%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L  K+   I   G +TV QY   C+ DP+FGYY+T    G  GDFVTAP +SQ+FG
Sbjct: 1   MSRNLAEKLAAQIAAGGPLTVAQYMTACLHDPQFGYYATRPALGEGGDFVTAPLVSQMFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++   +WE  G P  VRLVE+GPG G +M D+LR   ++ P F     +++VETSE
Sbjct: 61  ELVGVWAAVSWELMGRPETVRLVEMGPGDGTLMGDVLRA-ARMAPGFLDAADVWLVETSE 119

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTF-LVANEFFDSLPIKQFVMTEHGIRERMI 179
            L   Q+++L   GD   W  SLA+VP      L ANE  D LP++QFV T  G  E+++
Sbjct: 120 PLKARQRERL---GDGPRWAASLAEVPGEAPLILFANELLDCLPVRQFVRTATGWAEQVV 176

Query: 180 DIDQHDSLVFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
            +D        +    + +   T   D   GA+FE S  ++     I  R+  DGG A++
Sbjct: 177 GLDDQGGSGGRLAFGRVATPAGTLLPDAREGAVFEQSAAQEALGSEIGARVVRDGGAALL 236

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG  +   GDTLQA++ H  V PL  PG+ADL+ H DF  + + A         + TQ
Sbjct: 237 IDYGRARPGFGDTLQALRRHERVDPLACPGEADLTVHADFPAVMAAAEGEGAQAA-ILTQ 295

Query: 299 GKFLEGLGIWQRAFSLMKQTARKD---ILLDSVKRLVSTSADKKSMGELFK 346
            +FL  LGI +RA +L++  AR D   ++   + RLV  +AD+  MGELFK
Sbjct: 296 AEFLARLGIGERAEALVR--ARPDKAPVVGRQLNRLV--AADQ--MGELFK 340


>gi|99080460|ref|YP_612614.1| hypothetical protein TM1040_0619 [Ruegeria sp. TM1040]
 gi|99036740|gb|ABF63352.1| protein of unknown function DUF185 [Ruegeria sp. TM1040]
          Length = 357

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 197/349 (56%), Gaps = 12/349 (3%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L++ +   I+ +G MTV  Y + C+  P++GYY+T    GA GDF+TAPEISQ+FGE+L
Sbjct: 2   SLMQSLRRRIELDGPMTVADYMSECLLHPDYGYYTTAPAIGAEGDFITAPEISQMFGELL 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            + L+ +W   G P    L ELGPGRG +M D+LR   +  P F   + + ++E S RL 
Sbjct: 62  GLVLVQSWLDQGRPQPFTLAELGPGRGTLMADMLRA-TRAVPGFHEAMELLLIEASPRLR 120

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
            +Q++ LA Y  +  W  S+ D+P    FLVANEFFD+LPI+QF    +  RER + + +
Sbjct: 121 DLQRQALAPYAPR--WVPSVEDLPQHPLFLVANEFFDALPIRQFQREGNQWRERRVGLAE 178

Query: 184 HDS-LVFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
             S L   +G    +        D   G + E+        ++I+ R+   GG A+++DY
Sbjct: 179 DASGLTLGLGAPAPQPALAHRLEDTKDGDLVEHCEVAAVVTEAIAQRIGDHGGVALLVDY 238

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G  +S +GDTLQA++ H    PL  PGQADL++HVDF+ + + A         LT QG F
Sbjct: 239 GDWRS-LGDTLQALRAHAPTDPLAEPGQADLTAHVDFEAICTAASATGCAHTRLTPQGVF 297

Query: 302 LEGLGIWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKIL 348
           LE LGI  RA +L    A + +  ++ + +RL       + MG LFK+L
Sbjct: 298 LERLGITDRANALASGAAGEPLAQIIAAHRRLTH----PEEMGNLFKVL 342


>gi|298292440|ref|YP_003694379.1| hypothetical protein Snov_2465 [Starkeya novella DSM 506]
 gi|296928951|gb|ADH89760.1| protein of unknown function DUF185 [Starkeya novella DSM 506]
          Length = 369

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 192/350 (54%), Gaps = 14/350 (4%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I   I + G +TV  Y   C+  P  GYY+T  PFGA GDFVTAPEISQ+FGE+L ++  
Sbjct: 8   IARQIGQTGPITVADYMQQCLFHPTLGYYTTHEPFGAQGDFVTAPEISQMFGELLGLWAA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
             W + G PS   L ELGPGRG MM D+LR   ++ P       + +VE S RL   Q +
Sbjct: 68  DTWMRLGSPSRFVLAELGPGRGTMMADMLRA-TRIVPGLREAARVVLVEASPRLREKQAE 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            LA  G +++W +S+ D+P G   L+ANEF D+LP++QFV T  G+ ERM+ +++  +L 
Sbjct: 127 TLA--GQEVDWASSVDDLPAGPLILLANEFIDALPVRQFVRTPEGLAERMVGLEEDGALA 184

Query: 189 FNI--GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQS 246
           F +  G     S      D   GAI E  P      + +  RLA  GG A+ IDYG+   
Sbjct: 185 FGLRPGARLDASAEARLRDAPPGAILEICPAGLVVAEKLGARLAATGGAALFIDYGHAGG 244

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
             GDTLQA+  H Y   L +PG+ADL++HVDF  L+  A        G   QG  LE LG
Sbjct: 245 -FGDTLQALHRHAYDDVLAHPGEADLTAHVDFAALARAATAAGARAFGPIGQGVLLERLG 303

Query: 307 IWQRAFSLMKQ---TARKDILLDSVK-RLVSTSADKKSMGELFKILVVSH 352
           +  RA  L +     AR  I  D+ + RL  T   +K MG LFK L + H
Sbjct: 304 LDARAERLKRDADPAARASI--DAARARLAGTG--EKEMGALFKALALVH 349


>gi|166064237|gb|ABY79036.1| hypothetical protein [endosymbiont of Ridgeia piscesae]
          Length = 355

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 134/357 (37%), Positives = 204/357 (57%), Gaps = 27/357 (7%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            +L + ++  IK +G +++ +Y   C+  P+ GYYST +PFGA GDF TAPEISQ+FGE+
Sbjct: 2   TELAKLLIEHIKNSGPISLAEYMGECLLHPKHGYYSTRDPFGADGDFTTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L + +   W Q G P+   L E+GPGRG +M D+LR   K    F +   I ++E S  L
Sbjct: 62  LGLCMAQTWLQQGSPNAFTLAEIGPGRGTLMADVLRA-TKGVAGFHTAAQITLIEASPAL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             IQ++QLA Y   + W   +++ P    +L+ANEFFD+LPI Q++M + G RER++ + 
Sbjct: 121 QKIQREQLADY--DVTWLGDISETPKAPLYLLANEFFDALPIHQYIMEDDGWRERLVGVA 178

Query: 183 QHDSLVFNIG--------DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGG 234
             D LVF           +H  K       D   G + E           I+ R+A  GG
Sbjct: 179 D-DELVFGASAAADLPPLEHRRK-------DCRTGDLVEVCGAASAIAGEIATRIAEHGG 230

Query: 235 TAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
            AI+IDYG  +S +GDTLQA++ H + SPL +PG+AD+++HVDF+ L+  A+ +   ++ 
Sbjct: 231 AAIIIDYGDWRS-LGDTLQALRNHEFDSPLAHPGEADITAHVDFEALAVSAVSHT-PVSK 288

Query: 295 LTTQGKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILV 349
           +  QG+ L+ LGI QRA  L +  + A  +  + + +RL     +   MG LFK + 
Sbjct: 289 MIPQGELLKRLGIDQRAEVLAQGLEGAELENHMSTHRRLT----EPTEMGTLFKAIA 341


>gi|163732263|ref|ZP_02139709.1| hypothetical membrane protein [Roseobacter litoralis Och 149]
 gi|161394561|gb|EDQ18884.1| hypothetical membrane protein [Roseobacter litoralis Och 149]
          Length = 352

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 133/344 (38%), Positives = 197/344 (57%), Gaps = 15/344 (4%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           +++  I  +G M+V +Y   C+  P  GYY+T  PFG+ GDF TAPEISQ+FGE++ + L
Sbjct: 6   QLIARITAHGPMSVAEYMGECLLHPTLGYYTTQMPFGSAGDFTTAPEISQMFGELIGLCL 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           +  W   G P+   LVELGPGRG +M D+LR   ++ P F     I +VE S RL  IQ+
Sbjct: 66  VQTWIDQGQPTPFSLVELGPGRGTLMADVLRATSQV-PAFLHAAEIILVEASPRLQSIQR 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L  +   I + T ++ +P    F++ANEFFD+LP++QFV +    RER I  D  D L
Sbjct: 125 DTLKDH--DIAFVTEVSTLPQQPLFVIANEFFDALPVRQFVRSGAHWRERQIGSDG-DEL 181

Query: 188 VFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQS 246
           +F +G    +       SD     + E +P     +  +  R+   GG  ++IDYG   S
Sbjct: 182 IFGLGAETPQPALNDRLSDTKDNDVVEYTPAAAPILSQLGGRIEAHGGVGLIIDYGDWHS 241

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
            +GDTLQAV+ H +   L +PG++DL++HVDF+ L+  A   +   + LT QG FLE LG
Sbjct: 242 -LGDTLQAVRRHQFTGILDHPGESDLTAHVDFEALAQAA---RCAYSRLTPQGVFLERLG 297

Query: 307 IWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKIL 348
           I QRA  L +  +++  +I + + +RL   +     MG LFK+L
Sbjct: 298 IAQRAQHLAQNLSKEQLEIHIQAHRRLTHPA----EMGNLFKVL 337


>gi|84499690|ref|ZP_00997978.1| hypothetical protein OB2597_07165 [Oceanicola batsensis HTCC2597]
 gi|84392834|gb|EAQ05045.1| hypothetical protein OB2597_07165 [Oceanicola batsensis HTCC2597]
          Length = 362

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 194/362 (53%), Gaps = 18/362 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+ +I + I   G MT+ +Y  + + DP+ GYY+T +PFG  GDF+TAPE SQ+FGE+
Sbjct: 4   TPLLDRIRHRIGAQGPMTLAEYMQIALLDPDHGYYATRDPFGTAGDFITAPETSQMFGEL 63

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + + L  +W   G P+   L E GPGRG +M DILR   +  P F   LS+ ++E S  L
Sbjct: 64  VGLALAQSWIDQGRPAPFILAEPGPGRGTLMADILRA-TRSVPGFHDGLSLVLIEASPVL 122

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             IQ + L+ Y  +  W   L  +P    FLVANEFFD+LPI+QF     G  E M+ + 
Sbjct: 123 RDIQARTLSGY--RAEWIDDLGALPEAPLFLVANEFFDALPIRQFRRRGDGWAEVMVTVS 180

Query: 183 QHD---SLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
                 +L   +   E+        D     + E  P   R    I  R+A  GG A+++
Sbjct: 181 GSGLATALAAPVPLPELAHRL---GDTREDDVVELCPAAARAAAHIGARIADQGGAAVIV 237

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG  +S +GDT QA+KGH  V PL  PG ADL++HVDF+RL+  A     + +G+  QG
Sbjct: 238 DYGDWRS-LGDTFQALKGHAPVDPLAAPGTADLTAHVDFERLAKAAT--PAWASGMIPQG 294

Query: 300 KFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
            FLE LGI  RA +L    Q    D  + + +RL       + MG LFK+L +S      
Sbjct: 295 VFLERLGITARAQALATRLQGPDLDAHVAAHRRLTH----PEEMGTLFKVLALSPPDAPP 350

Query: 358 MP 359
           +P
Sbjct: 351 VP 352


>gi|146276315|ref|YP_001166474.1| hypothetical protein Rsph17025_0259 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554556|gb|ABP69169.1| protein of unknown function DUF185 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 353

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 143/343 (41%), Positives = 190/343 (55%), Gaps = 11/343 (3%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           +   I   G +TV  Y A C+  PE GYYST  PFGA GDF TAPEISQ+FGE+L + L 
Sbjct: 8   LARRIGATGPITVADYMAECLLHPEHGYYSTREPFGAAGDFTTAPEISQMFGELLGLCLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G P+   L ELGPGRG +M D+LR    + P F +   + +VE S RL  +Q++
Sbjct: 68  QAWLDQGAPARFTLAELGPGRGTLMADVLRATRGV-PGFHAAAQVRLVEASPRLRTLQRQ 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
           +L ++     W    AD+P    FL+ANEFFD+LPI+QFV    G RERMI +D      
Sbjct: 127 RLGNH--PAEWLDRAADLPEAPLFLLANEFFDALPIRQFVRGLSGWRERMIGLDGGRP-A 183

Query: 189 FNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           F +G    + S      D   G I E  P     M  I+ R+   GG A+V+DYG  +S 
Sbjct: 184 FGLGPETGLASLEHRLKDTQPGEIVELCPAAGPIMAEIARRIDGHGGLALVVDYGGWRS- 242

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
           +GDTLQA++ H +  PL  PG+ADL++HVDF+ L++ A   +      TTQG  L  LG+
Sbjct: 243 LGDTLQALRSHQFDDPLAAPGEADLTAHVDFEALATAA---RPCATAFTTQGALLLRLGL 299

Query: 308 WQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            +RA  L +  A +   L S +       D   MG LFK L V
Sbjct: 300 AERAERLAR--ALEGEALASHRAASHRLTDAAEMGTLFKALAV 340


>gi|83309693|ref|YP_419957.1| hypothetical protein amb0594 [Magnetospirillum magneticum AMB-1]
 gi|82944534|dbj|BAE49398.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 357

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 130/358 (36%), Positives = 195/358 (54%), Gaps = 19/358 (5%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           + + I+  G + V ++ A  +  PE+GYY   +PFG  GDF+TAPEISQ+FGE++ ++  
Sbjct: 7   LADRIRATGPIPVSEFMAEALGHPEYGYYMGRDPFGMAGDFITAPEISQMFGELIGLWCA 66

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
             W+  G P  V L E+GPGRG +M D+LR    L P F   L+++++ETS  L   + +
Sbjct: 67  LVWQSMGAPKRVVLAEIGPGRGTLMADLLRAAQALPP-FALALNVHLIETSPSL---RNR 122

Query: 129 QLASYGDK-INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
           Q  +  D+ + W+    D+P G   LVANE FD+LPI+Q        RER++ +D+  + 
Sbjct: 123 QAQALTDRSVEWHERFEDLPDGPLLLVANELFDALPIRQLEKAGGVWRERVVALDEAGAF 182

Query: 188 VFNIG----DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGY 243
            F  G    +  +    L  +D   GA+ E  P       +I+ RLA  GG A++IDYGY
Sbjct: 183 AFAQGPVVAEPPLAPAVLGAAD---GAVAELCPQGRALAGTIARRLAHQGGAALIIDYGY 239

Query: 244 LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLE 303
            +S  GD+LQA+K H     L  PG AD+++HVDFQ L+  A       +G   QG FL 
Sbjct: 240 GKSAAGDSLQALKSHKRHPVLSGPGTADITAHVDFQALAEAASGLA-RAHGPVPQGSFLA 298

Query: 304 GLGIWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
            LG+ +R   LM+    +    L    +RL+    D   MG LFK+L ++   + + P
Sbjct: 299 RLGLEERVRMLMQNATPEQAAHLASGARRLI----DPGEMGTLFKVLALAAPLLPVPP 352


>gi|126733062|ref|ZP_01748818.1| hypothetical protein SSE37_14379 [Sagittula stellata E-37]
 gi|126706472|gb|EBA05553.1| hypothetical protein SSE37_14379 [Sagittula stellata E-37]
          Length = 357

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 138/356 (38%), Positives = 192/356 (53%), Gaps = 38/356 (10%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I   I + G +T+  Y ALC++ PE GYY+T +P GA GDF TAPEISQ+FGE++ + L 
Sbjct: 8   ITRQISRTGPLTLADYMALCLSHPEHGYYATRDPLGAEGDFTTAPEISQMFGELIGLALA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            +W   G P+   L ELGPGRG +M D LR   ++ P F   L +++VETS  L   Q  
Sbjct: 68  QSWMDQGAPTRFVLSELGPGRGTLMADALRATTRV-PGFHDALELHLVETSPALRAEQAA 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI--------- 179
           +L        W+ S+A +P    FL+ANEFFD+LPI+QF+    G +ER++         
Sbjct: 127 RLPD----ATWHESVASLPEAPLFLIANEFFDALPIRQFLRHAQGWQERVVGLKDGQPTL 182

Query: 180 ---DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
              D   HD+L     DH +       +D   G I EN       +Q    R+A  GGTA
Sbjct: 183 GLTDPAPHDAL-----DHRL-------ADTEPGQIVENCAPAQAIVQETGRRIASHGGTA 230

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           +++DYG  +SR GDT QA+  H    P   PG+ADL++HVDF+ L+  A          T
Sbjct: 231 LIVDYGDWRSR-GDTFQALYRHKPAEPFARPGEADLTAHVDFEALAKAAHPAAHSAL--T 287

Query: 297 TQGKFLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            QG FLE LGI  RA +L ++   A  +  + + +RL         MG LFK+L +
Sbjct: 288 PQGVFLEHLGITARAQALARRLGGAALESHVAAHRRLTHPG----EMGSLFKVLAL 339


>gi|218678243|ref|ZP_03526140.1| hypothetical protein RetlC8_04957 [Rhizobium etli CIAT 894]
          Length = 257

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 163/255 (63%), Gaps = 6/255 (2%)

Query: 110 VLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVM 169
            +S+++VETSERL  +Q + L  YG+KI W+    +VP GFT + ANE FD++PI+QFV 
Sbjct: 1   TMSVHLVETSERLRDVQSQTLEVYGEKIAWHDGFDEVPSGFTLIAANELFDAIPIRQFVR 60

Query: 170 TEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISD 227
           T  G RERM+ +D +  L F  G   +    L     +  LGA+FE SP R   M +I +
Sbjct: 61  TPTGFRERMVGLDANGELTFAAGVAGLDPALLPEPVQNLPLGALFEISPARQAVMMAICE 120

Query: 228 RLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAIL 287
           RL   GGTA+ IDYG+L +  GDTLQAV+ H +  PL +PG+ADL+SHVDFQ+L+  A+ 
Sbjct: 121 RLRAFGGTALAIDYGHLVTGFGDTLQAVRMHEFDPPLAHPGEADLTSHVDFQQLAETALA 180

Query: 288 YKLYINGLTTQGKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELF 345
             +++NG   QG FL GLGI +RA +L   ++   + ++  +V RL    A +  MGELF
Sbjct: 181 AGVHLNGALHQGDFLTGLGILERAAALGRDREPQTQQVIQTAVDRLA--GAGEGRMGELF 238

Query: 346 KILVVSHEKVELMPF 360
           K++ VSH  V+LMPF
Sbjct: 239 KVMAVSHPAVDLMPF 253


>gi|260432873|ref|ZP_05786844.1| protein C2orf56 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416701|gb|EEX09960.1| protein C2orf56 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 355

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 140/344 (40%), Positives = 193/344 (56%), Gaps = 14/344 (4%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           ++  I++NG M++  Y A C+  P  GYY+T +P GA GDFVTAPEISQ+FGE++ + L 
Sbjct: 7   LIARIRQNGPMSIADYMAECLLHPTHGYYTTRDPLGAQGDFVTAPEISQMFGELIGLCLA 66

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G P    L ELGPGRG +M DILR   K  P F     + ++E S  L  +Q +
Sbjct: 67  QAWINQGKPERFALAELGPGRGTLMADILRA-TKGVPGFHDAAQVVLLEASPVLRGLQAE 125

Query: 129 QLASYG-DKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
            LA +  D I    +L D+PL   +LVANEFFD+LPI+QF+    G RER++ + + D L
Sbjct: 126 ALAGHAPDWIIQVGALPDLPL---YLVANEFFDALPIRQFLRDGDGWRERLVGL-KGDDL 181

Query: 188 VFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQS 246
            F +G    +        D   G + E        +  I+ R+   GG  ++IDYG   S
Sbjct: 182 AFGLGAWAAQPALAARLEDTRDGDLVELCAAAVPVVTEIARRIRTHGGVGLIIDYGDWHS 241

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
            +GDT QA+KGH    PL NPGQADL++HVDF+ L+  A         LT QG FLE LG
Sbjct: 242 -LGDTFQALKGHERTDPLANPGQADLTAHVDFELLAQAARAAGCAHTRLTQQGVFLERLG 300

Query: 307 IWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKIL 348
           I +RA +L         ++L+ + +RL       + MG LFK+L
Sbjct: 301 ITRRAQALAGPLTGDALNMLVAAHRRLTH----PEEMGNLFKVL 340


>gi|254460068|ref|ZP_05073484.1| ATP synthase beta subunit/transription termination factor rho
           [Rhodobacterales bacterium HTCC2083]
 gi|206676657|gb|EDZ41144.1| ATP synthase beta subunit/transription termination factor rho
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 354

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 142/350 (40%), Positives = 198/350 (56%), Gaps = 32/350 (9%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I   G M+V +Y + C+  PE+GYYST +PFGA GDF+TAPEISQ+FGE++ + L   W 
Sbjct: 12  ITTQGPMSVAEYMSTCLLHPEYGYYSTRDPFGAGGDFITAPEISQMFGELIGLTLAQVWM 71

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P+ + L ELGPGRG +M DILR   K  P F     I+++E S +L  +Q   L++
Sbjct: 72  DQGQPAKIALAELGPGRGTLMADILRT-AKAVPSFAQACEIHLIEASPKLREVQAATLSA 130

Query: 133 YG----DKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
           Y     D +N   S  D+PL   + +ANEFFD+LPI+Q +    G RER I +D +D+L 
Sbjct: 131 YTPVWHDHVNQLPS--DLPL---YAIANEFFDALPIRQMIRDGEGWRERQIGLD-NDALA 184

Query: 189 FNIG--------DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           F +         DH +       SD   G + E        M+++++R+  +GG A++ D
Sbjct: 185 FGLSISAPLAALDHRL-------SDTKDGDLVELCAQAPLIMRTLAERIQANGGAAVIFD 237

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG  +S +GDTLQAV  H  V  L+ PGQ+DL+SHVDF+ L  I  L   + + LTTQG 
Sbjct: 238 YGDWRS-LGDTLQAVYAHEKVPALLKPGQSDLTSHVDFEAL--ITDLPCTH-SRLTTQGV 293

Query: 301 FLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           FLE LGI  RA +L K      +          T  D+  MG +FK L +
Sbjct: 294 FLERLGITDRAQALAKSLGGTALEHHIAAHRRLTHPDE--MGTIFKTLAL 341


>gi|21434891|gb|AAM53573.1| Aby [Azospirillum brasilense]
          Length = 350

 Score =  229 bits (583), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 179/328 (54%), Gaps = 12/328 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + L   +   I  +G ++V  + A  +  P FGYY   +PFG  GDF TAPEISQ+FGE+
Sbjct: 7   DSLAHHLARRILMDGPLSVAAFMAEALGHPRFGYYMRQDPFGVSGDFTTAPEISQMFGEL 66

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
             ++ +  W + G P+ V LVELGPGRG +M D LR    L P F     +++VETS  L
Sbjct: 67  AGLWCVDTWARLGGPAPVHLVELGPGRGTLMQDALRA-AALVPAFREATRVHLVETSPTL 125

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QK+ LA  G  + W+  L DVP G T ++ANEFFD+LPI+Q   T HG  ER+IDID
Sbjct: 126 RARQKETLA--GIPVAWHDRLEDVPEGPTLILANEFFDALPIRQVQKTNHGWFERLIDID 183

Query: 183 QHDSL--------VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGG 234
             +S+        +   G    +       D   G++ E SP      + I +RLA   G
Sbjct: 184 NTESMDTPRFRFVLEAFGSAGARLIPPALRDAPEGSVVEVSPASQPVARLIGERLAAHPG 243

Query: 235 TAIVIDYGYL-QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
            A+VIDYGY     VGDTLQA++ H Y   L  PG+ADL++HVDF  +++ A        
Sbjct: 244 AALVIDYGYRGGPAVGDTLQALRRHAYAPVLDAPGEADLTAHVDFAAIAAAAREGGAESF 303

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQTARK 321
           G   QG +L  LGI  RA +L +    K
Sbjct: 304 GPVDQGDWLVRLGIQPRATALKRSATTK 331


>gi|294678327|ref|YP_003578942.1| hypothetical protein RCAP_rcc02806 [Rhodobacter capsulatus SB 1003]
 gi|294477147|gb|ADE86535.1| protein of unknown function DUF185 [Rhodobacter capsulatus SB 1003]
          Length = 356

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 129/350 (36%), Positives = 195/350 (55%), Gaps = 18/350 (5%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHG 75
            G + +DQY A C+  PE GYY+T +PFG  GDF+TAPEISQ+FGEML + L   W   G
Sbjct: 15  EGPIGLDQYMAACLLHPEHGYYATRDPFGRAGDFITAPEISQMFGEMLGLCLAQVWLDQG 74

Query: 76  FPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD 135
            P+   L E+GPGRG ++ D+ RVI ++ P       ++++E S  L  +Q++ LA++  
Sbjct: 75  RPAPFILAEIGPGRGTLLADVTRVIARV-PGMADAARLHLIEASPTLRAVQRQTLAAH-- 131

Query: 136 KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHE 195
            ++W+ S+A +P    FL+ANEFFD+LPI+QF+ TE G  ER + +   + LV  +    
Sbjct: 132 PVSWHDSVATLPEAPLFLLANEFFDALPIRQFLRTEAGWAERQVGLVG-ECLVPGLAP-- 188

Query: 196 IKSNFLTCS----DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDT 251
             + F        D   G + E  P     M  I+ R+A  GG A+VIDYG+ +S +GDT
Sbjct: 189 -PTRFAALEHRLVDTTPGDVVETCPAAAPIMGEIARRIATHGGVALVIDYGHWRS-LGDT 246

Query: 252 LQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI--WQ 309
            QAV+ H +  P   PG+ADL++HV F+ L+  A       + +T QG  LE LGI    
Sbjct: 247 FQAVRAHGFCDPFATPGEADLTAHVAFEPLAEAARAAGAQASAMTAQGVLLERLGITARA 306

Query: 310 RAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
            A +     A ++  + + +RL       + MG++F+ L +      + P
Sbjct: 307 EALAARLSGAAREAHVAAHRRLTH----PEEMGQVFQSLAIFPATAPVPP 352


>gi|114767217|ref|ZP_01446082.1| hypothetical protein 1100011001181_R2601_09240 [Pelagibaca
           bermudensis HTCC2601]
 gi|114540627|gb|EAU43698.1| hypothetical protein R2601_09240 [Roseovarius sp. HTCC2601]
          Length = 354

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 194/362 (53%), Gaps = 19/362 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +E  L R+I       G MT+ +Y A C+  P +GYY T +P GA GDF TAPEISQ+FG
Sbjct: 4   LEEILHRRIA----AEGPMTIAEYMATCLGHPRYGYYPTRDPLGAAGDFTTAPEISQMFG 59

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+L + L   W + G PS   L ELGPGRG +M D  R + +  P       +++VETS 
Sbjct: 60  ELLGLCLAQCWLEQGRPSSFVLAELGPGRGTLMADATRAM-RGVPGMLEAARLHLVETSP 118

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           RL   Q ++LA       W+ S+A++P    +L+ANEFFD+LPI+QF+ +  G  ER++ 
Sbjct: 119 RLRDEQHRRLAPL--MPVWHDSVANLPEAPLYLLANEFFDALPIRQFLRSGEGWCERVVG 176

Query: 181 IDQHDSLVFNIGDHEIKSNF-LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
           + +   L F + +           +D   G + E         + I  R+A  GG A+++
Sbjct: 177 LSE-GRLAFGLTEPAPHGELEHRLADTREGDLVETCAPATGIAEDIGRRIASQGGAALIV 235

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG  +S +GDT QAV+ H  VSPL  PG ADL++HVDF    ++A         LT QG
Sbjct: 236 DYGSARS-LGDTFQAVRRHDKVSPLDAPGTADLTAHVDF---GALATAMPCATTTLTPQG 291

Query: 300 KFLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
            FLE LGI  RA +L  +   A+ D  + + +RL       + MG LFK L    E    
Sbjct: 292 VFLERLGITDRARALAARLSGAQLDSHVAAHRRLTH----PEEMGSLFKTLGAFPEGAAP 347

Query: 358 MP 359
            P
Sbjct: 348 PP 349


>gi|310815440|ref|YP_003963404.1| hypothetical protein EIO_0956 [Ketogulonicigenium vulgare Y25]
 gi|308754175|gb|ADO42104.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 351

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 186/348 (53%), Gaps = 15/348 (4%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L  +I  +I + G M +  Y +LC+ DPE GYY+T    GA GDF+TAPE+SQ+FGE++
Sbjct: 2   SLAARIKRMIAQGGPMRLSDYMSLCLLDPEAGYYTTRTAIGAGGDFITAPEVSQVFGELI 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            + L  AW   G P    L ELGPGRG +M DILR   K+ P F +   + +VE S  + 
Sbjct: 62  GLALAQAWLDQGAPDPCILAELGPGRGTLMADILRATRKV-PGFHAAAQVVLVEASPLMR 120

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
            +Q   + +      W  S+  +P G  FL+ANEF D+LPI+QF  +  G  ER++ + Q
Sbjct: 121 TLQAANVPA----ARWCDSVEALPAGPLFLIANEFLDALPIRQFQRSSDGWHERLVTV-Q 175

Query: 184 HDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGY 243
             +L   +G        +   D     +FE +   +  M+ I+ R+A  GG AI IDYG 
Sbjct: 176 DGALTLGLGPQ------IALPDAPDADVFEQNTMAESVMRIIASRIAVAGGAAIFIDYGA 229

Query: 244 LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLE 303
            +SR GDT QAV+ H Y  P  +PG ADL++HV F  L+  A       + L TQ  FL 
Sbjct: 230 DESR-GDTFQAVQNHAYADPFSDPGTADLTAHVAFGPLARAATNAGAAASALITQADFLL 288

Query: 304 GLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
            LG+  R  +L +        LD+ +  ++       MG LFK+L ++
Sbjct: 289 TLGLSARGAALARHL--SGAALDAHQAALNRLTHPGEMGTLFKVLGIT 334


>gi|85704768|ref|ZP_01035869.1| hypothetical protein ROS217_06800 [Roseovarius sp. 217]
 gi|85670586|gb|EAQ25446.1| hypothetical protein ROS217_06800 [Roseovarius sp. 217]
          Length = 353

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 199/353 (56%), Gaps = 15/353 (4%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I + G +++  Y A C+  PEFGYY+T +PFGA GDFVTAPEISQ+FGE+L + L   W 
Sbjct: 12  IAEAGPISLADYMAACLMHPEFGYYATRDPFGAGGDFVTAPEISQMFGELLGLCLAQVWL 71

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P+   L ELGPGRG +M D+LR   ++ P F     +++VE S  L   Q++ +A 
Sbjct: 72  DQGRPARFVLAELGPGRGTLMADVLRATQRV-PGFRDAAEVHLVEGSAVLRAAQRRAIA- 129

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNI- 191
            GD I W+  +  +P G  +L+ANEFFD+LPI+QF     G RER++ +   D L   + 
Sbjct: 130 -GDVI-WHERVESLPEGPLYLLANEFFDALPIRQFQRFGDGWRERVVGLSD-DRLALGLS 186

Query: 192 GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDT 251
           G     +     ++   G + E     +     I  R+A  GG A+++DYG  +S +GDT
Sbjct: 187 GPVAPPALVERLAETREGDVVEICGPGEAVAAEIGARIAGHGGAALIVDYGDWRS-LGDT 245

Query: 252 LQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRA 311
            QAVKGH  V PL  PG ADL++HVDF+ L+  A    +Y   LT QG FLE LGI  R+
Sbjct: 246 FQAVKGHAPVDPLAAPGLADLTAHVDFEALARAAS-PAVYTR-LTPQGVFLERLGIGARS 303

Query: 312 FSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFVN 362
             L +  + + +   L + +RL       + MG LFK+L +  E     P ++
Sbjct: 304 EVLARNLSGQALENHLAAYQRLTGA----EEMGTLFKVLGLYPEGTTPPPGLD 352


>gi|254511961|ref|ZP_05124028.1| hypothetical protein RKLH11_2504 [Rhodobacteraceae bacterium KLH11]
 gi|221535672|gb|EEE38660.1| hypothetical protein RKLH11_2504 [Rhodobacteraceae bacterium KLH11]
          Length = 355

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 141/351 (40%), Positives = 200/351 (56%), Gaps = 16/351 (4%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++ L+R+I    +++G MTV  Y   C+  P  GYY+T +P GA GDF+TAPEISQ+FG
Sbjct: 3   LKDHLLRRI----REHGPMTVADYMNACLLHPIHGYYTTRDPLGAQGDFITAPEISQMFG 58

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ + L  +W   G P+ + L ELGPGRG +M DILR    + P F     I ++E S 
Sbjct: 59  ELVGLCLAQSWIGQGQPARIALAELGPGRGTLMADILRATRNV-PGFHDAAEITLLEASP 117

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            L  IQ + L  +  +  W  ++ D+P    FLVANEFFD+LPI+QF+      RER++ 
Sbjct: 118 ALRHIQSETLRDHTPR--WIDAIDDLPDLPLFLVANEFFDALPIRQFLREGSSWRERLVG 175

Query: 181 IDQHDSLVFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
            D   SL F +G    +       SD   G + E        +  I+ ++   GG A++I
Sbjct: 176 GDG-TSLTFGLGPQTAQPALSERLSDTQDGDLVELCSATAPMLGFIAGQITRHGGVAMII 234

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG  +S +GDTLQAV+ H    PL +PGQADL++HVDF+ L+  A         LT QG
Sbjct: 235 DYGDWRS-LGDTLQAVRSHEVTDPLKDPGQADLTAHVDFETLALAAKAAGCAYTKLTPQG 293

Query: 300 KFLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKIL 348
            FLE LGI  RA SL      ++ + L+ + +RL  T  D+  MG LFK+L
Sbjct: 294 VFLERLGITGRARSLAAPLGGSQLETLVAAHRRL--THPDE--MGNLFKVL 340


>gi|296282188|ref|ZP_06860186.1| hypothetical protein CbatJ_01140 [Citromicrobium bathyomarinum
           JL354]
          Length = 331

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 128/324 (39%), Positives = 183/324 (56%), Gaps = 19/324 (5%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YY+  +P G+ GDF TAPEISQ+FGE++ ++L   W + G P     VELGPGRG +  D
Sbjct: 14  YYAARDPLGSAGDFTTAPEISQMFGELIGLWLADIWTRAGSPPDAIYVELGPGRGTLAAD 73

Query: 96  ILRVICK--LKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFL 153
            LR + +  L+P+      ++ VE S  L  +Q + +      ++++     +P G   L
Sbjct: 74  ALRSMARFGLQPE------VHFVEGSPALRSLQAEAVPG----VHFHDDPTSLPNGRPLL 123

Query: 154 -VANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLT-CSDYFLGAI 211
            VANEFFD+LP++Q V TE G RERM+ + + D   F  GD  + S      +D  +G I
Sbjct: 124 LVANEFFDALPVRQLVRTEKGWRERMVGLGEEDDFRFVAGDQPMDSAVPADRADAEVGVI 183

Query: 212 FENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
            E  P     +Q I+ RLA  GGTA++IDYG+L  R G TLQA+  H  V PLV PG AD
Sbjct: 184 VETCPAATAILQDIAQRLAVQGGTALMIDYGHLTPRTGSTLQAITRHEKVDPLVMPGAAD 243

Query: 272 LSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI-WQRAFSLMKQTARKDILLDSVKR 330
           L++HVDF  L+ +A      + G  TQG FL  LGI  + A        R + +  ++ R
Sbjct: 244 LTAHVDFAALAEVARREGARVLGSATQGAFLSALGIDARAAALAKAAPQRAEEIETALHR 303

Query: 331 LVSTSADKKSMGELFKILVVSHEK 354
           LVS     + MG+LFK+L ++H +
Sbjct: 304 LVS----GQQMGDLFKVLAIAHPQ 323


>gi|83952694|ref|ZP_00961424.1| hypothetical protein ISM_11090 [Roseovarius nubinhibens ISM]
 gi|83835829|gb|EAP75128.1| hypothetical protein ISM_11090 [Roseovarius nubinhibens ISM]
          Length = 353

 Score =  225 bits (574), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 193/354 (54%), Gaps = 33/354 (9%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I   I   G +++  Y  LC+  PE GYY T +P G  GDF+TAPEISQ+FGE++ + L 
Sbjct: 8   ISRQIAATGPISIADYMTLCLLHPEHGYYPTRDPLGVSGDFITAPEISQMFGELIGLALA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            +W   G P+   L ELGPGRG +M DILR   K+ P F +    +MVE S  L  +Q K
Sbjct: 68  QSWLDQGAPAPFALAELGPGRGTLMADILRATSKI-PGFHAAARPHMVEASPALRALQAK 126

Query: 129 QLA--SYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDS 186
            +   ++ D I+   +L ++PL   FLVANEFFD+LP++QF+      RER++ +D+  +
Sbjct: 127 AVPGVTHHDHID---TLPELPL---FLVANEFFDALPLRQFLRNGDQWRERLVGLDEGGA 180

Query: 187 LVFNIG--------DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           L F +         DH +       +D   G +   SP  +   +++  R+A  GG A++
Sbjct: 181 LCFGLAAPLPLRALDHRL-------ADTTEGDMVTLSPASEAMAETLGTRIATHGGVALL 233

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG  QS  GDT QAVK H    PL  PG ADL++HV+F  L+  A          T Q
Sbjct: 234 IDYGDWQS-AGDTFQAVKSHAKTDPLEAPGTADLTAHVEFASLARAAAPAAHSRA--TPQ 290

Query: 299 GKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           G FLE LGI  RA +L      A  D  + + +RL       + MG LFK++V+
Sbjct: 291 GVFLERLGITARAQALASGLTGAALDAHIAAHRRLTH----PEEMGTLFKVMVL 340


>gi|254441180|ref|ZP_05054673.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
 gi|198251258|gb|EDY75573.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
          Length = 368

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 143/375 (38%), Positives = 201/375 (53%), Gaps = 52/375 (13%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            KL   I   I   G +T+  Y A  +  P++GYY+T +P GA GDF TAPEISQ+FGE+
Sbjct: 2   TKLNDLIAARIAATGPITLADYMADALMHPKYGYYATRDPLGAAGDFTTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + + L  AW   G PS   LVELGPGRG +M DILR    +   F     +++VETS  L
Sbjct: 62  IGLSLAQAWIDQGHPSAFALVELGPGRGTLMSDILRATTSVS-GFADAAQVHLVETSPTL 120

Query: 123 TLIQKKQLASYGDKINWYT---SLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
              Q  +L +   K+ W+    +L D+PL   +LVANEFFD+LPI+QF      + +R  
Sbjct: 121 RHEQATRLNARQSKVTWHDDIGTLPDLPL---YLVANEFFDALPIRQFHRA--ALADRFA 175

Query: 180 DID---------QHDSLVFNIG--------DHEIKSNFLTCSDYFLGAIFENSPCRDREM 222
           D           Q+D+LV  +         DH I        D  +G + E+ P      
Sbjct: 176 DGAVWREVQFGLQNDTLVAGLSAAAPIAFLDHRIH-------DTNVGDVVEHCPALAAIT 228

Query: 223 QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
           + I++R+A  GG A++IDYG  +S +GDTLQA++ H    P  +PG+ D+++HVDF+ ++
Sbjct: 229 EDIANRIATHGGVALIIDYGDWRS-LGDTLQALQNHAAADPFAHPGETDITAHVDFEAIA 287

Query: 283 SIAILYKLYING------LTTQGKFLEGLGIWQRAFSLMKQTARKDIL---LDSVKRLVS 333
               +     NG      LTTQG FLE LGI +RA +L   T   D L   + + +RL  
Sbjct: 288 ----MATTSTNGGAKYTRLTTQGVFLERLGITKRAQTLAA-TLSGDALETHIAAHRRLTH 342

Query: 334 TSADKKSMGELFKIL 348
            S     MG LFK+L
Sbjct: 343 PS----EMGSLFKVL 353


>gi|170751782|ref|YP_001758042.1| hypothetical protein Mrad2831_5412 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170658304|gb|ACB27359.1| protein of unknown function DUF185 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 356

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/359 (37%), Positives = 188/359 (52%), Gaps = 11/359 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L  +I  LI++NG + VD+Y ALC+  P  GYY T +P GA GDF TAPEISQ+FGE+
Sbjct: 2   TPLGAEIAALIRQNGPIGVDRYMALCLGHPVHGYYRTRDPLGAQGDFTTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L  +        G P  + LVELGPGRG +M D LR +    P     ++ ++VETS  L
Sbjct: 62  LGAWTAYVRGSIGAPDPLLLVELGPGRGTLMADALRALRAALPGVR--VAPHLVETSPVL 119

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q + L+  G    W+ S+  +P G T ++ANEFFD LP++QF     G  ER I +D
Sbjct: 120 RAAQARALSGTG--AVWHDSVDTLPEGPTIILANEFFDCLPVRQFERRPSGWHERQIGLD 177

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
               L F +    +        D   GA+          +++++ RL   GG  +V+DYG
Sbjct: 178 SAGGLAFGLSPEPVPGLVADGPD---GALMSVPAAGLALIRALARRLVSGGGALLVVDYG 234

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           +++   GDTLQA+ GH +  PL  PG+ADL+ HVDF  L+  A      I+G   QG FL
Sbjct: 235 HVRPGFGDTLQALAGHRFADPLAEPGEADLTHHVDFAALAQAARAEGAAIHGPVDQGDFL 294

Query: 303 E--GLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
              GLG            A+   +  +V RL  T   +  MG LFK+L VS   +  +P
Sbjct: 295 AALGLGARAERLRARANPAQVTAIDAAVTRL--TDPGRGGMGRLFKVLAVSGPSLGPLP 351


>gi|16124746|ref|NP_419310.1| hypothetical protein CC_0491 [Caulobacter crescentus CB15]
 gi|221233461|ref|YP_002515897.1| cytosolic protein [Caulobacter crescentus NA1000]
 gi|13421668|gb|AAK22478.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220962633|gb|ACL93989.1| conserved hypothetical cytosolic protein [Caulobacter crescentus
           NA1000]
          Length = 374

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 132/363 (36%), Positives = 194/363 (53%), Gaps = 28/363 (7%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L+ ++   I ++G + V ++F  C+ DP  GYY+T    GA GDF+TAP +SQ+FGE++ 
Sbjct: 3   LLDRLKAQIAQDGPIGVPEFFTRCLHDPRDGYYATRPDLGAGGDFITAPLVSQMFGELIG 62

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           ++++  W + G P+  RLVE+GPG G +M D+LR   +L P F     +++VE SE L  
Sbjct: 63  LWVLETWTRMGRPAPFRLVEMGPGDGTLMSDLLRA-GRLDPAFLEAAQVWLVEVSEPL-- 119

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTF-LVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
            + +Q A  G+   W + L +VP G    LVANE  D LP +QF+ T  G  ER+I + +
Sbjct: 120 -KARQAARLGEGPRWASRLDEVPGGAPMILVANELLDCLPARQFIRTRTGWAERVIGLGE 178

Query: 184 HDSLVFNI----------GDHEIKSNFLTCSDYF--------LGAIFENSPCRDREMQSI 225
             +L F +          G      +    SD+          GA+ E+SP +      I
Sbjct: 179 GGALAFGLRAINPPPRGRGPVGHAPSPSGPSDHLPRWGEELEAGAVVESSPAQAALASDI 238

Query: 226 SDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
           + RL  DGG A++IDYG  +   GDTLQA++ H  V PL   G ADL+   DF  + + A
Sbjct: 239 AHRLVIDGGAALLIDYGRAELEPGDTLQAIQNHRKVDPLETAGLADLTVWADFPSVITAA 298

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSADKKSMGEL 344
                    + TQG FL  LGI QRA +L  +Q  R D +   + RL+     +  MGEL
Sbjct: 299 RDTGAKAGPILTQGAFLVALGIIQRAEALAARQPERGDQIARQLDRLIG----EAQMGEL 354

Query: 345 FKI 347
           FK+
Sbjct: 355 FKV 357


>gi|126735170|ref|ZP_01750916.1| hypothetical protein RCCS2_14874 [Roseobacter sp. CCS2]
 gi|126715725|gb|EBA12590.1| hypothetical protein RCCS2_14874 [Roseobacter sp. CCS2]
          Length = 352

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 194/355 (54%), Gaps = 18/355 (5%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           ++  I + G +++  Y A C+  PE GYY+T +PFGA GDF TAPEISQ+FGE++ + L 
Sbjct: 8   LIARIARTGPISLADYMADCLMHPEHGYYATRDPFGAAGDFTTAPEISQMFGELIGLSLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G P+   L ELGPGRG +M D LR   K  P F   L++++VETS  L   Q K
Sbjct: 68  QAWIDQGCPAPFTLAELGPGRGTLMADALRA-TKAVPGFHDALTVHLVETSPVLRAAQAK 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            +        W+ S+  +P    FL+ANEFFD+LPI+QF       RE+M+ +     L 
Sbjct: 127 LIP----DATWHDSVDHLPDAPLFLIANEFFDALPIRQFTRDGDAWREKMVGVTD-GKLG 181

Query: 189 FNI-GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           F +     I       +D   G + E+       + +IS ++   GG A++IDYG  QS+
Sbjct: 182 FGLSAAAPIALLEDRLADTKDGDLVEHCLALPSIVSTISAKIEMHGGCAVIIDYGDWQSQ 241

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
            GDTLQA+K   +  PL  PG ADL++HVDF  +++   L K   + LT QG FLE LGI
Sbjct: 242 -GDTLQALKSQDHADPLATPGDADLTAHVDFAAIAANTGLAKF--SRLTPQGVFLERLGI 298

Query: 308 WQRAFSLMKQTARKDILLDSV---KRLVSTSADKKSMGELFKILVVSHEKVELMP 359
            QRA +L  + +  D L   +   +RL   +     MG+LFK++ +        P
Sbjct: 299 TQRAQALATKLS-GDALTSHIAAHRRLTHPA----EMGDLFKVISIHPSNANPPP 348


>gi|254475299|ref|ZP_05088685.1| ATP synthase beta subunit/transription termination factor rho
           [Ruegeria sp. R11]
 gi|214029542|gb|EEB70377.1| ATP synthase beta subunit/transription termination factor rho
           [Ruegeria sp. R11]
          Length = 356

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 134/365 (36%), Positives = 208/365 (56%), Gaps = 27/365 (7%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I+  I+ +G ++V  Y A  +  P +GYY+T +P GA GDF TAPEISQ+FGE++ + L 
Sbjct: 7   IIARIRTDGPISVADYMAEALLHPTYGYYTTRDPLGASGDFTTAPEISQMFGELIGLALA 66

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
             W   G P+   L ELGPGRG +M D+LR   K  P F + + I ++E S  L   Q +
Sbjct: 67  QTWIDQGSPTPFTLAELGPGRGTLMADVLRA-TKAVPGFHAAMRISLLEASPTLRKRQAE 125

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            L+ Y     W+ ++ ++P    FLVANEFFD+LP++QF+    G RE+ + + +  +L 
Sbjct: 126 ALSGYA--ATWHENIEELPDQALFLVANEFFDALPVRQFLRDGEGWREKSVGLSEDGALQ 183

Query: 189 FNIG--------DHEIKSNFLTCSDYFLGAIFENS-PCRDREMQSISDRLACDGGTAIVI 239
           F +G         H I+      SD  L  + E + P     + +++ R+A  GG A+++
Sbjct: 184 FGLGPVAPQPALSHRIEDT----SDNDLVELCEAAQPI----VSTLAQRIAAYGGCALIV 235

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG  +S +GDTLQA++ H    PL++PG+ADL++HVDF+ L+  A       + +T QG
Sbjct: 236 DYGDWRS-LGDTLQALRSHAPSDPLLSPGEADLTTHVDFEALALAAKSAGAEFSRVTPQG 294

Query: 300 KFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
            FLE LGI  RA +L  + + +  D L+ + +RL       + MG LFK+L +   ++  
Sbjct: 295 VFLERLGITARAQALAARLSGQQLDQLIAAHRRLTH----PEEMGNLFKVLALYPAQMTP 350

Query: 358 MPFVN 362
            P +N
Sbjct: 351 PPGLN 355


>gi|254450658|ref|ZP_05064095.1| ATP synthase beta subunit/transription termination factor rho
           [Octadecabacter antarcticus 238]
 gi|198265064|gb|EDY89334.1| ATP synthase beta subunit/transription termination factor rho
           [Octadecabacter antarcticus 238]
          Length = 364

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 141/363 (38%), Positives = 201/363 (55%), Gaps = 44/363 (12%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I   I+ +G +T+  Y A  +  P++GYY+T +P GA GDF TAPEISQ+FGE++ + L 
Sbjct: 8   ITARIQTSGPITLADYMADALMHPKYGYYATRDPLGAAGDFTTAPEISQMFGELIGLSLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G PS   L ELGPGRG +M DILR   K+   F     +++VETS  L   Q +
Sbjct: 68  QAWIDQGQPSTFALAELGPGRGTLMADILRATAKVV-GFVDAAQVHLVETSPALRKKQAE 126

Query: 129 QLASYGDKINWY---TSLADVPLGFTFLVANEFFDSLPIKQFVMTE----HGIRERMIDI 181
            ++     + W+   ++L D+PL   FLVANEFFD+LPI+QF         G RE  I +
Sbjct: 127 LMSGPHTNVTWHDDVSTLPDMPL---FLVANEFFDALPIRQFHRATPADGSGWRELQIGL 183

Query: 182 DQHDSLVFNIG--------DHEI---KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLA 230
            Q  +LV  +         +H +   K++ +      L AI EN          I++R+A
Sbjct: 184 -QDGTLVAGLSAAAPIAFLEHRLGNTKASDIVEHCTALAAITEN----------IANRIA 232

Query: 231 CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK- 289
             GG A+++DYG  +S +GDTLQA++ H    P  NPG+AD+++HVDF+ ++  A     
Sbjct: 233 TSGGAALIVDYGDWRS-LGDTLQALQNHASTDPFANPGEADITAHVDFEAIAMTAASTNG 291

Query: 290 --LYINGLTTQGKFLEGLGIWQRAFSLMKQTARK--DILLDSVKRLVSTSADKKSMGELF 345
             +Y   LTTQG FLE LGI QRA +L    +    D  + + +RL   S     MG LF
Sbjct: 292 GAIYTQ-LTTQGVFLERLGIAQRAQTLAANLSGDALDAHITAHRRLTHPS----EMGSLF 346

Query: 346 KIL 348
           K+L
Sbjct: 347 KVL 349


>gi|149916086|ref|ZP_01904608.1| hypothetical protein RAZWK3B_10522 [Roseobacter sp. AzwK-3b]
 gi|149809941|gb|EDM69790.1| hypothetical protein RAZWK3B_10522 [Roseobacter sp. AzwK-3b]
          Length = 366

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 194/364 (53%), Gaps = 22/364 (6%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           ++  I+ +G MT+ +Y A C+  PE GYY+T +P GA GDF TAPEISQ+FGE+L + L 
Sbjct: 8   LIARIRADGPMTLAEYMADCLMHPEHGYYATRDPLGAAGDFTTAPEISQMFGELLGLSLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G P  + L E GPGRG +M D+LR   +  P F + + +++VETS  L  +Q  
Sbjct: 68  QAWMDQGSPEGITLAECGPGRGTLMADVLRA-TRAVPGFHAAMRVHLVETSATLRAVQGA 126

Query: 129 QLA-SYG---------DKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERM 178
            L  S G         D I W+  +  +P    FL+ANEFFD+LPI+Q        RER 
Sbjct: 127 TLGKSLGKSLGKSLGRDDITWHDHVDALPDAPLFLLANEFFDALPIRQLQREGGMWRERC 186

Query: 179 IDIDQHDSLVFNI-GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
           + +   D+L   +     + +      D   G I E          +I  R+   GG A+
Sbjct: 187 VGLSG-DALALGVSAPKPVAALAHRMEDTRDGDIVEICAGAQAMAGAIGARIGARGGAAL 245

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           ++DYG  +S +GDT QAV GH    PL +PG ADL++HVDF+ L+  A   K   + LT 
Sbjct: 246 IVDYGDWRS-LGDTFQAVAGHEAADPLADPGGADLTAHVDFEALAQAAAPAKH--SRLTP 302

Query: 298 QGKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKV 355
           QG FLE LGI  RA +L +  + A  D  + + +RL   +     MG +FK+L +  E  
Sbjct: 303 QGVFLERLGITARAQALAQGLEGAALDAHVAAHRRLTHPA----EMGTVFKVLGLFPETA 358

Query: 356 ELMP 359
              P
Sbjct: 359 PPPP 362


>gi|295687993|ref|YP_003591686.1| hypothetical protein Cseg_0556 [Caulobacter segnis ATCC 21756]
 gi|295429896|gb|ADG09068.1| protein of unknown function DUF185 [Caulobacter segnis ATCC 21756]
          Length = 383

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 131/371 (35%), Positives = 192/371 (51%), Gaps = 35/371 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L+ ++   I ++G +   ++F  C+ DP  GYY+T    GA GDF+TAP +SQ+FGE++ 
Sbjct: 3   LLDRLKAQIAQDGPIGAPEFFTRCLHDPRDGYYATRPDLGASGDFITAPLVSQMFGELIG 62

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           +++I  W + G P+  RLVE+GPG G +M D+LR   +L PDF +   +++VE S+ L  
Sbjct: 63  LWVIETWTRMGRPAPFRLVEMGPGDGALMSDLLRA-ARLAPDFLAATDVWLVEVSQPLKA 121

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTF-LVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
            Q ++L   G++  W + L +VP G    LVANE  D LP +QFV T+ G  ER+I + +
Sbjct: 122 RQAERL---GERPRWASRLDEVPGGAPMILVANELLDCLPARQFVRTKDGWAERVIGLGE 178

Query: 184 HDSLVFNIGDHEI-------------------------KSNFLTC--SDYFLGAIFENSP 216
              L F +                               S  L     D+ +GA+ E SP
Sbjct: 179 DGDLAFGLRSLSPPPRGGGGRGATGGGSSSGPASSPSDASRHLPPQGEDFPVGAVVETSP 238

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
            +      I+ RL  DGG A++IDYG  +   GDTLQAV+ H  V PL   G ADL+   
Sbjct: 239 AQAALASEIAHRLVTDGGAALLIDYGRAEPEAGDTLQAVQNHQKVDPLKTAGLADLTVWA 298

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSA 336
           DF  + + A         + TQG+FL  LGI  RA +L    AR+    D + R +    
Sbjct: 299 DFPSVVAAARDTGAKAGPILTQGQFLVALGILDRAEAL---AARQPEKTDQIGRQLDRLL 355

Query: 337 DKKSMGELFKI 347
            +  MG LFK+
Sbjct: 356 GEAQMGTLFKV 366


>gi|126725164|ref|ZP_01741007.1| hypothetical protein RB2150_15051 [Rhodobacterales bacterium
           HTCC2150]
 gi|126706328|gb|EBA05418.1| hypothetical protein RB2150_15051 [Rhodobacterales bacterium
           HTCC2150]
          Length = 354

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 190/348 (54%), Gaps = 10/348 (2%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I  +G +++  Y A C+  PE GYYS  +PFGA GDF TAPEISQ+FGE+L ++L  +W 
Sbjct: 12  IGNHGPISIADYMAECLLHPELGYYSRRDPFGAKGDFTTAPEISQMFGELLGLWLAQSWI 71

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P    L E+GPGRG +M D+ R   K  P F      Y++E S  L  +QK  L  
Sbjct: 72  DAGQPPSFVLAEIGPGRGTLMADVWRA-TKGVPGFHDAAKPYLIEASAHLRSVQKATLG- 129

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
            G   NW  ++ ++P    FL+ANEFFD+LPI+Q+   + G  E +I  +  D L F   
Sbjct: 130 -GVNANWVGTIDELPDAPLFLLANEFFDALPIRQYKRQKSGWSELLIGGNA-DGLCFGQA 187

Query: 193 DHEIKSNF-LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDT 251
                ++      D   G + E        M++++DR+  +GG A+V+DYG  +S +G T
Sbjct: 188 APSPNTSLDHRLDDTNEGDLVEVCSAMQGVMETVNDRIKTNGGVALVVDYGDWRS-LGST 246

Query: 252 LQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRA 311
           LQA+K H +V  L N G+ADL++HVDF+ L++ A    L  + LT QG FL+ LGI  RA
Sbjct: 247 LQAIKSHAFVDVLTNSGEADLTAHVDFEALANAAP--DLNYSRLTPQGIFLQRLGIDHRA 304

Query: 312 FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             L  Q +   +          T+AD+  MG LFK++        L P
Sbjct: 305 EVLGNQLSGAALESHKAAHHRLTAADE--MGTLFKVMAFYAPNSPLPP 350


>gi|114770207|ref|ZP_01447745.1| hypothetical protein OM2255_11240 [alpha proteobacterium HTCC2255]
 gi|114549044|gb|EAU51927.1| hypothetical protein OM2255_11240 [alpha proteobacterium HTCC2255]
          Length = 354

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 199/351 (56%), Gaps = 12/351 (3%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I   IK+ G M V +Y  LC+  PE GYY+  +  GA GDF TAPEISQ+FGE++ + + 
Sbjct: 8   IKKQIKRFGPMPVSEYMTLCLLHPEHGYYTNRDALGATGDFTTAPEISQMFGELIGLSIA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            +W     P+   L ELGPG G +M DILR   K  P+F + + ++++E S  +   +++
Sbjct: 68  QSWIDQEMPTPFILAELGPGNGTLMADILRA-TKSVPNFHASMDLHLIEASPEMR--KRQ 124

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
           + A  G  + W    +++P    FL+ANEFFD LPIKQ+  T+ G +E+MI + +++ L 
Sbjct: 125 ETALNGFNVTWLNYFSELPQKPLFLIANEFFDCLPIKQYRRTDEGWQEQMIAV-ENEQLH 183

Query: 189 FNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRV 248
           F +G    +  F   +D     + E SP       +I + +  +GG AI++DYG   S  
Sbjct: 184 FILGTATSEEVFSKTNDVPSADMLEVSPPTVAFASAIGEHIQGNGGCAIIVDYGEWDSD- 242

Query: 249 GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIW 308
           GD+LQA+K H  + PL + G ADL++HV F+ L++ A  Y   ++    QG  LE LGI 
Sbjct: 243 GDSLQALKDHRKIDPLTHCGTADLTAHVSFKDLTNAASKYA-KVSSTIPQGILLERLGIT 301

Query: 309 QRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
           QRA +L K  + K +   + + KRL  T  D+  MG LFK + +  E  +L
Sbjct: 302 QRAQTLAKNMSGKKLENHISAHKRL--THPDE--MGSLFKAIAIIPENTDL 348


>gi|304321295|ref|YP_003854938.1| hypothetical protein PB2503_08704 [Parvularcula bermudensis
           HTCC2503]
 gi|303300197|gb|ADM09796.1| hypothetical protein PB2503_08704 [Parvularcula bermudensis
           HTCC2503]
          Length = 362

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 133/361 (36%), Positives = 185/361 (51%), Gaps = 9/361 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L   +   I K G ++V  Y A  +  PEFGYY T +P GA GDF TAPEISQ+FGEM
Sbjct: 4   TPLAPLLAKRIDKEGPLSVGAYMAEALGHPEFGYYMTRDPLGAEGDFTTAPEISQLFGEM 63

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +  FL+ +W     P  V L E GPGRG +M D+LRV  KL+PDF       ++ETS  L
Sbjct: 64  IGGFLLASWAAMAAPRPVTLAEFGPGRGTLMADMLRV-AKLRPDFLEAAEAVLLETSPVL 122

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHG--IRERMID 180
              Q++ L+S    + W    A +P G   L+ANEFFD LPI+QFV    G   RER++ 
Sbjct: 123 RSRQRETLSSPPLPLRWIEDAAALPSGPLLLIANEFFDCLPIRQFVRAGTGPLFRERLVT 182

Query: 181 IDQHDS-LVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
             +    L + + +          +      I E        ++ +  RL    G  ++I
Sbjct: 183 TGEMPGQLAYCLSEETYSPPPGAAAHGPPEEIVETCAPAHALIEVLIPRLTAAPGLVLII 242

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG  +   GDT QAVK H +  PL  PG+ADL++HV+F  L+  A    L + G  +Q 
Sbjct: 243 DYGAGRRGSGDTFQAVKNHQFHHPLALPGEADLTAHVNFAALADTARRGGLGVYGPISQS 302

Query: 300 KFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
           +FL  LG+  RA  L     A K  +   V+RLV     +  MG LF++L ++     + 
Sbjct: 303 RFLTALGLPARADQLAGANPAAKAAIAQQVERLVG----QDQMGTLFQVLCLTSPGSPVP 358

Query: 359 P 359
           P
Sbjct: 359 P 359


>gi|149201041|ref|ZP_01878016.1| hypothetical protein RTM1035_15487 [Roseovarius sp. TM1035]
 gi|149145374|gb|EDM33400.1| hypothetical protein RTM1035_15487 [Roseovarius sp. TM1035]
          Length = 353

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 134/349 (38%), Positives = 189/349 (54%), Gaps = 13/349 (3%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I + G M++  Y A+C+  PEFGYY+T +PFGA GDF+TAPEISQ+FGE+L + L   W 
Sbjct: 12  IAEAGPMSLADYMAVCLMHPEFGYYATRDPFGARGDFITAPEISQMFGELLGLCLAQVWL 71

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P+   L ELGPGRG +M D+LR   ++ P F     +++VE S  L   Q++ +A 
Sbjct: 72  DQGRPARFLLAELGPGRGTLMADVLRATQRV-PGFREAAEVHLVEGSAVLRAAQRRAIA- 129

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
            GD I W+  +  +P G  +L+ANEFFD+LPI+QF  +  G RER++       L+   G
Sbjct: 130 -GDVI-WHERVESLPEGPLYLLANEFFDALPIRQFQRSGEGWRERVVGQSAGQLLLGLGG 187

Query: 193 DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTL 252
                +      D   G I E        M  I  R+   GG A+++DYG  +S +GDT 
Sbjct: 188 PVAPPALAERLVDTREGDIVETCGPAAAVMAEIGARIEGQGGAALIVDYGDWRS-LGDTF 246

Query: 253 QAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAF 312
           QA+K H  V PL  PG ADL++HVDF+  +            LT QG FLE LGI  RA 
Sbjct: 247 QALKAHQPVDPLAEPGAADLTAHVDFE--ALALAAAPALHTRLTPQGVFLERLGIAARAE 304

Query: 313 SLMKQTARK--DILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           +L +  +    +  L + +RL       + MG L K++ +  E     P
Sbjct: 305 ALARNLSGPALETHLAAYQRLTGA----EEMGTLLKVMGLYPEGAAPPP 349


>gi|288959074|ref|YP_003449415.1| hypothetical protein AZL_022330 [Azospirillum sp. B510]
 gi|288911382|dbj|BAI72871.1| hypothetical protein AZL_022330 [Azospirillum sp. B510]
          Length = 385

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 141/364 (38%), Positives = 200/364 (54%), Gaps = 23/364 (6%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L R +   I  +G ++V  + A  +  P FGYY   +PFG+ GDF TAPEISQ+FGE+
Sbjct: 16  ESLARLLARRILMDGPISVATFMAEALGHPRFGYYMRRDPFGSGGDFTTAPEISQMFGEL 75

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++ + +W + G P    LVELGPGRG +M D+LR    L P F    +I++VETS  L
Sbjct: 76  VGLWCVDSWARLGGPGPFHLVELGPGRGTLMADVLRAAAVL-PLFRDSATIHLVETSPAL 134

Query: 123 TLIQKKQLAS-YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
              Q++ L    G+ + W+  L DVP G T L+ANEFFD+LPI+Q   T HG  ER++D+
Sbjct: 135 RERQRETLRPILGEAVRWHDRLEDVPDGPTILIANEFFDALPIRQVQKTNHGWFERLVDV 194

Query: 182 DQHDSL-----------VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLA 230
           D  DSL            F    + +  + L   D   G + E SP      + I  RLA
Sbjct: 195 DP-DSLEDDPRFRFVLEAFGSSGNRLVPDSL--RDAPEGCVVEVSPASQAVARLIGARLA 251

Query: 231 CDGGTAIVIDYGYLQS-RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK 289
              G A+VIDYGY +   VGD+LQA++ H Y   L  PG+ADL++HVDF  ++  A    
Sbjct: 252 AAPGAALVIDYGYGRGPAVGDSLQAMRRHAYAPVLEAPGEADLTAHVDFATIAVAAREGG 311

Query: 290 LYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTSADKKSMGELFKI 347
               G   QG +L  LGI QRA +L  +   A+   +  ++ RL+    D   MG LFK+
Sbjct: 312 AQPFGPVEQGDWLTRLGIRQRASALAAKASPAQARDIGAALDRLI----DPAQMGRLFKL 367

Query: 348 LVVS 351
           + ++
Sbjct: 368 VALA 371


>gi|103485980|ref|YP_615541.1| hypothetical protein Sala_0487 [Sphingopyxis alaskensis RB2256]
 gi|98976057|gb|ABF52208.1| protein of unknown function DUF185 [Sphingopyxis alaskensis RB2256]
          Length = 356

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 188/349 (53%), Gaps = 26/349 (7%)

Query: 7   RKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIF 66
           R+++N I     +TV  Y A   A     YY+T +P GA GDF TAPEISQ+FGEM+ I+
Sbjct: 11  RQLINDIAAARPVTVADYMAAANAH----YYATRDPLGAAGDFTTAPEISQMFGEMVGIW 66

Query: 67  LICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQ 126
           +   W + G P+  R VELGPGRG +  D LR + +        + I++VETS  L   Q
Sbjct: 67  IADLWTRAGNPA-FRYVELGPGRGTLAADALRTMARFG---CEPVGIHLVETSPALRAAQ 122

Query: 127 KKQL--ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI--D 182
             +L  A + D+++      D PL    +VANEFFD+LPI Q+V T  G RERM+    D
Sbjct: 123 LARLPAAQHHDEVDALPG--DAPL---LIVANEFFDALPIHQYVRTADGWRERMVGRAGD 177

Query: 183 QHDSLVFNI-GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
              ++  ++  D  I +     ++   G I E  P     MQ  + RL+  GG  + IDY
Sbjct: 178 ARMAVAGDVSADEAIPAALRGAAE---GTIVETMPVAAAIMQRCAFRLSRQGGAMLAIDY 234

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           GY     GDTLQAVK H +  P  +PG+ADL++HVDF  L+  A    + + G + QG +
Sbjct: 235 GYTGPAAGDTLQAVKAHGFADPFADPGEADLTAHVDFAALADAARSGGVAVAGPSPQGAW 294

Query: 302 LEGLGIWQRAFSLMKQT-ARKDILLDSVKRLVSTSADKKSMGELFKILV 349
           L  +GI  R  SL+    AR D L     RLV+  A    MGELFK + 
Sbjct: 295 LRRMGIDARLASLVAAAPARADELQGRRDRLVNADA----MGELFKAIA 339


>gi|89070837|ref|ZP_01158082.1| hypothetical protein OG2516_14036 [Oceanicola granulosus HTCC2516]
 gi|89043575|gb|EAR49784.1| hypothetical protein OG2516_14036 [Oceanicola granulosus HTCC2516]
          Length = 362

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 195/352 (55%), Gaps = 26/352 (7%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
           ++IR+ + +    G +TV  Y ALC+  PE G Y+  +P GA G F TAPEISQ+FGE+L
Sbjct: 5   EIIRRQIAMA---GPLTVADYMALCLNHPEHGVYAGIDPLGAGGHFTTAPEISQMFGELL 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            + L  AW   G P+   L ELGPGRG +M D+LR   +  P F +   +++VETS  L 
Sbjct: 62  GLALAQAWLDQGAPAPFALAELGPGRGTLMADVLRA-ARGVPGFAAAAELHLVETSPALR 120

Query: 124 LIQKKQLASYGDKINWYTSLA----DVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             Q+ +L +      W+ ++A    D PL   FL+ANEFFD LP++QF+    G RER+I
Sbjct: 121 DAQRDRLGA----ATWHDTVATLPDDRPL---FLLANEFFDVLPVRQFLRDGEGWRERVI 173

Query: 180 DIDQHDSLVFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
            +D+H +  F +             +D   G + E+ P      ++I  R+A  GG A++
Sbjct: 174 ALDEHGAPTFGLTPAAPLERLADRLADTAEGDMVEHCPALAPVAEAIGARIAAQGGAALI 233

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           +DYG  +  +GD+LQA++ H  + PL  PG ADL++HVDF  L++           LT Q
Sbjct: 234 VDYGDWRP-LGDSLQALRRHEKIDPLDAPGSADLTAHVDFAALAAARPAGH---TALTPQ 289

Query: 299 GKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           G FLE LGI +RA  L    + A  +  L + +RL   +     MG LFK++
Sbjct: 290 GVFLERLGIAERARQLAAGLEGAALEAHLAAHRRLTHPA----EMGHLFKVM 337


>gi|163742925|ref|ZP_02150309.1| hypothetical protein RG210_12425 [Phaeobacter gallaeciensis 2.10]
 gi|161383889|gb|EDQ08274.1| hypothetical protein RG210_12425 [Phaeobacter gallaeciensis 2.10]
          Length = 355

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 131/359 (36%), Positives = 193/359 (53%), Gaps = 14/359 (3%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           +I + I+  G + V  Y A  +  P +GYY+T +P G  GDF+TAPEISQ+FGE++ + L
Sbjct: 6   RIASRIRTEGPIPVADYMAEALLHPTYGYYTTRDPLGRAGDFITAPEISQMFGELIGLAL 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              W   G P    L ELGPGRG +M D+LR   K  P F   + I ++E S  L   Q 
Sbjct: 66  AQCWLDQGSPKPFTLAELGPGRGTLMADLLRA-TKQVPGFHDAMQIALLEASPTLRSRQA 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
           + L+  G    W  +L  +P    FL+ANEFFD+LP++QF+    G RE+ + + Q   L
Sbjct: 125 ETLS--GSTPLWLDTLEALPEQPLFLIANEFFDALPVRQFLRDGDGWREKSVGL-QDGKL 181

Query: 188 VFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQS 246
            F +G    +        D     + E        +Q+I+ R+A  GG A+++DYG  +S
Sbjct: 182 SFGLGAAAPQPALAHRLEDTRDDDLVELCEAAQPMVQTIAARIATHGGAALIVDYGDWRS 241

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
            +GDTLQA++ H    PL +PG ADL++HVDF+ L+  A       + LT QG FLE LG
Sbjct: 242 -LGDTLQALRAHAPSDPLKDPGSADLTTHVDFEALALTAKAAGCTHSRLTPQGVFLERLG 300

Query: 307 IWQRAFSLMKQTARKDILLDSVKRLVSTS---ADKKSMGELFKILVVSHEKVELMPFVN 362
           I  RA +L  +     +  DS++ L++        + MG LFK+L +   +    P +N
Sbjct: 301 ITDRAQALAAR-----LEGDSLQSLIAAHRRLTHPEEMGNLFKVLGIFPMQASPPPGLN 354


>gi|144899708|emb|CAM76572.1| protein containing DUF185 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 350

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 193/363 (53%), Gaps = 24/363 (6%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L  K+   I + G +TV  +    V      YY+T +PFG  GDF TAPE+SQ+FGE+
Sbjct: 2   RSLAEKLAARIAQGGPITVADFMHEAVGQ----YYATRDPFGRQGDFTTAPEVSQMFGEL 57

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++ +  W+  G P  V L ELGPGRG +M D+LR    + P F     I +VETS RL
Sbjct: 58  IGLWCVMVWQMMGAPDKVVLAELGPGRGTLMNDLLRA-AGVVPAFLKAADIRLVETSPRL 116

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           T +Q++ L+  G  + W  ++  +P G   ++ANE FD+LPI+QFV  +    ERM+ +D
Sbjct: 117 TALQRQTLS--GRDVQWCENVDQLPDGPLIVIANELFDALPIRQFVKADGQWCERMVGLD 174

Query: 183 QHDSLVFNIG---DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
             D   F  G   D ++ +  L   D   GAI E          S+  RL    G A++I
Sbjct: 175 -GDGFCFVAGPAADPDLPAEVLATPD---GAIVETCDGGRALAASLGKRLNRQPGFALII 230

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG+ +S  GDTLQAV+ H +   L  PG AD+++HVDFQ L+  A+  + +  G   QG
Sbjct: 231 DYGHGRSGTGDTLQAVRHHRFHPVLDQPGLADITAHVDFQALAGAAVPARAW--GPVDQG 288

Query: 300 KFLEGLGIWQRAFSLMKQTARK---DILLDSVKRLVSTSADKKSMGELFKILVVSHEKVE 356
            FL  LGI  RA  L +    K   DI +  ++RL+    D   MG LFK L ++     
Sbjct: 289 GFLRALGIETRAHLLAQAGGDKVAADI-MGQLRRLI----DPGEMGTLFKALALASPHFP 343

Query: 357 LMP 359
             P
Sbjct: 344 APP 346


>gi|326386423|ref|ZP_08208046.1| hypothetical protein Y88_2317 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209084|gb|EGD59878.1| hypothetical protein Y88_2317 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 364

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 132/352 (37%), Positives = 190/352 (53%), Gaps = 28/352 (7%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
           +L  + V LI   G ++V Q+    VA+    YY + +P G+ GDF+TAPEISQ+FGE++
Sbjct: 17  RLKDRFVRLIAATGPISVAQF----VAESNARYYDSRDPLGSAGDFITAPEISQMFGELI 72

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICK--LKPDFFSVLSIYMVETSER 121
            ++L   W++ G P  +  VELGPGRG +  D L    +  L P+      I+ VE S  
Sbjct: 73  GLWLADMWDRAGRPGPIHYVELGPGRGTLARDALGAARRFGLSPE------IHFVEGSTA 126

Query: 122 LTLIQKKQLASYGDKINWYTSLADVP-LGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           L  +Q+    S+  K +W+  LA +P  G   +VANEF D+LPI+Q VMT  G RERM+ 
Sbjct: 127 LRAVQQ----SHFPKAHWHDDLASLPETGPLLIVANEFLDALPIRQLVMTASGWRERMVG 182

Query: 181 IDQHDSLVFNIG----DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
           I + D LV   G    D  + +   +  +   GAI E SP      + I+ RLA  GG A
Sbjct: 183 I-EGDRLVPIAGTQPMDAAVPAELASAHE---GAILETSPAAAAVTREIARRLATQGGAA 238

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           +VIDYG  +   G +LQA++ HT V+P   PG+ADL++HVDF  L  +         G  
Sbjct: 239 LVIDYGRAEPAYGSSLQALRAHTKVNPFECPGEADLTAHVDFSVLRPVVEAEGARWLGTV 298

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
            QG FL  LG+  R  +L +    K     +V+      A  ++MG LFK++
Sbjct: 299 EQGAFLISLGLGPRMEALCRAAPDK---AQAVRAAAHRLAAPEAMGSLFKVM 347


>gi|83859400|ref|ZP_00952921.1| hypothetical protein OA2633_13385 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852847|gb|EAP90700.1| hypothetical protein OA2633_13385 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 378

 Score =  218 bits (556), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 127/362 (35%), Positives = 186/362 (51%), Gaps = 13/362 (3%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           ++   I+  G ++V  + A  +  P  G+Y+T +P GA  DF+TAPEISQ+FGE+L ++ 
Sbjct: 15  RLAERIRTEGSLSVAAFMAEALFHPMAGFYATKDPLGAANDFITAPEISQMFGELLGLWA 74

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              W Q G PS   L+ELGPG G MM D+LR   +  P F   + + ++E S  L ++Q 
Sbjct: 75  AECWMQMGAPSRFELIELGPGTGRMMSDMLRA-GRAAPGFLDAVHVTLIEASPALKMVQG 133

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
           + LAS    INW       P G   ++ NEF D LPI+Q +  +   RER++ +   D  
Sbjct: 134 QTLASASVPINWAKDFDKAPSGPAVVIGNEFLDCLPIRQAIRHKGQWRERVVTLHPEDEA 193

Query: 188 VF------NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
            F       +G+ ++        +   G + E  P   +++  ++ R   D G A+ +DY
Sbjct: 194 RFVYGLGPVLGEADVAFIAPGLREADDGTLVELRPGDQQQIDQLAARFDRDPGYALFVDY 253

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G  +   GDTLQA++ H  V PL  PG ADL++ VDF RL  +     L   G  TQG F
Sbjct: 254 GSAKPETGDTLQAIRAHQKVDPLDAPGTADLTAWVDFDRLLRLGEDAGLSAFGPMTQGDF 313

Query: 302 LEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           L  LGI QRA  L +    A +  L   + RLVS     + MG LFK+   S E +   P
Sbjct: 314 LTELGIEQRAAVLSRSVDEAGQAKLKRQMHRLVS----PEDMGTLFKLAAFSSEGLPPAP 369

Query: 360 FV 361
            +
Sbjct: 370 GI 371


>gi|163737769|ref|ZP_02145186.1| hypothetical protein RGBS107_19598 [Phaeobacter gallaeciensis
           BS107]
 gi|161389295|gb|EDQ13647.1| hypothetical protein RGBS107_19598 [Phaeobacter gallaeciensis
           BS107]
          Length = 355

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 132/362 (36%), Positives = 194/362 (53%), Gaps = 12/362 (3%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L  +I + I+  G ++V  Y A  +  P +GYY+T +P G  GDF+TAPEISQ+FGE++
Sbjct: 2   SLSERIASRIRTEGPISVADYMAEALLHPTYGYYTTRDPLGRAGDFITAPEISQMFGEVI 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            + L   W   G P    L ELGPGRG +M D+LR   K  P F   + I ++E S  L 
Sbjct: 62  GLALAQCWLDQGSPKPFTLAELGPGRGTLMADLLRA-TKQVPGFHDAMQIALLEASPTLR 120

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
             Q + L+  G    W  +L  +P    FL+ANEFFD+LP++QF+    G RE+ + + Q
Sbjct: 121 SRQAETLS--GHTPLWLDTLEALPEQPLFLIANEFFDALPVRQFLRDGDGWREKSVGL-Q 177

Query: 184 HDSLVFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
              L F +G    +        D     + E        +Q+I+ R+A  GG A+++DYG
Sbjct: 178 DGKLSFGLGAAAPQPALAHRLEDTRDDDLVELCEAAQPMVQTIAARIATHGGAALIVDYG 237

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
             +S +GDTLQA++ H    PL +PG ADL++HVDF+ L+  A       + LT QG FL
Sbjct: 238 DWRS-LGDTLQALRAHAPSDPLNDPGSADLTTHVDFEALTLAAKAAGCTHSRLTPQGVFL 296

Query: 303 EGLGIWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
           E LGI  RA +L  +     +  L+ + +RL       + MG LFK+L +   +    P 
Sbjct: 297 ERLGITDRAQALAARLEGDSLQSLIVAHRRLTH----PEEMGNLFKVLGIFPMQASPPPG 352

Query: 361 VN 362
           +N
Sbjct: 353 LN 354


>gi|119384944|ref|YP_916000.1| hypothetical protein Pden_2212 [Paracoccus denitrificans PD1222]
 gi|119374711|gb|ABL70304.1| protein of unknown function DUF185 [Paracoccus denitrificans
           PD1222]
          Length = 355

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/347 (36%), Positives = 185/347 (53%), Gaps = 15/347 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L R I   I+ +G M +D+Y  LC+  PE GYY+T +PFG  GDF TAPEISQ+FGEM
Sbjct: 2   TPLARLIATRIRLSGPMALDEYMRLCLLHPEHGYYATRDPFGTAGDFTTAPEISQMFGEM 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + + L  AW   G P+   L E+GPGRG +M DILR I ++ P       + +VE S  L
Sbjct: 62  IGLALGQAWLDQGRPAPFTLAEIGPGRGTLMADILRAI-RIVPGMAEAARVALVEASPHL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             +Q+ +L     +I     ++ +P     LVANEFFD+LPI+QF     G  ER++ +D
Sbjct: 121 RRVQRDRLG----EIVHLDDVSQLPQAPLLLVANEFFDALPIRQFQRGAQGWAERVVALD 176

Query: 183 QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
               L   +      ++     +   G I E  P     +  ++ R+A  GG AIV+DYG
Sbjct: 177 AQGGLEMGLLPIPGDASLPLAPE---GVIRETCPEAAPIVAQVAGRIAAHGGCAIVVDYG 233

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
               + GDT QA++ H     L NPG+ADL++HVDF  L++      +  + +  QG +L
Sbjct: 234 GWDGQ-GDTFQALRRHRPEDVLANPGEADLTAHVDFAPLAAAGRAAGVRASRMVAQGDWL 292

Query: 303 EGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILV 349
             LGI  RA  L +  A  +  + ++ RL +       MG LFK+L 
Sbjct: 293 LRLGIESRAQQLAR--AGDEGAMAALHRLTAPG----EMGHLFKVLA 333


>gi|126461008|ref|YP_001042122.1| hypothetical protein Rsph17029_0231 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102672|gb|ABN75350.1| protein of unknown function DUF185 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 353

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 163/284 (57%), Gaps = 6/284 (2%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L   +   I   G +TV  Y A C+  PE GYYST  PFGA GDF TAPEISQ+FGE+
Sbjct: 2   TALAALLARRIGATGPVTVADYMAECLLHPEHGYYSTREPFGAAGDFTTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L + L  AW   G PS V L ELGPGRG +M D+LR   +  P F     +++VE S RL
Sbjct: 62  LGLCLAQAWLDQGQPSPVTLAELGPGRGTLMADLLRAT-RGVPGFHDAARVHLVEASPRL 120

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             +Q++ L   G    W    AD+P G  FLVANEFFD+LPI+QFV    G RERM+ + 
Sbjct: 121 RALQREMLG--GHPAAWLDRAADLPEGPLFLVANEFFDALPIRQFVRGPEGWRERMVGLT 178

Query: 183 QHDSLVFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
           +   L + +G     +       D   G + E  P     M  I+ R+A  GG A+ +DY
Sbjct: 179 E-GRLTWGLGPETALAALAHRLEDTAPGDVVELCPAAGPIMAEIARRIAAAGGLALAVDY 237

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
           G  +SR GDTLQA++ H +  PL  PG+ADL++HVDF+ L+  A
Sbjct: 238 GGWRSR-GDTLQALRAHRFDDPLAAPGEADLTAHVDFEALAQAA 280


>gi|83591981|ref|YP_425733.1| hypothetical protein Rru_A0642 [Rhodospirillum rubrum ATCC 11170]
 gi|83574895|gb|ABC21446.1| Protein of unknown function DUF185 [Rhodospirillum rubrum ATCC
           11170]
          Length = 364

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/351 (36%), Positives = 196/351 (55%), Gaps = 15/351 (4%)

Query: 15  KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQH 74
           ++G + V+ + A C+ +    YY+  +  GA GDF+TAPE +QIFGE+L ++    W+  
Sbjct: 21  RSGPLPVEDWMAACLGE----YYARGDVLGAGGDFITAPECTQIFGELLGLWSAVVWQAM 76

Query: 75  GFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYG 134
           G P  + LVELGPGRG +M D LR +  + P F   LS+++VETS  L   QK++L + G
Sbjct: 77  GSPERINLVELGPGRGTLMADALRALAPV-PAFRRALSVHLVETSPGLRARQKQKLRASG 135

Query: 135 DKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI-DQHDSLVFNIGD 193
             + W+  L  VP G   ++ANEF D+LPI+Q++    G RER++ +  +  +L F  G 
Sbjct: 136 VTVFWHERLDTVPSGPMIVLANEFLDALPIRQYLRDAEGWRERLVGLAGEGPALTFTQGP 195

Query: 194 HEIKSNFLTCSDYF---LGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGD 250
                  L    +    +G   E  P     +  ++ RLA DGG  + +DYG   S  GD
Sbjct: 196 LLGDPPPLAQPAHLQARVGEEIEVCPQAQAVVAQVAARLAADGGAGLFLDYGPAHSAPGD 255

Query: 251 TLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           +LQA++ H + + L NPG  DL++HVDFQ ++ +A      ++G+  QG FL+ LG+  R
Sbjct: 256 SLQALRRHRFAAVLENPGAVDLTAHVDFQAMARVAAAAGAAVDGIVQQGPFLQSLGLEAR 315

Query: 311 AFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           A  LM   A  +K  +  +V+RL+    D   MG LFK+L +    +  +P
Sbjct: 316 AGVLMANAATDQKREIRFAVRRLI----DSSEMGTLFKVLGLRSPSMARLP 362


>gi|170741474|ref|YP_001770129.1| hypothetical protein M446_3290 [Methylobacterium sp. 4-46]
 gi|168195748|gb|ACA17695.1| protein of unknown function DUF185 [Methylobacterium sp. 4-46]
          Length = 367

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 135/358 (37%), Positives = 186/358 (51%), Gaps = 4/358 (1%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+ ++  LI +NG + V++Y ALC+  P  GYY+T +P GA GDF TAPEISQIFGE+
Sbjct: 4   TPLLAELRALIAQNGPIPVERYMALCLGHPLHGYYTTRDPLGAAGDFTTAPEISQIFGEL 63

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L ++    W   G PS  R+VELGPGRG ++ D LR I    P F   L +++VETS  L
Sbjct: 64  LGLWAAEVWHGMGRPSPCRVVELGPGRGTLIADALRAIRAALPPFAEALDLHLVETSPVL 123

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q  +LA+ G +  W+  + DVP G   ++ANEFFD+LP++QF        ER I +D
Sbjct: 124 RAAQAARLAAIGREAAWHARIEDVPEGPAIVLANEFFDALPVRQFARGAGAWHERRIGLD 183

Query: 183 -QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
            +   LV  + D +        +    GA+          M++I+ RLA  GG  + IDY
Sbjct: 184 PEGGGLVVGL-DPDPTPEIAAAAPE--GAVLTLPSAALAAMRAIAGRLARQGGALLAIDY 240

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G     + DTLQAV  H  V  L  PG+ DL+  VDF  L+  A      ++G   Q  F
Sbjct: 241 GEATLGLTDTLQAVSRHRAVGILDAPGETDLTVPVDFGALARAAREAGAALHGPVPQRDF 300

Query: 302 LEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           L  LG+ QRA  L  +         +      T      MG LFK+L VS   +  +P
Sbjct: 301 LLALGLAQRAERLAARATPDQARAVAEAAARLTDPAPTGMGRLFKVLGVSDAGMAGLP 358


>gi|77462119|ref|YP_351623.1| hypothetical protein RSP_1579 [Rhodobacter sphaeroides 2.4.1]
 gi|77386537|gb|ABA77722.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 351

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 163/278 (58%), Gaps = 6/278 (2%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I   I   G +TV  Y A C+  PE GYYST  PFGA GDF TAPEISQ+FGE+L + L 
Sbjct: 8   IARRIGATGPVTVADYMAECLLHPEHGYYSTREPFGAAGDFTTAPEISQMFGELLGLCLA 67

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            AW   G PS V L ELGPGRG +M D+LR   +  P F     +++VE S RL  +Q++
Sbjct: 68  QAWLDQGQPSPVTLAELGPGRGTLMADLLRAT-RGVPGFHEAARVHLVEASPRLRALQRE 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            L   G    W    AD+P G  FLVANEFFD+LPI+QFV    G RERM+ + +   L 
Sbjct: 127 TLG--GHPAAWLDRAADLPEGPLFLVANEFFDALPIRQFVRGPEGWRERMVGLTE-GRLT 183

Query: 189 FNIG-DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           + +G +  + +      D   G + E  P     M  I+ R+A  GG A+ +DYG  +S 
Sbjct: 184 WGLGPETSLAALAYRLEDTAPGDVVELCPAAGPIMAEIARRIAAAGGLALAVDYGGWRSH 243

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
            GDTLQA++ H +  PL  PG+ADL++HVDF+ L+  A
Sbjct: 244 -GDTLQALRAHRFDDPLAAPGEADLTAHVDFEALAQAA 280


>gi|312114462|ref|YP_004012058.1| hypothetical protein Rvan_1711 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219591|gb|ADP70959.1| protein of unknown function DUF185 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 373

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 185/353 (52%), Gaps = 14/353 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L  K+   I + G + +  Y   C+ D + GYY   +P G  GDF+TAPEISQ+FGE+
Sbjct: 11  TPLALKLRRDIAERGPIPLHDYMEACLYDLQHGYYRKRDPLGRGGDFITAPEISQVFGEL 70

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++    W Q G P  V LVELGPGRG +M D LR   ++ P F   +++++VE+SE L
Sbjct: 71  IGLWAAQVWMQMGQPQSVCLVELGPGRGTLMADALRA-ARVMPGFLQSIAVHLVESSEVL 129

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVM--TEHGIRERMID 180
              QK  LA     I W+  + +VP G   ++ANEFFD LP++QF         RER++ 
Sbjct: 130 REAQKATLAGVPVPIQWHGDMGEVPSGPAIVIANEFFDCLPVRQFAFDGAAEVWRERVVA 189

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLACDGGTAI 237
            +  D         ++    LT + Y     G I E+ P     +   + R       A+
Sbjct: 190 FE--DGAFHLATSADVAQPPLTAASYGEPRDGDILEHCPGVGPLLAKFAARAGDAPLAAL 247

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           VIDYGY +   G+TLQAV+ H +      PG+ DL++HVDF RL+ +A      + G   
Sbjct: 248 VIDYGYAKPAFGETLQAVRRHKFAGLFDAPGETDLTAHVDFSRLARLAEEASFVVFGPMA 307

Query: 298 QGKFLEGLGIWQRAFSLMKQTARKD--ILLDSVKRLVSTSADKKSMGELFKIL 348
            G++L  LG+  RA  L+  T+ ++   +  S+ RLV    D   MG LFKIL
Sbjct: 308 MGEWLLRLGVEARANQLLASTSAEEARAIAQSIARLV----DPAQMGALFKIL 356


>gi|163745737|ref|ZP_02153097.1| hypothetical protein OIHEL45_09100 [Oceanibulbus indolifex HEL-45]
 gi|161382555|gb|EDQ06964.1| hypothetical protein OIHEL45_09100 [Oceanibulbus indolifex HEL-45]
          Length = 352

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 137/343 (39%), Positives = 189/343 (55%), Gaps = 23/343 (6%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I   G M +D Y   C+  P++GYY+T  PFG  GDF TAPEISQ+FGE++ + L   W 
Sbjct: 11  IALEGPMRLDDYMQSCLLHPDWGYYTTRMPFGVQGDFTTAPEISQMFGELIGLSLAQCWL 70

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P+   L ELGPGRG +M D+LR  C   P F +   + ++E S  L  +Q++ L  
Sbjct: 71  DQGAPAPFTLAELGPGRGTLMADVLRA-CARVPGFLAAAQVRLIEASPALRDLQRQTLEG 129

Query: 133 YGDKINWY---TSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVF 189
           +  +  W+   T L DVPL   FL+ANEFFD+LPI+QF+    G  ER I   + + L F
Sbjct: 130 F--EATWHDTVTELPDVPL---FLIANEFFDALPIRQFLRQGAGWAERRIGAAE-NGLCF 183

Query: 190 N---IGDHEIKSNFLTCSDYFLGAIFE-NSPCRDREMQSISDRLACDGGTAIVIDYGYLQ 245
               +  H   ++ L   D   G + E  +P  D  M  I +R+A  GG A++IDYG  +
Sbjct: 184 GLAPVAPHPAIAHRL--DDTKDGDLVEVCAPAADI-MLEIGNRIAQQGGAALIIDYGDWR 240

Query: 246 SRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGL 305
           + +GDTLQA++ H    PL NPG ADL++HVDF+   ++A+      + L TQG FLE L
Sbjct: 241 A-LGDTLQAMEHHAPADPLANPGCADLTAHVDFE---ALALACPCQYSRLVTQGVFLERL 296

Query: 306 GIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           GI  RA  L +  A  D  L S             MG LFK++
Sbjct: 297 GITARAQKLAE--ALTDDALHSHIAAHRRLTHPAEMGNLFKVM 337


>gi|260427542|ref|ZP_05781521.1| ATP synthase beta subunit/transcription termination factor rho
           [Citreicella sp. SE45]
 gi|260422034|gb|EEX15285.1| ATP synthase beta subunit/transcription termination factor rho
           [Citreicella sp. SE45]
          Length = 353

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 130/337 (38%), Positives = 182/337 (54%), Gaps = 11/337 (3%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I   G M+V +Y   C+  P+ GYY+T +P GA GDF TAPEISQ+FGE+L + L  +W 
Sbjct: 12  IAAEGPMSVAEYMTACLLHPQHGYYATRDPLGAAGDFTTAPEISQMFGELLGLCLAQSWI 71

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P+   L ELGPGRG +M D  R + +  P       +++VE S  L   Q ++LA 
Sbjct: 72  DQGRPAPFVLAELGPGRGTLMADATRAM-RAVPGMLEAARVHLVEASPTLRDAQHQRLAP 130

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
                 W+ S+AD+P    FL+ANEFFD+LPI+QF+    G  ER++ + Q  +L F + 
Sbjct: 131 L--MPVWHESVADLPEASLFLLANEFFDALPIRQFLRVGTGWAERVVGV-QDGALAFGLA 187

Query: 193 DHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDT 251
           +    ++  +  +D   G + E           I  R+A  GG A+++DYG  QS +GDT
Sbjct: 188 EPVALASLESRLADTQEGDMVETCAPATGIAAEIGRRIAEHGGAALIVDYGSDQS-LGDT 246

Query: 252 LQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRA 311
            QAV+ H  + PL  PG+ADL++HVDF  L+  A         L  QG FLE LGI  RA
Sbjct: 247 FQAVRRHRKLGPLDCPGEADLTAHVDFGALAQAA---PCATAPLVPQGIFLERLGITDRA 303

Query: 312 FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
            +L  +   +   LDS           + MG LFK L
Sbjct: 304 RALAAKL--EGPALDSHIAAHRRLTHPEEMGSLFKTL 338


>gi|114569311|ref|YP_755991.1| hypothetical protein Mmar10_0760 [Maricaulis maris MCS10]
 gi|114339773|gb|ABI65053.1| protein of unknown function DUF185 [Maricaulis maris MCS10]
          Length = 366

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 123/359 (34%), Positives = 186/359 (51%), Gaps = 17/359 (4%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
           + I+  G +++  +    + DP  G+Y+T +P GAV DF+TAPEISQ+FGE++ +     
Sbjct: 8   DRIRSGGPISIAAFMTEALFDPRHGFYATKDPIGAVADFITAPEISQMFGELIGLVAAQT 67

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL 130
           W   G P+  +L+E+GPGRG MM D LR   +  P F     I ++E S  L  +Q + L
Sbjct: 68  WLDMGRPAAFKLIEMGPGRGTMMSDALRA-ARTVPGFMDATEIMLIEASAALKAVQAQTL 126

Query: 131 ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI------DQH 184
              G +I W   L     G  F+V NEF D LP++Q +  +    ER++ +      D  
Sbjct: 127 GPSGAQIRWIDRLDAAAPGPCFIVGNEFLDCLPVRQALRHKGEWHERLVGLAPTYGNDSE 186

Query: 185 DSLVFNIGDHEIKSNFL---TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
              VF +G    +   L      D   GA+ E  P   + +  +++R A   G A+ IDY
Sbjct: 187 SDFVFVLGPPLGQDTDLIPERLRDAEDGALVELRPGDRQVVDQLAERFANQPGRALFIDY 246

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G   S +GDTLQA++ H    PL +PG ADL++ VDF+ L        L  +G  TQG++
Sbjct: 247 GPATSEIGDTLQAIRAHKKQPPLQDPGTADLTARVDFESLMQAGRTAGLTAHGPQTQGQW 306

Query: 302 LEGLGIWQRAFSLMK-QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           L  LG+  RA  L + Q  ++  +   + RL     D + MGELFK++ +  +  EL P
Sbjct: 307 LRDLGLEARAAVLSQSQPGKRSEIARQIWRLT----DTEQMGELFKLVCL--DSAELPP 359


>gi|209965197|ref|YP_002298112.1| hypothetical protein RC1_1903 [Rhodospirillum centenum SW]
 gi|209958663|gb|ACI99299.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 331

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/314 (40%), Positives = 168/314 (53%), Gaps = 14/314 (4%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           E  L   I   I+  G + V  Y ALC+  P+ GYY+T +P GA GDF TAPEISQ+FGE
Sbjct: 14  ETPLAALIARQIRLTGPLPVSAYMALCLGHPQHGYYTTRDPLGAGGDFTTAPEISQMFGE 73

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ML ++    W   G P+ V LVELGPGRG +M D LR   ++ P F + L  ++VETS  
Sbjct: 74  MLGLWAAHCWLAMGSPAGVALVELGPGRGTLMADALRATARV-PGFHAALRPHLVETSPV 132

Query: 122 LTLIQKKQLASYGDKIN--WYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIR---- 175
           L   Q   LA+        W+  L +VP G   L+ANEFFD+LPI+Q V  EH  R    
Sbjct: 133 LRQRQAAALAALPAPPAPVWHDRLEEVPEGPLLLLANEFFDALPIRQLVRQEHRGRLLWA 192

Query: 176 ERMIDIDQHDSLVFNI----GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC 231
           ER + +D    L + +    G+  +            G++ E +P      Q I  RLA 
Sbjct: 193 ERKVGLDADGRLAWVLDPAAGEALVPPALRGSPP---GSVVELAPAAAAVAQEIGGRLAR 249

Query: 232 DGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLY 291
             G A+++DYG+    VGDTLQAV+ H +  PL  PG+ADL++HVDF  L++        
Sbjct: 250 APGAALMVDYGHAGPAVGDTLQAVRRHRFADPLEAPGEADLTAHVDFAALAAALRAGGAA 309

Query: 292 INGLTTQGKFLEGL 305
             G  TQG  L  L
Sbjct: 310 AWGPVTQGDLLSAL 323


>gi|325192008|emb|CCA26474.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 476

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/382 (34%), Positives = 198/382 (51%), Gaps = 35/382 (9%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N+L   + + I   G +T+ +Y    +A P  GYY   + FGA GDF TAPEISQ+FGE+
Sbjct: 91  NELFSILSSFIDVRGPLTLAEYMQRALAHPTHGYYMKKDVFGAQGDFTTAPEISQMFGEL 150

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +AI+ I  W++ G P  + +VELGPGRG +M D LR   +  P F S L ++MVE S  L
Sbjct: 151 IAIWCIATWKEMGSPDPIHIVELGPGRGSLMSDFLRS-SRSFPTFHSALQVHMVEISPAL 209

Query: 123 TLIQKKQLASYGD--KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
             IQ+  L        + W+TSL  VP G   ++A EFFD++P+ QF  TE G  ER+ID
Sbjct: 210 RKIQEGMLKDVDGIRSLQWHTSLTHVPEGPLLVIAQEFFDAMPVHQFEYTERGWCERLID 269

Query: 181 IDQHDSLVFN---------------IGDHEIK--------SNFLTCSDYFLGAIFENSPC 217
           + Q +   F                IG   ++         + +      +G   E SP 
Sbjct: 270 VHQKNGERFFRFVLSPGPTPAARVLIGHQNLQGLRSGVSEESSVITEQAQIGDQLEISPA 329

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
               MQ I+ R++ + G A+++DYG+       +L+ ++ H +V  L  PG+ DLS++VD
Sbjct: 330 SFTIMQEIARRISANRGAALIVDYGHNHPSTF-SLRGIRNHAFVDALEEPGEIDLSANVD 388

Query: 278 FQRLSSIAILY-KLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVS 333
           F+ L+  A     +   G   QG FL+ LG+  R   L++     A+   L  + KRLV 
Sbjct: 389 FKTLARYATAEPNISSLGPVPQGLFLKTLGVEHRLAVLLENCESDAQAQELYSAYKRLV- 447

Query: 334 TSADKKSMGELFKILVVSHEKV 355
              D   MG +FK++ +SH  +
Sbjct: 448 ---DSDQMGTIFKVMAISHSDI 466


>gi|300024011|ref|YP_003756622.1| hypothetical protein Hden_2505 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525832|gb|ADJ24301.1| protein of unknown function DUF185 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 379

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 190/364 (52%), Gaps = 15/364 (4%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L R I   I+++G MTV  Y A C+ D  FGYY     FGA GDF+TA +ISQ+FGE
Sbjct: 10  DTPLGRLIKEGIQRDGPMTVQAYMARCLWDEPFGYYRRQRVFGASGDFITAADISQVFGE 69

Query: 62  MLAIFLICAWEQ-HGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           ++ ++    W+   G P  + L E GPGRG MM D LR   ++ P F   +  Y++E S+
Sbjct: 70  LIGVWTGVVWQTVFGAPGTITLAEYGPGRGTMMRDALRA-ARVVPGFIEAVHPYLIEASQ 128

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            L+ +Q   LA +  +  W   L +       +VANEF DS P+ Q+V T  G R R + 
Sbjct: 129 TLSQLQATTLADFRSRATWGAKLDEFSPP-AIIVANEFLDSWPVAQWVKTVDGWRIRGVG 187

Query: 181 IDQHDSLVFNIGD----HEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
           ++    L F   D    HE     L   D  +GA+ E     DR   ++   +       
Sbjct: 188 LNASGHLEFTAVDGDCPHEAFDALL--PDAQVGAVVETQRL-DRLADALQSLMQRGPVVM 244

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           ++IDYG+  +  GDTLQAV+ H Y SPL +PG+ADL+ HV+F  L+S      L ++G  
Sbjct: 245 LLIDYGHTAAAAGDTLQAVREHKYESPLASPGEADLTVHVNFYDLASTLHRAGLALDGPV 304

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARKDILLDS-VKRLVSTSADKKSMGELFKILVVSHEKV 355
           TQ +FL  +GI +RA  LM    ++   +++ V RL++       MG  FK+L      +
Sbjct: 305 TQAEFLGAVGIVERASRLMSANPQRAGEIEAGVARLLA----PNGMGSRFKVLAARSPDL 360

Query: 356 ELMP 359
             +P
Sbjct: 361 PPLP 364


>gi|321461519|gb|EFX72550.1| hypothetical protein DAPPUDRAFT_308204 [Daphnia pulex]
          Length = 430

 Score =  213 bits (541), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 133/380 (35%), Positives = 194/380 (51%), Gaps = 38/380 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           NKL+++I   I   G +TV  Y    + +P  GYY + + FG  GDF+T+PEISQ+FGE+
Sbjct: 39  NKLLKQIEARILATGPITVADYMKEVLTNPSAGYYMSKDVFGEKGDFITSPEISQMFGEL 98

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK---PDFFSVLSIYMVETS 119
           +AI+L+  W + G P+  ++VELGPGRG +M D+LRV  K K    DF    S+ +VE S
Sbjct: 99  IAIWLMNEWTKCGKPTPFQIVELGPGRGTLMSDVLRVFSKFKMAESDF----SVSLVEVS 154

Query: 120 ERLTLIQKKQLAS----------------------YGDKINWYTSLADVPLGFTFLVANE 157
             L+ IQ+K L                        YG  + WY  ++D+P  FT  +A+E
Sbjct: 155 PYLSQIQEKCLCKTQNEKISELPIDSQHYKESKSLYGSPVRWYNHISDLPRTFTLFLAHE 214

Query: 158 FFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC 217
           FFD+LPI + V  + G RE +ID+++ +S +  +   E     L C +  +    E SP 
Sbjct: 215 FFDALPIHKLVKVDQGWREVLIDLNREESTLRYVLSRERTPASLYCRENEVRKDLEISPQ 274

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
               +Q ++ R+  DGG  +VIDYG+   +  DT +  K H    PLV PG ADL++ VD
Sbjct: 275 SSVMIQVMASRIHQDGGIGLVIDYGHEGDKT-DTFRGFKNHKLHDPLVEPGTADLTADVD 333

Query: 278 FQRLSSIAILYKLYIN-------GLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKR 330
           F  L   A   K   +       G   Q  FL  +GI  R   L+  + R + L + +K 
Sbjct: 334 FSALKWAATHPKSVEDWKANLTFGTVDQKDFLTRMGINMRLEKLL-ASCRNEKLANDLKS 392

Query: 331 LVSTSADKKSMGELFKILVV 350
                 D   MG  FK L +
Sbjct: 393 AHRMLTDPIEMGSKFKFLAL 412


>gi|217074438|gb|ACJ85579.1| unknown [Medicago truncatula]
          Length = 449

 Score =  213 bits (541), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 124/346 (35%), Positives = 198/346 (57%), Gaps = 32/346 (9%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ +  +IK + G +++ +Y +  + +P+ GYY   + FGA GDF+T+PE+SQ+FG
Sbjct: 49  DSELVKHLKGIIKFRGGPISLGEYMSEVLTNPKAGYYINRDIFGAQGDFITSPEVSQMFG 108

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++++C WEQ G P  V LVELGPGRG +M D+LR   K K +F   L +++VE S 
Sbjct: 109 EMVGVWVMCLWEQMGRPERVNLVELGPGRGTLMADLLRGASKFK-NFTESLHVHLVECSP 167

Query: 121 RLTLIQKKQL-----------------ASY-GDKINWYTSLADVPLGF-TFLVANEFFDS 161
            L  +Q K L                 +S+ G  ++W+ +L  VP G  T ++A+EFFD+
Sbjct: 168 ALKTLQHKNLKCVDEENADGDTDKRTVSSFVGTPVSWHATLEQVPSGSPTIIIAHEFFDA 227

Query: 162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           LP+ QF     G  E+M+D+ +  SL F +  H   +            + E +     E
Sbjct: 228 LPVHQFQKGSRGWCEKMVDVAEDSSLHFVLSPHPTPATLYLLKRAKWAGVEEIAKFNQIE 287

Query: 222 M--------QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
           +        Q+I +R++ DGG A++IDYG     V D+LQA++ H +V  L +PG ADLS
Sbjct: 288 ICPKAMDLTQTIVERISSDGGGALIIDYGS-DGVVSDSLQAIRKHRFVDLLDDPGSADLS 346

Query: 274 SHVDFQ--RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
           ++VDF   R S+     ++ ++G  TQ +FL  LGI  RA SL++ 
Sbjct: 347 AYVDFASIRHSAEEASGEVSVHGPMTQSQFLGALGINFRAESLLQN 392


>gi|89055825|ref|YP_511276.1| hypothetical protein Jann_3334 [Jannaschia sp. CCS1]
 gi|88865374|gb|ABD56251.1| protein of unknown function DUF185 [Jannaschia sp. CCS1]
          Length = 371

 Score =  212 bits (540), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 136/357 (38%), Positives = 204/357 (57%), Gaps = 21/357 (5%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L  +++  I + G +++  Y A C+ DP+FGYY+T +P G  GDF+TAPEISQ+FGE++
Sbjct: 7   SLKARLLARIARLGPISLADYMAECLHDPQFGYYATRDPLGRGGDFITAPEISQMFGELI 66

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            ++L   W   G      LVELGPGRG +M D++R   +  P F   +++++VE S  L 
Sbjct: 67  GLWLAQVWMDQGG-GAAALVELGPGRGTLMADVMRA-TRGVPGFHDAVTVHLVEASPVLR 124

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHG-IRERMIDID 182
            +Q + LA+Y  +  ++ +LADVP G   LVANEFFD+LPI+QF M++ G  +ER I   
Sbjct: 125 AMQTEALAAYAPR--FHDNLADVPEGPILLVANEFFDALPIRQFQMSDAGDWQERQIGAS 182

Query: 183 QHDSLVFNIGDH---EIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
              +L++ +      +++  F   +    G I E     +     I  R+A  GG A+++
Sbjct: 183 D-GALIWGLAPPAPLDVRDGF---APGMPGMIVETCAPAEAIAAEIGRRVA-QGGAALIV 237

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK-LYINGLTTQ 298
           DYG   S  GDT QA+  H Y  PL  PG+ADL++HV F  ++  A     +  +GLT Q
Sbjct: 238 DYGDWHS-AGDTFQALAKHAYTDPLDAPGEADLTAHVAFAPIARAARAASGVVASGLTRQ 296

Query: 299 GKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           G FLE LGI  RA +L +       D  + + +RL  T  D+  MG LFK+L ++ E
Sbjct: 297 GMFLERLGITARAQALARGLDGTALDTHIAAHRRL--THGDE--MGTLFKVLALTPE 349


>gi|188582252|ref|YP_001925697.1| hypothetical protein Mpop_3007 [Methylobacterium populi BJ001]
 gi|179345750|gb|ACB81162.1| protein of unknown function DUF185 [Methylobacterium populi BJ001]
          Length = 362

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 190/354 (53%), Gaps = 14/354 (3%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+  +   I+ +G + +D+Y ALC+  P  GYY+T +PFG  GDFVTAPEISQ+FGE+
Sbjct: 6   TPLLAILAREIRASGPIGLDRYMALCLGHPRHGYYATRDPFGRGGDFVTAPEISQMFGEL 65

Query: 63  LAIFL--ICAWEQHGFPSCVR-LVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           +  +   + A  Q   P+    LVELGPGRG +M D LR +      F     +++VETS
Sbjct: 66  IGAWAGAVLATMQAASPAARPCLVELGPGRGTLMADALRALRAAGAAF----DLHLVETS 121

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             L  +Q ++LA+     +   SL D PL    ++ANEFFD+LP +QFV T HG  ER +
Sbjct: 122 PVLRRLQAERLAAAPVFHDSVESLPDAPL---LVIANEFFDALPARQFVRTGHGWCERRV 178

Query: 180 DI-DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
            +  + D+L F + D E        ++   GA+          M+ ++ RLA  GG  + 
Sbjct: 179 GLTPEGDALAFGL-DPEPDPRL--AAEAPEGAVLTVPRQGLAVMRDLARRLAARGGALLA 235

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+ +   GDT QA+ GH +  PL  PG+ADL+ HVDF  L+  A      ++G  TQ
Sbjct: 236 IDYGHDRPGFGDTFQALVGHRFADPLSRPGEADLTLHVDFGALARAASAEGAAVHGPATQ 295

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
             FL GLG+  RA  L  +                T  D + MG LFK+L VSH
Sbjct: 296 RDFLLGLGLLTRAERLKVRATPDQAAAIDAAAARLTDPDPRGMGALFKVLGVSH 349


>gi|225452686|ref|XP_002276826.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296087782|emb|CBI35038.3| unnamed protein product [Vitis vinifera]
          Length = 483

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 193/345 (55%), Gaps = 32/345 (9%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ +  +IK + G ++V +Y    + +P+ G+Y   + FG  GDF+T+PE+SQ+FG
Sbjct: 83  DSELVKHLKGIIKFRGGPISVAEYMEEVLTNPKAGFYINRDVFGTEGDFITSPEVSQMFG 142

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++++C WEQ G PS V LVELGPGRG +M D+LR   K K +F   L I+MVE S 
Sbjct: 143 EMIGVWVMCLWEQMGQPSKVNLVELGPGRGTLMADLLRGTSKFK-NFIESLQIHMVECSP 201

Query: 121 RLTLIQKKQLASY------------------GDKINWYTSLADVPLGF-TFLVANEFFDS 161
            L  +Q K L                     G  ++W+ +L  VP G  T ++A+EF+D+
Sbjct: 202 TLQKLQHKNLKCVDEDSHNGNVDKRTISMLTGTPVSWHAALEQVPSGLPTIIIAHEFYDA 261

Query: 162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSN-FLTCSDYFLGA-------IFE 213
           LP+ QF     G  E+MID+ +  S  F +      +  +L     + GA         E
Sbjct: 262 LPVHQFQRASRGWCEKMIDVAEDSSFRFVLSPQSTPAKLYLMERCKWAGAEEIAKLDQIE 321

Query: 214 NSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
             P       +I+ R++ DGG A+VIDYG L   V D+LQA++ H +V+ L NPG ADLS
Sbjct: 322 VCPKAIELTHTIAKRISSDGGGALVIDYG-LDGIVSDSLQAIRKHKFVNILDNPGSADLS 380

Query: 274 SHVDFQ--RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
           ++VDF   R S+      + ++G  TQ +FL  LGI  R  +L+K
Sbjct: 381 AYVDFASIRHSAEEASDDVIVHGPITQSQFLGSLGINFRVEALLK 425


>gi|329888131|ref|ZP_08266729.1| hypothetical protein BDIM_00510 [Brevundimonas diminuta ATCC 11568]
 gi|328846687|gb|EGF96249.1| hypothetical protein BDIM_00510 [Brevundimonas diminuta ATCC 11568]
          Length = 357

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 192/365 (52%), Gaps = 20/365 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           ++++L+R+IV      G MTV  Y   C+ DP+ GYY+T    G  GDF+TAP +SQ+FG
Sbjct: 5   LKDRLVREIV----LTGPMTVADYVTRCLHDPKGGYYATRPALGERGDFITAPMVSQMFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++ +  W + G P  VRLVE+GPG G +M D+LR   +L P F   + + ++E S 
Sbjct: 61  ELIGLWAVETWTRLGAPERVRLVEVGPGDGTLMSDVLRA-ARLVPGFLQAVDLILIEPSA 119

Query: 121 RLTLIQKKQLASYGDKINWYTSL----ADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
            L   Q ++LA       W ++L     D P+    L+ANE  D LP +QF+ TE G  E
Sbjct: 120 PLRAEQARRLADADVHPRWLSALHKIETDAPV---ILIANEVLDCLPARQFIKTEGGWAE 176

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCS-DYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           R I +   D L F +    I   F     D   G I E S  +    + ++  +    G 
Sbjct: 177 RRIGVTDADELTFGL--TAIADGFEAPGFDVEPGQIIEISEQQAAFGRDLASLIRAASGA 234

Query: 236 AIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGL 295
           A++IDYG  +   GDTLQA++ H  V PL  PG+ADL+   DF  +   A+     + G 
Sbjct: 235 ALLIDYGRSKPEAGDTLQALRRHQKVDPLSTPGEADLTQWADFPLVLEAAVRGGADVTGC 294

Query: 296 TTQGKFLEGLGIWQRAFSLMK-QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
            +QG FL+ LGI  RA  LM+ +     ++   + RL  T+ D+  MGELFK   +   +
Sbjct: 295 VSQGAFLQALGIEARAQRLMQGRPEAAPVIQRQLDRL--TAPDQ--MGELFKATAIFSPR 350

Query: 355 VELMP 359
              +P
Sbjct: 351 SLALP 355


>gi|240139638|ref|YP_002964114.1| hypothetical protein MexAM1_META1p3090 [Methylobacterium extorquens
           AM1]
 gi|240009611|gb|ACS40837.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 361

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 189/355 (53%), Gaps = 17/355 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+  +   I+ +G + +D+Y ALC+  P  GYY+T +PFG  GDFVTAPEISQ+FGE+
Sbjct: 6   TPLLAILAREIRASGPLGLDRYMALCLGHPLHGYYATRDPFGRGGDFVTAPEISQMFGEL 65

Query: 63  L---AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           +   A  ++      G   C  LVELGPGRG +M D LR +     DF     +++VETS
Sbjct: 66  VGAWAAAVLAMMPATGVRPC--LVELGPGRGTLMADALRALRAAGTDF----ELHLVETS 119

Query: 120 ERLTLIQKKQLASYGDKI-NWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERM 178
             L  +Q ++LA       +   SL D PL    ++ANEFFD+LP +QFV TE G  ER 
Sbjct: 120 PVLRGLQAERLADAAPIFHDSVASLPDAPL---LIIANEFFDALPARQFVRTELGWCERR 176

Query: 179 IDI-DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
           + +  + D+L F + D E        ++   GA+          M+ ++ RL   GG  +
Sbjct: 177 VGLTPEGDALAFGL-DPEPDPRL--TAEAPAGAVLTLPSQGLAVMRDLARRLVARGGALL 233

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG+ +   GDT QAV GH +  PL  PG+ADL+ HVDF  L+  A      ++G  T
Sbjct: 234 AIDYGHDRPGFGDTFQAVAGHRFADPLARPGEADLTLHVDFGALARAAAAEGAALHGPVT 293

Query: 298 QGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
           Q  FL GLG+  RA  L  +      L      L  T  D + MG LFK+L  SH
Sbjct: 294 QRDFLLGLGLAMRAERLKARATPDQALAIDAAVLRLTDPDPRGMGALFKVLCASH 348


>gi|167644641|ref|YP_001682304.1| hypothetical protein Caul_0673 [Caulobacter sp. K31]
 gi|167347071|gb|ABZ69806.1| protein of unknown function DUF185 [Caulobacter sp. K31]
          Length = 402

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/390 (35%), Positives = 195/390 (50%), Gaps = 49/390 (12%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPF-----GAVGDFVTAPEISQI 58
            L+ ++   I ++G ++V ++F  C+ DP  GYY+T         G  GDF+TAP +SQ+
Sbjct: 2   SLLDRLKAQIAQDGPISVAEFFTRCLHDPRDGYYATRPALAGMKGGEDGDFLTAPGVSQM 61

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGE++ ++++  W + G PS VR+VE+GPG G ++ D+LR   +L P+F +   +++VE 
Sbjct: 62  FGELIGLWILETWTRMGRPSPVRMVEMGPGDGTLISDVLRA-ARLLPEFLNAADLWLVEV 120

Query: 119 SERLTLIQKKQLASYGDKINWYTSLADVPLGFTF-LVANEFFDSLPIKQFVMTEHGIRER 177
           S  L   Q  +LA      +W   L  VP G    LVANE  D LP  QFV TE G  ER
Sbjct: 121 SPPLRAAQAVKLAPL--TPSWADRLEVVPAGAPLILVANEVLDCLPAHQFVRTEGGWAER 178

Query: 178 MIDIDQHDSLVF----------------------------NIGDH-------EIKSNFLT 202
           ++ +D   +L F                            N+G            S    
Sbjct: 179 VVGLDDSGNLAFGLKALQSPLPLDGGGAGVGGVRGVGRRANLGTSGSAFTPIPNPSPIER 238

Query: 203 CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVS 262
              Y  G I E+SP +      I  R+A DGG A++IDYG      GDTLQA+K HT VS
Sbjct: 239 EGSYPPGTIVESSPAQAALGSEIGHRIARDGGAALLIDYGRDAPGPGDTLQALKAHTKVS 298

Query: 263 PLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA-RK 321
           PL  PGQADL+   DF  + + A         + TQG FL+GLGI  RA +L      + 
Sbjct: 299 PLAQPGQADLTVWADFPAVLAAAAEAGAATGPILTQGAFLQGLGIEARAQALAAARPDQA 358

Query: 322 DILLDSVKRLVSTSADKKSMGELFKILVVS 351
           D L   + RL      +  MGELFK++ +S
Sbjct: 359 DKLTRQLDRLTG----RAQMGELFKVVCLS 384


>gi|159045190|ref|YP_001533984.1| hypothetical protein Dshi_2650 [Dinoroseobacter shibae DFL 12]
 gi|157912950|gb|ABV94383.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 363

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 130/349 (37%), Positives = 183/349 (52%), Gaps = 15/349 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L   +   I   G +TV ++ A C+  P  GYY+T  PFG  GDF TAPEISQ+FGE+
Sbjct: 2   TPLAEILAARIAATGPITVAEFMAECLLHPTHGYYTTRTPFGQAGDFTTAPEISQMFGEL 61

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L + L  AW   G P    L E+GPGRG +M DI RV+ ++     + L  ++VE S  L
Sbjct: 62  LGLALAQAWHDQGAPPGAILAEIGPGRGTLMADIRRVLKQVP--GAATLRPHLVEASPAL 119

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q  ++     +++    L D PL    LVANEFFD+LPI+QF     G  ER I + 
Sbjct: 120 RAEQATRV-PEAVRLDRVEDLPDAPL---LLVANEFFDALPIRQFERHAAGWAERQIGLA 175

Query: 183 QHDSLVFNIGDHEIKSNFL-TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
           +  +L F        ++     +D   G + E        +  I+ R+A  GG AI+ DY
Sbjct: 176 E-GALAFGRAQPAALASLAHRMADTGPGDLVETCAPAQPIIAEIAGRIARHGGAAIIADY 234

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G  +S+ GDTLQAV+ H     L +PGQADL++HVDF+ L+  A      ++ +  QG F
Sbjct: 235 GDWRSK-GDTLQAVRAHRPDPVLAHPGQADLTAHVDFEPLAQAARTAGASVSAMIPQGVF 293

Query: 302 LEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           LE LGI  RA +L    + A     + + +RL       + MG LFK+L
Sbjct: 294 LERLGITTRAQALATGLEGAALQSHIAAHRRLT----HPEEMGTLFKVL 338


>gi|149185006|ref|ZP_01863323.1| hypothetical protein ED21_18172 [Erythrobacter sp. SD-21]
 gi|148831117|gb|EDL49551.1| hypothetical protein ED21_18172 [Erythrobacter sp. SD-21]
          Length = 351

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 190/347 (54%), Gaps = 28/347 (8%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
            LI+++G M V +Y     A     YY++ +P GA GDF TAPEISQ+FGEM+ ++L   
Sbjct: 16  RLIERHGPMPVSRYMGESNAR----YYTSRDPLGAGGDFTTAPEISQMFGEMVGLWLADL 71

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICK--LKPDFFSVLSIYMVETSERLTLIQKK 128
           W + G P  +   ELGPGRG +  D LR +    L+P       +++VE S  L  +Q  
Sbjct: 72  WSRSGHPQAI-YAELGPGRGTLARDALRAMASQGLRP------PVHLVEGSAALREVQAD 124

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            LA      +  T   D PL   ++VANEF D+LPI+Q VMT  G RER++ +D  D  V
Sbjct: 125 ALAGAQFHESIDTLPDDRPL---YIVANEFLDALPIRQLVMTTRGWRERLVALD-GDRFV 180

Query: 189 FNIGDHEIKSNFLT---CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ 245
           F  G + +    L      D  +G + E  P     ++ ++ R+   GG A+ IDYGYL+
Sbjct: 181 FAAGPNPMDDAVLEERRAQD--VGTVIETCPGAAAVIEDLARRIDRQGGAALFIDYGYLE 238

Query: 246 SRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGL 305
           SR G+TLQAVK H  V     PG+ DL++ VDF  L+ IA    L +    TQG +L+ +
Sbjct: 239 SRTGETLQAVKAHGKVGVFDAPGEMDLTALVDFAELAQIARQEGLAVE-TATQGAWLDAM 297

Query: 306 GIWQRAFSLMKQT-ARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           G+  RA +L +++ A  + +  +  RL  T      MGELFK++ ++
Sbjct: 298 GLGLRAKALSERSPAHAEEIARACNRLAGTG----EMGELFKVMAIT 340


>gi|163852302|ref|YP_001640345.1| hypothetical protein Mext_2884 [Methylobacterium extorquens PA1]
 gi|163663907|gb|ABY31274.1| protein of unknown function DUF185 [Methylobacterium extorquens
           PA1]
          Length = 361

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 191/364 (52%), Gaps = 15/364 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+  +   I+ +G + +D+Y A C+  P  GYY+T +PFG  GDFVTAPEISQ+FGE+
Sbjct: 6   TPLLAILAREIRASGPLGLDRYMAFCLGHPLHGYYATRDPFGRGGDFVTAPEISQMFGEL 65

Query: 63  L---AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           +   A  ++      G   C  LVELGPGRG +M D LR +     DF     +++VETS
Sbjct: 66  VGAWAAAVLAMMPATGVRPC--LVELGPGRGTLMADALRALRAAGSDF----ELHLVETS 119

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             L  +Q  +LA       ++ S+A +P     +VANEFFD+LP +QFV TE G  ER +
Sbjct: 120 PVLRRLQSARLADAAP--TFHDSVASLPDAPLLIVANEFFDALPARQFVRTELGWCERRV 177

Query: 180 DI-DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
            +  + D+L F + D E        ++   GA+          M+ ++ RL   GG  + 
Sbjct: 178 GLAPEGDALAFGL-DPEPDPRL--TAEAPAGAVLTLPSQGLAVMRDLARRLVARGGALLA 234

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+ +   GDT QAV GH +  PL  PG+ADL+ HVDF  L+  A      ++G   Q
Sbjct: 235 IDYGHDRPGFGDTFQAVAGHRFADPLARPGEADLTLHVDFGALARAAAAEGAALHGPVMQ 294

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELM 358
             FL GLG+  RA  L  +             L  T  D + MG LFK+L  SH  +  +
Sbjct: 295 RDFLLGLGLAMRAERLKARATPDQAQAIDAAVLRLTDPDPRGMGALFKVLCASHPALGPL 354

Query: 359 PFVN 362
           P ++
Sbjct: 355 PALS 358


>gi|182680434|ref|YP_001834580.1| hypothetical protein Bind_3534 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636317|gb|ACB97091.1| protein of unknown function DUF185 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 386

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 127/382 (33%), Positives = 197/382 (51%), Gaps = 31/382 (8%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L R I  +I++ G ++++++  L +  P FGYY    P GA GDFVTAPEISQ+FGE+
Sbjct: 9   TPLQRLIAEMIEQEGPISLERFMDLALYHPAFGYYCAKMPLGAEGDFVTAPEISQMFGEL 68

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           + ++    W   G P+ + LVE GPGRG +M D+LR   +  P F + + +++VE +  L
Sbjct: 69  IGLWAAEVWRTMGAPARIALVEFGPGRGTLMADLLRA-ARAVPAFSAAIEVHLVEANPVL 127

Query: 123 TLIQKKQLASYGDKINWYTSL-------ADVPLGFTFLVANEFFDSLPIKQFVMTEHGIR 175
             +Q++ LA  G  + W+ S+        + P+     +ANEFFD LP++QF+    G  
Sbjct: 128 RRVQEQILAGTGHPLIWHESMDMFLAGGEETPV---LCIANEFFDCLPLRQFIRGRAGWH 184

Query: 176 ERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           ER++ +       F +         LT      GA+ E +      M  ++ R++   G 
Sbjct: 185 ERLVGLAAGGGFQFGLAAEAAPE--LTGIAAEPGAVLEINAGAVSAMHRLATRISRVSGV 242

Query: 236 AIVIDYGYLQSR----VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLY 291
            + IDYG+         G+TLQA++ H  V PL   G+ADL++HVDF RL+  A      
Sbjct: 243 LLAIDYGHAAPSGRFGGGETLQALRHHRRVDPLEAAGEADLTAHVDFTRLTEAARAGGAE 302

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVST-------SAD----- 337
           I G  TQG+FL  LG+ +RA +L ++    + + L  +V RL          + D     
Sbjct: 303 IYGPVTQGEFLCRLGLVERAEALARRANPQQMEALHMAVARLAGDDFPSSGLAGDQGMSL 362

Query: 338 KKSMGELFKILVVSHEKVELMP 359
           +  MG LFK+L V+     L P
Sbjct: 363 QAGMGTLFKVLAVTAPGFPLPP 384


>gi|332187872|ref|ZP_08389605.1| hypothetical protein SUS17_2997 [Sphingomonas sp. S17]
 gi|332012033|gb|EGI54105.1| hypothetical protein SUS17_2997 [Sphingomonas sp. S17]
          Length = 360

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/357 (36%), Positives = 186/357 (52%), Gaps = 31/357 (8%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           E+ L  ++   I   G + V Q+ A   A     YY T +P GA GDF T+PEISQ+FGE
Sbjct: 16  EDALPERLARAIALAGPIPVAQFMAAANAH----YYGTRDPLGAGGDFTTSPEISQMFGE 71

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICK--LKPDFFSVLSIYMVETS 119
           ++ ++    W++ G P  V  VELGPGRG +  D  R + K  L P      + + VETS
Sbjct: 72  LVGLWCADLWDRAGRPE-VHWVELGPGRGTLAADARRAMAKAGLTP------TTHFVETS 124

Query: 120 ERLTLIQKKQL--ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
             L   Q +++  A + D ++  T   D PL    +VANEFFD+LPI+Q V    G  ER
Sbjct: 125 ATLRSAQGERVPDAEWHDSVD--TLPTDRPL---IVVANEFFDALPIRQLVRRGDGWHER 179

Query: 178 MIDIDQHDSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           ++     D L   I    + S  +     +   G++ E SP     M+ ++ R+A  GG 
Sbjct: 180 LVAA--QDLLFLPIAGPPVPSEIIPEPLREAEAGSVIEVSPASVAVMRQLAARIAAQGGA 237

Query: 236 AIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGL 295
           A++IDYGY    + DTLQAV+GH + +P   PG+ DLS+HVDF  L++ A    L   G 
Sbjct: 238 ALIIDYGYEGPAIADTLQAVRGHAFANPFDRPGEQDLSAHVDFTTLAAAAQGSGLAAFGP 297

Query: 296 TTQGKFLEGLGIWQRAFSLMK-QTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
            TQ   L  LGI QR  SL +    R D LL    RL+      + MG LF+ L ++
Sbjct: 298 VTQRDLLGALGIDQRTASLARAHPDRADALLADRNRLM------QDMGTLFRALAIT 348


>gi|91079168|ref|XP_967572.1| PREDICTED: similar to CG17726 CG17726-PA [Tribolium castaneum]
 gi|270004240|gb|EFA00688.1| hypothetical protein TcasGA2_TC003565 [Tribolium castaneum]
          Length = 412

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 197/373 (52%), Gaps = 33/373 (8%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           +++ ++I + IK  G +TV +Y    + +P  GYY   + FG  GDF+T+PE++Q+FGEM
Sbjct: 30  HQVAKQIYSKIKATGPITVAEYMKEVLINPLGGYYMHKDVFGESGDFITSPELNQMFGEM 89

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVL---SIYMVETS 119
           +AI+ +  W + G P  +++VELGPGRG +  D+LRV      D F  L   ++++VE S
Sbjct: 90  VAIWFLNEWSKVGSPKPIQIVELGPGRGTLSQDLLRVF-----DHFGALQSATLHLVEVS 144

Query: 120 ERLTLIQKKQLASYGDKI-------------------NWYTSLADVPLGFTFLVANEFFD 160
             L+ +Q ++L    D I                    WY  L DVP  FT LVA+EFFD
Sbjct: 145 PLLSDLQARKLCIQSDNIIDKKSVIHRQGISHQGIPVKWYRQLDDVPNCFTLLVAHEFFD 204

Query: 161 SLPIKQFVMTEHGIRERMIDID--QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCR 218
           +LP+ +F  T+ G RE +IDID  +  S  + I   E  ++ L          FE SP  
Sbjct: 205 ALPVHKFQKTKDGYREILIDIDLSKECSFRYVIAREETPASKLYIRPNETREHFEISPES 264

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
               + I++RL  DGG A++ DYG+  S   DT +A K H    PLV PG ADL++ VDF
Sbjct: 265 LVLAKQIAERLEIDGGLALIADYGHNGSGT-DTFRAFKKHKLHDPLVEPGTADLTADVDF 323

Query: 279 QRLSSIAILYKLYIN-GLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSAD 337
             LS  A      I  G TTQ  FL  +GI  R F  +K  A+ D  ++ ++       +
Sbjct: 324 DALSKSATEAGGVITFGPTTQRDFLLKMGIEHR-FKALKANAKPD-QIEGLEFGYKMMTE 381

Query: 338 KKSMGELFKILVV 350
              MGE FK L +
Sbjct: 382 SNQMGERFKFLAL 394


>gi|254562048|ref|YP_003069143.1| hypothetical protein METDI3653 [Methylobacterium extorquens DM4]
 gi|254269326|emb|CAX25292.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 361

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/354 (37%), Positives = 187/354 (52%), Gaps = 15/354 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+  +   I+ +G + +D+Y ALC+  P  GYY+T +PFG  GDFVTAPEISQ+FGE+
Sbjct: 6   TPLLAILAREIRASGPLGLDRYMALCLGHPLHGYYATRDPFGRGGDFVTAPEISQMFGEL 65

Query: 63  L---AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           +   A  ++      G   C  LVELGPGRG +M D LR +     DF     +++VETS
Sbjct: 66  VGAWAAAVLAMMPATGVRPC--LVELGPGRGTLMADALRALRAAGSDF----ELHLVETS 119

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             L  +Q ++LA       ++ S+A +P     ++ANEFFD+LP +QFV TE G  ER +
Sbjct: 120 PVLRRLQAERLADAAP--TFHDSVASLPDAPLLVIANEFFDALPARQFVRTELGWCERRV 177

Query: 180 DI-DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
            +    D+L F + D E        ++   GA+          M+ ++ RL   GG  + 
Sbjct: 178 GLAPDGDALAFGL-DPEPDPRL--TAEAPAGAVLTLPSQGLAVMRDLARRLVARGGALLA 234

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+ +   GDT QAV  H +  PL  PG+ADL+ HVDF  L+  A      ++G  TQ
Sbjct: 235 IDYGHDRPGFGDTFQAVAAHRFADPLARPGEADLTLHVDFGALARAAAAEGAALHGPVTQ 294

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
             FL GLG+  RA  L  +             L  T  D + MG LFK+L  SH
Sbjct: 295 RDFLLGLGLAMRAERLKARATPDQAQAIDAAVLRLTDPDPRGMGALFKVLCASH 348


>gi|296536483|ref|ZP_06898576.1| protein of hypothetical function DUF185 [Roseomonas cervicalis ATCC
           49957]
 gi|296263195|gb|EFH09727.1| protein of hypothetical function DUF185 [Roseomonas cervicalis ATCC
           49957]
          Length = 335

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 174/321 (54%), Gaps = 16/321 (4%)

Query: 41  NPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVI 100
           +PFGA GDF+TAPEISQ FGE L ++   AW+  G P+ V LVELGPGRG +M D LR I
Sbjct: 24  DPFGARGDFITAPEISQAFGECLGLWAAIAWQAMGRPAPVLLVELGPGRGTLMADALRAI 83

Query: 101 CKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFD 160
            ++ PDF + L +++VE S  L   Q + LA  G    W+  + D+P G   ++ANEF D
Sbjct: 84  AQVVPDFRAALRLHLVEQSPALRARQAELLA--GADPAWHDRVEDLPPGPALVLANEFLD 141

Query: 161 SLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFE-NSPCRD 219
           +LPI+QF        ER ++         N             ++   GAI E   P R 
Sbjct: 142 ALPIRQFERRGGAWLERHVEDG-------NFVLLPAADAPPLPAEAPEGAIQEVCEPARA 194

Query: 220 REMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQ 279
              Q +  RLA  GG A+ +DYG  +S +GD+LQA+  H    PL  PG AD+++HVDFQ
Sbjct: 195 IAAQ-LGARLAAQGGAALFVDYGPARSGLGDSLQALSAHGAADPLGTPGAADITAHVDFQ 253

Query: 280 RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK-QTARKDILLDSVKRLVSTSADK 338
            ++   +       G   QG FL+ LG+  RA  L + + A   + L + +RL++     
Sbjct: 254 AVAEAGMAAGAAAQGPVPQGIFLQSLGLVTRAAMLARARPASAGMQLSAAQRLIA----P 309

Query: 339 KSMGELFKILVVSHEKVELMP 359
           + MG LFK L + H  + ++P
Sbjct: 310 EGMGRLFKALALCHPALPILP 330


>gi|42565270|ref|NP_189511.2| unknown protein [Arabidopsis thaliana]
 gi|95147286|gb|ABF57278.1| At3g28700 [Arabidopsis thaliana]
 gi|332643957|gb|AEE77478.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 471

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 118/341 (34%), Positives = 196/341 (57%), Gaps = 28/341 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ + ++IK + G ++V +Y    + +P+ G+Y   + FGA GDF+T+PE+SQ+FG
Sbjct: 75  DSELVKHLKSIIKFRGGPISVAEYMEEVLTNPKAGFYMNRDVFGAQGDFITSPEVSQMFG 134

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++ +C WEQ G P  V LVELGPGRG +M D+LR   K K +F   L I++VE S 
Sbjct: 135 EMIGVWTVCLWEQMGRPERVNLVELGPGRGTLMADLLRGTSKFK-NFTESLHIHLVECSP 193

Query: 121 RLTLIQ-------------KKQLASY-GDKINWYTSLADVPLGF-TFLVANEFFDSLPIK 165
            L  +Q             KK ++S  G  ++W+ +L +VP G  T ++A+EF+D+LP+ 
Sbjct: 194 ALQKLQHQNLKCTDESSSEKKAVSSLAGTPVHWHATLQEVPSGVPTLIIAHEFYDALPVH 253

Query: 166 QFVMTEHGIRERMIDIDQHDSLVFNIGDHEI--------KSNFLTCSDYFLGAIFENSPC 217
           QF  +  G  E+M+D+ +     F +             +  + T  +       E SP 
Sbjct: 254 QFQKSTRGWCEKMVDVGEDSKFRFVLSPQPTPAALYLMKRCTWATPEEREKMEHVEISPK 313

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
                Q ++ R+  DGG A++IDYG + + + D+LQA++ H +V+ L +PG ADLS++VD
Sbjct: 314 SMDLTQEMAKRIGSDGGGALIIDYG-MNAIISDSLQAIRKHKFVNILDDPGSADLSAYVD 372

Query: 278 FQRL--SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
           F  +  S+      + ++G  TQ +FL  LGI  R  +L++
Sbjct: 373 FPSIKHSAEEASENVSVHGPMTQSQFLGSLGINFRVDALLQ 413


>gi|332643958|gb|AEE77479.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 471

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 118/341 (34%), Positives = 196/341 (57%), Gaps = 28/341 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ + ++IK + G ++V +Y    + +P+ G+Y   + FGA GDF+T+PE+SQ+FG
Sbjct: 75  DSELVKHLKSIIKFRGGPISVAEYMEEVLTNPKAGFYMNRDVFGAQGDFITSPEVSQMFG 134

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++ +C WEQ G P  V LVELGPGRG +M D+LR   K K +F   L I++VE S 
Sbjct: 135 EMIGVWTVCLWEQMGRPERVNLVELGPGRGTLMADLLRGTSKFK-NFTESLHIHLVECSP 193

Query: 121 RLTLIQ-------------KKQLASY-GDKINWYTSLADVPLGF-TFLVANEFFDSLPIK 165
            L  +Q             KK ++S  G  ++W+ +L +VP G  T ++A+EF+D+LP+ 
Sbjct: 194 ALQKLQHQNLKCTDESSSEKKAVSSLAGTPVHWHATLQEVPSGVPTLIIAHEFYDALPVH 253

Query: 166 QFVMTEHGIRERMIDIDQHDSLVFNIGDHEI--------KSNFLTCSDYFLGAIFENSPC 217
           QF  +  G  E+M+D+ +     F +             +  + T  +       E SP 
Sbjct: 254 QFQKSTRGWCEKMVDVGEDSKFRFVLSPQPTPAALYLMKRCTWATPEEREKMEHVEISPK 313

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
                Q ++ R+  DGG A++IDYG + + + D+LQA++ H +V+ L +PG ADLS++VD
Sbjct: 314 SMDLTQEMAKRIGSDGGGALIIDYG-MNAIISDSLQAIRKHKFVNILDDPGSADLSAYVD 372

Query: 278 FQRL--SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
           F  +  S+      + ++G  TQ +FL  LGI  R  +L++
Sbjct: 373 FPSIKHSAEEASENVSVHGPMTQSQFLGSLGINFRVDALLQ 413


>gi|218531060|ref|YP_002421876.1| hypothetical protein Mchl_3110 [Methylobacterium chloromethanicum
           CM4]
 gi|218523363|gb|ACK83948.1| protein of unknown function DUF185 [Methylobacterium
           chloromethanicum CM4]
          Length = 361

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 132/354 (37%), Positives = 187/354 (52%), Gaps = 15/354 (4%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
             L+  +   I+ +G + +D+Y A C+  P  GYY+T +PFG  GDFVTAPEISQ+FGE+
Sbjct: 6   TPLLAILAREIRASGPLGLDRYMAFCLGHPLHGYYATRDPFGRGGDFVTAPEISQMFGEL 65

Query: 63  L---AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           +   A  ++      G   C  LVELGPGRG +M D LR +     DF     +++VETS
Sbjct: 66  VGAWAAAVLAMMPATGVRPC--LVELGPGRGTLMADALRALRAAGSDF----ELHLVETS 119

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             L  +Q ++LA       ++ S+A +P     ++ANEFFD+LP +QFV TE G  ER +
Sbjct: 120 PVLRRLQAERLADAAP--TFHDSVASLPDAPLLVIANEFFDALPARQFVRTELGWCERRV 177

Query: 180 DI-DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
            +    D+L F + D E        ++   GA+          M+ ++ RL   GG  + 
Sbjct: 178 GLAPDGDALAFGL-DPEPDPRL--TAEAPAGAVLTLPSQGLAVMRDLARRLVARGGALLA 234

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+ +   GDT QAV GH +  PL  PG+ADL+ HVDF  L+  A      ++G  TQ
Sbjct: 235 IDYGHDRPGFGDTFQAVAGHRFADPLARPGEADLTLHVDFGALARAAAAEGAALHGPVTQ 294

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
             FL  LG+  RA  L  +             L  T +D + MG LFK+L  SH
Sbjct: 295 RDFLLALGLAMRAERLKARATPDQAQAIDAAVLRLTDSDPRGMGALFKVLCASH 348


>gi|254292683|ref|YP_003058706.1| hypothetical protein Hbal_0307 [Hirschia baltica ATCC 49814]
 gi|254041214|gb|ACT58009.1| protein of unknown function DUF185 [Hirschia baltica ATCC 49814]
          Length = 361

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 129/351 (36%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++ +LIK +G +++  +  L + D + GYY+T    G   DF TAPEISQIFGEML 
Sbjct: 10  LEERLKSLIKTDGPISLSVFMQLALFDRKQGYYATRPGLGK--DFTTAPEISQIFGEMLG 67

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           ++    W+Q G PS   L+E+GPGRGIMM DI R   K+   F      Y++E S  L  
Sbjct: 68  VWAAHEWQQMGCPSPFYLIEMGPGRGIMMKDIWRATAKIA-GFHDAAHPYLIEPSPSLRK 126

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
           IQ K+L++  +   W   L D+P G + ++ANE  D LPI+QF+  +    ER I +D++
Sbjct: 127 IQAKRLSALKNP-QWVNELTDIPNGPSIILANEVLDCLPIRQFIRQDGAWCERKIGLDKN 185

Query: 185 DSLVFNIGDH---EIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
            + +  I      E ++     SD  +  + E S   D  ++ ISDRL  D   A+ IDY
Sbjct: 186 GNFMLGISSPISTETENTPDNLSD-MVQDVVEISSALDAFIELISDRLKHDNSRALFIDY 244

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
           G   S  GDTL+A      V PL N G  DL++ VDF ++   A  + L I G + QG F
Sbjct: 245 GPANSTPGDTLRAYSDGKQVDPLSNVGNVDLTADVDFAKVVQSAKTHGLEIAGPSPQGWF 304

Query: 302 LEGLGIWQRAFSLMKQTARK-DILLDSVKRLVSTSADKKSMGELFKILVVS 351
           L  LG  +R  +L+ Q   K D + +   R+++       MGE F+ L +S
Sbjct: 305 LNALGGVERVNALINQNPDKIDEISEGAMRIMAPD----QMGERFQALCLS 351


>gi|297815160|ref|XP_002875463.1| hypothetical protein ARALYDRAFT_905140 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297321301|gb|EFH51722.1| hypothetical protein ARALYDRAFT_905140 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 471

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/341 (34%), Positives = 192/341 (56%), Gaps = 28/341 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           E +L++ + ++IK + G ++V +Y    + +P+ G+Y   + FGA GDF+T+PE+SQ+FG
Sbjct: 75  ETELVKHLKSIIKFRGGPISVAEYMEEVLTNPKAGFYMNRDVFGAQGDFITSPEVSQMFG 134

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++ +C WEQ G P  V LVELGPGRG +M D+LR   K + +F   L I++VE S 
Sbjct: 135 EMIGVWTVCLWEQMGRPERVNLVELGPGRGTLMADLLRGTSKFR-NFTESLHIHLVECSP 193

Query: 121 RLTLIQKKQL--------------ASYGDKINWYTSLADVPLGF-TFLVANEFFDSLPIK 165
            L  +Q + L              +  G  ++W+ +L +VP G  T ++A+EF+D+LP+ 
Sbjct: 194 ALQKLQHQNLKCIDESSLEKKVISSLAGTPVHWHATLEEVPSGVPTLIIAHEFYDALPVH 253

Query: 166 QFVMTEHGIRERMIDIDQHDSLVFNIGDHEI--------KSNFLTCSDYFLGAIFENSPC 217
           QF  +  G  E+M+D+ +     F +             +  + T  +       E SP 
Sbjct: 254 QFQKSSRGWCEKMVDVGEDSKFHFVLSPQPTPAALYLMKRCTWATPEEREKLEHVEISPK 313

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
                Q ++ R+  DGG A++IDYG +   + D+LQA++ H +V+ L +PG ADLS++VD
Sbjct: 314 SMDLTQEMAKRIGSDGGGALIIDYG-MNEIISDSLQAIRKHKFVNILDDPGSADLSAYVD 372

Query: 278 FQRL--SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
           F  +  S+      + ++G  TQ +FL  LGI  R  +L++
Sbjct: 373 FPSIKHSAEEASENVSVHGPMTQSQFLGSLGINFRVDALLQ 413


>gi|254420131|ref|ZP_05033855.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gi|196186308|gb|EDX81284.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
          Length = 361

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 129/362 (35%), Positives = 184/362 (50%), Gaps = 24/362 (6%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           ++   I   G MTV  Y   C+ DP+ GYY++    G  GDF+TAP +SQ+FGE++ ++ 
Sbjct: 10  RLAREIALTGPMTVADYVTRCLHDPKGGYYASRPALGEGGDFITAPLVSQMFGELIGLWA 69

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           +  W + G P   RLVE+GPG G +M D LR   +L P F     + ++E S  L  +Q 
Sbjct: 70  VETWNRLGAPERFRLVEVGPGDGTLMSDALRA-ARLVPGFLEACDLILIEPSAPLRDLQA 128

Query: 128 KQLASYGDKINWYTSL----ADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
           K LA       W   L     D P+    L+ANE  D LP +QFV T+ G  ER I +  
Sbjct: 129 KALAGADLSPRWVRDLTRIETDAPV---ILIANEVLDCLPARQFVRTDGGWAERRIGVTD 185

Query: 184 HDSLVFNIGDHEIKSNFLTCS-DYFLGAIFENSPCRDREMQSISDR-----LACDGGTAI 237
            + L+F +    I   F   + D   G +FE S     E Q+I  R     L    G A+
Sbjct: 186 DNDLIFGL--TAISGGFEKPAFDIEPGEVFEIS-----EQQAIFGRDLAGLLKAASGAAL 238

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           +IDYG  +   GDTLQA++ H  V PL +PG+ADL+   DF R+   A+     + G  T
Sbjct: 239 LIDYGRARPEAGDTLQALRRHQKVDPLDSPGEADLTQWADFPRVLEAAVRAGADVTGCLT 298

Query: 298 QGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVEL 357
           QG+FL  LGI  RA  L  +  R D      ++L   +A+ + MG LFK   +   +  +
Sbjct: 299 QGEFLRRLGIEARAERL--KAGRPDAAPVIDRQLHRLTAEDQ-MGSLFKAAAIFSPRALI 355

Query: 358 MP 359
           +P
Sbjct: 356 VP 357


>gi|87198703|ref|YP_495960.1| hypothetical protein Saro_0679 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134384|gb|ABD25126.1| protein of unknown function DUF185 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 351

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 189/351 (53%), Gaps = 20/351 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L+   V LI   G +++  Y A   A     YY+  +PFG  GDF+TAPEISQ+FG
Sbjct: 1   MTTSLLDTFVRLIANTGPISMAHYMAESNAR----YYAAQDPFGVAGDFITAPEISQMFG 56

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++L   W + G P  V  VELGPGRG +  D LR   +    +  V   + VETS 
Sbjct: 57  ELIGLYLADIWIRAGRPEPVHYVELGPGRGTLARDALRAARR----YGLVPRTHFVETS- 111

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPL-GFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             T ++  QL  + D   W+  L+ +P+ G   +VANEF D+LP++Q V T  G RERM+
Sbjct: 112 --TALKALQLDMHPDA-RWHADLSTLPVDGPLLIVANEFLDALPVRQMVKTAAGWRERMV 168

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTC-SDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
            +D    LV   G   + +       +   GAI E SP     +  ++ RLA  GGTA+ 
Sbjct: 169 GLDD-GRLVPVSGSAPMDAAVPAGRQEAPEGAILETSPACAAVIYEVAGRLAAQGGTALF 227

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           IDYG+ + R+G +LQAV+ H  V     PG+ADL++HVDF  L+ IA   ++   G   Q
Sbjct: 228 IDYGHAEPRLGSSLQAVRAHRKVDVFAAPGEADLTAHVDFSALAPIAQSREVRWLGTVEQ 287

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDILLDSVK-RLVSTSADKKSMGELFKIL 348
           G +L  LGI  RA +L   +      + + + RL+    D+  MG LFK++
Sbjct: 288 GDWLRALGIEARAEALATFSPPHAQAIHAARDRLI----DEGQMGSLFKVM 334


>gi|306837807|ref|ZP_07470670.1| Hypothetical protein BROD_0614 [Brucella sp. NF 2653]
 gi|306407103|gb|EFM63319.1| Hypothetical protein BROD_0614 [Brucella sp. NF 2653]
          Length = 307

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 167/312 (53%), Gaps = 15/312 (4%)

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           +FGE++ I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVE
Sbjct: 1   MFGELIGIWCLREWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVE 60

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHG 173
           TS RL   Q+++LA     I W+   AD+P     G   LV NE FD++P +QFV  +  
Sbjct: 61  TSPRLAEKQRQKLAGTKAHIEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGR 120

Query: 174 IRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLA 230
             ERM+ +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A
Sbjct: 121 FVERMVALNEQDEFHFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIA 179

Query: 231 CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
              G A+ IDYG+L+S  GDTLQA+  H Y     +PG ADL+SHVDF  L   A     
Sbjct: 180 ATRGAALNIDYGHLESGFGDTLQAMLKHAYDDVFAHPGAADLTSHVDFDILQKTAKACGC 239

Query: 291 YINGLTTQGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
              G  TQG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L
Sbjct: 240 K-TGTMTQGEFLLAMGLVDRAGQLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVL 294

Query: 349 VVSHEKVELMPF 360
             S E+  L+PF
Sbjct: 295 AFSDEQTRLLPF 306


>gi|91204830|ref|YP_537185.1| hypothetical protein RBE_0015 [Rickettsia bellii RML369-C]
 gi|157826399|ref|YP_001495463.1| hypothetical protein A1I_00070 [Rickettsia bellii OSU 85-389]
 gi|91068374|gb|ABE04096.1| unknown [Rickettsia bellii RML369-C]
 gi|157801703|gb|ABV78426.1| hypothetical protein A1I_00070 [Rickettsia bellii OSU 85-389]
          Length = 366

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/359 (34%), Positives = 197/359 (54%), Gaps = 24/359 (6%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  +I+++G +T D+     +      YY         GDF TAPE+SQ+FGE++ ++ 
Sbjct: 6   KIREIIEQSGYITCDRLMQEVLHVSPTSYYRQTKSLAEEGDFTTAPEVSQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + +VELGPGRG++M D+LR   KL P+F++ LSI +++ +E   + QK
Sbjct: 66  IKEWQRIGSPKNLSIVELGPGRGLLMRDLLRT-AKLVPEFYNALSINLIDINENFIVQQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
             L ++   INWY S+ D+P     ++ANEFFD++PIKQ++  +    ER+  +      
Sbjct: 125 SNLQNFDLPINWYASIEDIPKKPALIIANEFFDAMPIKQYIKVKESWYERIFVVQPVDGK 184

Query: 183 -QHDSLVFNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            ++D +  +    E ++   L   D   GA+ E S      M+ IS+ +   GG+ ++ID
Sbjct: 185 IKYDKIAVSKQLQEYLQKTHLDAKD---GAVLEESYKSIEIMKFISEHIKELGGSGLIID 241

Query: 241 YGY-----LQSR--VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY     +++R     TLQA+K H Y   + N G+ DLS+HVDF  L ++A   K+ + 
Sbjct: 242 YGYDINPNIRTRYQYNSTLQAIKNHKYCPIIENLGEEDLSAHVDFYVLKTVAQNSKINVI 301

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
              +Q  FL   GI  R  +L  +    + +++   V RL+S     K MG LFK+L V
Sbjct: 302 DTISQRDFLIENGILLRKQTLQNKLNPEQAELIERQVNRLISL----KEMGGLFKVLQV 356


>gi|126031971|gb|ABN71547.1| uncharacterized conserved protein [uncultured bacterium]
          Length = 327

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 183/347 (52%), Gaps = 38/347 (10%)

Query: 7   RKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIF 66
           + +   IK  G M+V+ Y   C       YY+T +P G  GDF TAPEISQ++GE++   
Sbjct: 6   KALAERIKAEGPMSVEAYMEAC----NTYYYATRDPLGVRGDFTTAPEISQMYGELIGAA 61

Query: 67  LICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQ 126
           L   W + G P  VR  ELGPGRG +  D LRV   ++       S+  VETS  L   Q
Sbjct: 62  LADCWNRAGQPEGVRYAELGPGRGTLASDALRV---MRAAGCEPASVEFVETSPVLREAQ 118

Query: 127 KKQL--ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
              +  A + D+I    + +D PL    +VA+EFFD+LP++Q+V             D  
Sbjct: 119 ANAVTDAIFHDEIAGLAN-SDGPL---LVVASEFFDALPVQQWV-------------DAI 161

Query: 185 DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYL 244
           +  V  IG H     F    D   GAI E SP R+  M  ++  LA  GG  I IDYGY 
Sbjct: 162 ERRVEWIGGH-----FAFDRD---GAIIETSPAREEAMAELARVLAAKGGIGIFIDYGY- 212

Query: 245 QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEG 304
            S  G++LQAV GH + SPL  PG+ DL++HVDF  L   A      ++ LT+QG +LE 
Sbjct: 213 ASGTGESLQAVGGHKFASPLEKPGEQDLTAHVDFASLGRAAREAGASVSRLTSQGTWLET 272

Query: 305 LGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           LGI  RA +L  +   +   + + +R +    D+++MG LFK++ V+
Sbjct: 273 LGIGGRALALAGRNPEQTEAIGAARRRLC---DEEAMGRLFKVMGVA 316


>gi|306844530|ref|ZP_07477119.1| Hypothetical protein BIBO1_1205 [Brucella sp. BO1]
 gi|306275141|gb|EFM56897.1| Hypothetical protein BIBO1_1205 [Brucella sp. BO1]
          Length = 307

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 166/312 (53%), Gaps = 15/312 (4%)

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           +FGE++ I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVE
Sbjct: 1   MFGELIGIWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVE 60

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHG 173
           TS RL   QK++LA     I W+   AD+P     G   LV NE FD++P +QFV  +  
Sbjct: 61  TSPRLAEKQKQKLAGTKAHIEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGR 120

Query: 174 IRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLA 230
             ERMI +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A
Sbjct: 121 FVERMIALNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIAGRIA 179

Query: 231 CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
              G A+ IDYG+L+S  GDTLQA+  H Y     +PG ADL+SHVDF  L   A     
Sbjct: 180 ATRGAALNIDYGHLESGFGDTLQAMLKHAYDDVFAHPGAADLTSHVDFDILQKTAKACGC 239

Query: 291 YINGLTTQGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
              G  TQG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L
Sbjct: 240 K-TGTMTQGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVL 294

Query: 349 VVSHEKVELMPF 360
             S  +  L+PF
Sbjct: 295 AFSDGQTRLLPF 306


>gi|254796952|ref|YP_003081789.1| ATP synthase beta subunit/transription termination factor rho
           [Neorickettsia risticii str. Illinois]
 gi|254590199|gb|ACT69561.1| ATP synthase beta subunit/transription termination factor rho
           [Neorickettsia risticii str. Illinois]
          Length = 323

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 186/344 (54%), Gaps = 27/344 (7%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I N I++NG +   ++  L +  P  GYY T NP G  GD++TAPEIS +FG  +A++++
Sbjct: 5   IKNFIRENGSIAFSKFIELSMYHPSKGYYITRNPIGKTGDYITAPEISSLFGRTVAVWIL 64

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
             WE+   P  + +VELGPG G+MM DIL  I  ++  F+  +++YM+E S  L  +Q +
Sbjct: 65  EQWERLEKPREIAIVELGPGSGMMMFDILNTIRNVE-SFYDSVTVYMIEISPFLRGVQME 123

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            L  +  KI W  S+ ++P G   ++ANEFFD+LPI QF+       ER I  D      
Sbjct: 124 NLRPHSCKIRWCNSIDELPNGKVIVLANEFFDALPIDQFIFWGGTFFERKITED------ 177

Query: 189 FNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRV 248
           F I + E +  F     +  G I E S    +   SI  R+A DGG+ +++DYG+     
Sbjct: 178 FQIEEEETRKRF--SGKFKDGDIVEISLLGKQIASSILTRIAKDGGSGLIVDYGHATCTR 235

Query: 249 GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIW 308
             T+QAVKGH ++    + G++D++  +DF  L   A         L TQG FL   GI 
Sbjct: 236 RSTIQAVKGHRFIDIFESIGESDITHEIDFSYLFPRA--------KLMTQGDFLSLYGI- 286

Query: 309 QRAFSLMKQTARKD--ILLDSVKRLVSTSADKKSMGELFKILVV 350
              F L K+++  D  IL  ++ RLV    DK  MG LFK  ++
Sbjct: 287 ---FELAKRSSATDTGILEQTLFRLV----DKGKMGRLFKCAII 323


>gi|255552842|ref|XP_002517464.1| conserved hypothetical protein [Ricinus communis]
 gi|223543475|gb|EEF45006.1| conserved hypothetical protein [Ricinus communis]
          Length = 490

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 124/345 (35%), Positives = 184/345 (53%), Gaps = 32/345 (9%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           E++L + +  +IK + G +TV +Y    + +P+ G+Y   + FGA GDF+T+PE+SQ+FG
Sbjct: 90  ESELFKHLKGIIKFRGGPITVAEYMEEVLTNPKAGFYINRDVFGAEGDFITSPEVSQMFG 149

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++ +C WEQ   P  V LVELGPGRG +M D+LR   K K  F   L I+MVE S 
Sbjct: 150 EMVGVWALCLWEQMEQPKSVNLVELGPGRGTLMADLLRGASKFK-SFTESLHIHMVECSP 208

Query: 121 RLTLIQKKQLASY------------------GDKINWYTSLADVPLGF-TFLVANEFFDS 161
            L  +Q   L                     G  I+W+TSL  VP G  T ++A+EF+D+
Sbjct: 209 ALQKLQHHNLKCVDDNNSCGSGEERTISTLAGTPISWHTSLEQVPTGSPTIIIAHEFYDA 268

Query: 162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           LP+ QF     G  E+M+D+ +     F +      +           A  E       E
Sbjct: 269 LPVHQFQRASRGWCEKMVDVAEDSMFRFVLSPQPTPATLYLVKRCKWAAPEEIEKLNHIE 328

Query: 222 M--------QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
           +         +I+ R++ DGG A++IDYG L   V D+LQA++ H +V  L NPG ADLS
Sbjct: 329 VCPKAIDLTCTIAKRISSDGGGALIIDYG-LNGVVSDSLQAIRKHKFVDILDNPGSADLS 387

Query: 274 SHVDFQ--RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
           ++VDF   R S+      + ++G  TQ +FL  LGI  R  +L++
Sbjct: 388 AYVDFASIRHSAEEASEAVSVHGPITQSQFLGSLGINFRVEALLQ 432


>gi|189024643|ref|YP_001935411.1| hypothetical protein BAbS19_I14440 [Brucella abortus S19]
 gi|189020215|gb|ACD72937.1| Protein of unknown function DUF185 [Brucella abortus S19]
          Length = 307

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 166/312 (53%), Gaps = 15/312 (4%)

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           +FGE++ I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVE
Sbjct: 1   MFGELIGIWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGAQIAMVE 60

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHG 173
           TS RL   QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +  
Sbjct: 61  TSPRLAEKQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGR 120

Query: 174 IRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFL---GAIFENSPCRDREMQSISDRLA 230
             ERMI +++ D   F  G   I    L   D+     GAIFE +P R   MQ I+ R+A
Sbjct: 121 FVERMIALNEQDEFQFVSGAGGIDPALLP-KDHVKAEEGAIFEAAPARTALMQEIASRIA 179

Query: 231 CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
              G A+ IDYG+L+S  GDTLQA+    Y     +PG ADL+SHVDF  L   A     
Sbjct: 180 ATRGAALNIDYGHLESGFGDTLQAMLKQAYDDVFAHPGVADLTSHVDFDILQKTAKACGC 239

Query: 291 YINGLTTQGKFLEGLGIWQRAFSL--MKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
              G  TQG+FL  +G+  RA  L   K  A ++ +   V+RL +       MG LFK+L
Sbjct: 240 K-TGTMTQGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQDVERLAAPD----QMGTLFKVL 294

Query: 349 VVSHEKVELMPF 360
             S E+  L+PF
Sbjct: 295 AFSDEQTRLLPF 306


>gi|88608244|ref|YP_506481.1| hypothetical protein NSE_0601 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600413|gb|ABD45881.1| conserved hypothetical protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 323

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/342 (35%), Positives = 184/342 (53%), Gaps = 23/342 (6%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
           I N I+ NG ++  ++  L +  P  GYY T NP G  GD++TAPEIS +FG+ +A++++
Sbjct: 5   IENFIRGNGSISFSKFIELSMYHPSKGYYMTRNPIGKSGDYITAPEISSLFGKTIAVWIL 64

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
             WE+ G P  + L ELGPG G+MM DIL  I  ++P F+  ++++MVE S  L  +Q +
Sbjct: 65  EQWEKLGKPGEIVLAELGPGSGMMMFDILNTIRNIEP-FYDAVTVHMVEISPFLRGVQME 123

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
            L  +  K  W  S+ ++P G   ++ANEFFD+LPI QF+       ER I  D      
Sbjct: 124 NLRPHSCKTRWCKSVDELPNGKLLVLANEFFDALPIDQFIFWGGNFFERKITED------ 177

Query: 189 FNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRV 248
           F + + + +  F    ++  G I E S    +   SI  R+A DGG  ++IDYG+     
Sbjct: 178 FQVEEEKTQKKF--SGEFKDGDIVEISLLGKQIASSILARIAKDGGGGLIIDYGHATRTR 235

Query: 249 GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIW 308
             T+QAVKGH ++    + G++D++  +DF  L   A         L TQG FL   GI+
Sbjct: 236 RSTVQAVKGHRFIDIFESIGESDITHEIDFSYLFPRA--------KLMTQGDFLSLYGIF 287

Query: 309 QRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           +  F+         IL  ++ RLV    DK  MG LFK  ++
Sbjct: 288 E--FAKRFSATDTGILEQTLSRLV----DKGKMGRLFKCAII 323


>gi|242053431|ref|XP_002455861.1| hypothetical protein SORBIDRAFT_03g026410 [Sorghum bicolor]
 gi|241927836|gb|EES00981.1| hypothetical protein SORBIDRAFT_03g026410 [Sorghum bicolor]
          Length = 499

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 190/343 (55%), Gaps = 29/343 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ I ++IK ++G +++ +Y    + +P+ G+Y   + FG  GDF+T+PE+SQ+FG
Sbjct: 102 DSELVKHIKSIIKFRSGPISIAEYMEEVLTNPQSGFYINRDVFGESGDFITSPEVSQMFG 161

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ I+ +C WEQ G P+ V L+ELGPGRG ++ D+LR   K   +F   LSI +VE S 
Sbjct: 162 EMIGIWAMCLWEQMGKPAMVNLIELGPGRGTLLADLLRGSAKFV-NFTKALSINLVECSP 220

Query: 121 RLTLIQKKQLASY---------------GDKINWYTSLADVPLGF-TFLVANEFFDSLPI 164
            L  IQ   L                  G  I W+ SL  VP G  T ++A+EF+D+LPI
Sbjct: 221 TLQKIQYNTLKCEDEHVDDGKRTVSKLCGAPICWHASLEQVPSGSPTIIIAHEFYDALPI 280

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI--------KSNFLTCSDYFLGAIFENSP 216
            QF     G  E+M+D+ +  S  F +  H          +S + +  +       E  P
Sbjct: 281 HQFQKASRGWCEKMVDLAEDSSFRFVLSPHPTPSLIYLAKRSGWASSEELERIEHIEVCP 340

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                 + I+DR++ DGG A++IDYG     V D+LQA++ H +V  L +PG ADLS++V
Sbjct: 341 KAMELTEQIADRISSDGGGALIIDYGK-NGIVSDSLQAIRKHKFVDILDDPGSADLSAYV 399

Query: 277 DFQRL--SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
           DF  +  S+      + ++G  TQ +FL  LGI  R  +L++ 
Sbjct: 400 DFASIKHSAEEASDDISVHGPMTQSQFLGSLGINFRVEALLQN 442


>gi|294011547|ref|YP_003545007.1| hypothetical protein SJA_C1-15610 [Sphingobium japonicum UT26S]
 gi|292674877|dbj|BAI96395.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 355

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/357 (34%), Positives = 184/357 (51%), Gaps = 20/357 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +E  L  ++   I+  G +++  Y    +A+    YY T +P GA GDF TAPEISQ+FG
Sbjct: 3   VELTLSERLARQIEAGGPISIAHY----MAEANQHYYGTRDPLGAAGDFTTAPEISQMFG 58

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ + L   W + G       VELGPGRG +  D LR +  +   F     ++ VETS 
Sbjct: 59  ELIGLCLADIWMRSGSRPAAHYVELGPGRGTLASDALRAMASVT--FHP--RVHFVETSP 114

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVP-LGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
            L    +++  +    +  + S++ +P  G   +VANEFFD+LP +Q V      RER++
Sbjct: 115 SL----RERQGALIPNVAHHDSVSSLPEQGPLLVVANEFFDALPARQLVRVGSEWRERVV 170

Query: 180 ---DIDQHDSLVFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGT 235
              D DQ D      G   ++S      +D   GAI E           ++ R+A  GG 
Sbjct: 171 VRPDPDQPDRFAPMAGYRRVESGIPAMAADAPEGAILEMPLAGSAIALELAHRIAKQGGA 230

Query: 236 AIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGL 295
           AIVIDYGY     GDTLQAV+ H Y  P + PG++DL++HVDF  + ++A    L +   
Sbjct: 231 AIVIDYGYEGPATGDTLQAVRAHRYADPFLEPGESDLTTHVDFTMIGNMARQAGLRVTRT 290

Query: 296 TTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
             QG FL  LGI  RA  L + T  +   +++ +R ++   D  +MG LFK +   H
Sbjct: 291 VGQGAFLRQLGIDARADQLSRTTPARAEEVEAARRRLT---DDDAMGTLFKAMAWVH 344


>gi|58617060|ref|YP_196259.1| hypothetical protein ERGA_CDS_03330 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416672|emb|CAI27785.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 367

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 187/344 (54%), Gaps = 26/344 (7%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G ++V+Q+  + + D   GYY T  PFG  GDFVT+PEISQ+FGE++A++++  WE+ G 
Sbjct: 42  GAISVEQFMRIALYDMNCGYYMTQMPFGVFGDFVTSPEISQLFGEVIALWVLLYWEKMGS 101

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           PS   L+ELGPGRG ++ DI+RV+ K K   +S + IY++E S +L  +Q   L   G+K
Sbjct: 102 PSKFVLLELGPGRGTLISDIIRVLKKFK-QCYSAVDIYLLEVSPKLQEVQYNTLQDVGEK 160

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI 196
           + W   +  +P     ++ANEFFD+LPIKQF+       ER I ++ +    F   +  I
Sbjct: 161 VLWCRDINSIPNYPILVIANEFFDALPIKQFICISDSWYERYITVEDNK---FRFINKLI 217

Query: 197 KSNFLTCSDYFLGAIFENSP----CRD--REMQSISDRLACDGGTAIVIDYGYLQSRVGD 250
             NF       L     N P    C D    ++ I  ++  + G A++IDYGY+      
Sbjct: 218 DKNF-----QILNVNNINDPIIEVCDDAISIIKLIEHKILQNKGAAVIIDYGYIDPPYKS 272

Query: 251 TLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           T+Q+VK H Y +   N G +D++ HVDF  L         YI    TQ  FL   GI +R
Sbjct: 273 TMQSVKNHQYNNIFENVGNSDITVHVDFTALRKSLSFLNSYI---MTQRDFLYNFGIRER 329

Query: 311 AFSLMKQT--ARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
              L++    A++  L+    RL       ++MG +FK+L+++H
Sbjct: 330 LQILIENATEAQQQNLMTGFLRLT------ENMGSMFKVLLINH 367


>gi|148284461|ref|YP_001248551.1| hypothetical protein OTBS_0811 [Orientia tsutsugamushi str.
           Boryong]
 gi|146739900|emb|CAM79877.1| conserved hypothetical protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 386

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/361 (34%), Positives = 193/361 (53%), Gaps = 18/361 (4%)

Query: 7   RKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIF 66
           + I  +I+    +TV+   ++ +      YY    P G  GDF+TAPEISQ+FGEM+ I+
Sbjct: 7   QHIRQIIRSENNITVENLMSIVMESRYNSYYRIQQPLGKAGDFITAPEISQMFGEMIGIW 66

Query: 67  LICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQ 126
            I  W +   P  + L+ELGPG G ++ DIL     +K  F + +S+ +VE +  L  IQ
Sbjct: 67  CIDLWHKLNCPQKIDLIELGPGNGTLLHDILNATRHIK-KFSTAISLILVEINCTLKKIQ 125

Query: 127 KKQLASYGDKINWYTSLADVPLGF-TFLVANEFFDSLPIKQFVMT------EHGIRERMI 179
           +  L S+   I W  S+  +   + T ++ANEFFD+LPIKQ++        +    ER++
Sbjct: 126 RDTLLSFNVPIKWVKSVNHIVSSYPTIILANEFFDALPIKQYIKKINQQSGQINWLERVV 185

Query: 180 DIDQHDSLVFNIGDHEIKSN-FLTCSDYFL-GAIFENSPCRDREMQSISDRLACDGGTAI 237
            ID ++ L F+  D +I  N FL   +    G + E SP + + +Q++S+ L  +GG  +
Sbjct: 186 KIDNNNKLYFDTIDADINENKFLKLHNNAPNGGVLEISPAQHQTIQAVSNLLKKNGGGGL 245

Query: 238 VIDYGYLQS-------RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
           +IDYGY  S       +   +LQAVK H Y   L N G ADLS+HVDF  L +IA+   +
Sbjct: 246 IIDYGYDISPEQRKNYQYNSSLQAVKHHQYHPLLENLGCADLSAHVDFWSLKNIAVAEGI 305

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
              G  +Q   L  LGI  R  +++KQ    + L   +    +     ++MGELFK + +
Sbjct: 306 VSFGSISQNVLLHKLGIKTR-LNMLKQINSDENLASKLDLQYNRLTSVRAMGELFKAIAI 364

Query: 351 S 351
           +
Sbjct: 365 T 365


>gi|115438020|ref|NP_001043438.1| Os01g0588800 [Oryza sativa Japonica Group]
 gi|53792246|dbj|BAD52879.1| ATP synthase beta subunit/transcription termination factor rho-like
           [Oryza sativa Japonica Group]
 gi|113532969|dbj|BAF05352.1| Os01g0588800 [Oryza sativa Japonica Group]
 gi|215704112|dbj|BAG92952.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222618761|gb|EEE54893.1| hypothetical protein OsJ_02410 [Oryza sativa Japonica Group]
          Length = 504

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 190/345 (55%), Gaps = 29/345 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ + ++IK ++G ++V +Y    + +P+ G+Y   + FG  GDF+T+PE+SQ+FG
Sbjct: 106 DSELVKHLKSIIKFRSGPISVAEYMEEVLTNPQSGFYINRDVFGTSGDFITSPEVSQMFG 165

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM  ++ +C WEQ G P  V L+ELGPGRG ++ D+LR   K   +F   L+I +VE S 
Sbjct: 166 EMTGVWAMCLWEQMGQPEKVNLIELGPGRGTLLADLLRGSSKFV-NFTKALNINLVECSP 224

Query: 121 RLTLIQKKQLA----SYGDK-----------INWYTSLADVPLGF-TFLVANEFFDSLPI 164
            L  +Q   L       GDK           ++W+ SL  VP G  T ++A+EF+D+LPI
Sbjct: 225 TLQKVQYNTLKCEDEPIGDKTRTVSKLCGAPVHWHASLEQVPSGLPTIIIAHEFYDALPI 284

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKS--------NFLTCSDYFLGAIFENSP 216
            QF     G  E+M+D+ +  S  F +      S         + +  +       E  P
Sbjct: 285 HQFQKASRGWCEKMVDLAEDSSFRFVLSPQPTASLLFLSKRCGWASSEELEKVEHIEVCP 344

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                 + I+DR++ DGG A++IDYG     V D+LQA++ H +V  L NPG ADLS++V
Sbjct: 345 KAMEITEQIADRISSDGGGALIIDYGK-DGIVSDSLQAIRKHKFVHILDNPGSADLSAYV 403

Query: 277 DFQ--RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA 319
           DF   R S+      + ++G  TQ +FL  LGI  R  +L++  A
Sbjct: 404 DFASIRHSAKEASDDISVHGPMTQSQFLGSLGINFRVEALLQNCA 448


>gi|190571091|ref|YP_001975449.1| hypothetical protein WPa_0686 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019611|ref|ZP_03335417.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357363|emb|CAQ54794.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995033|gb|EEB55675.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 347

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/356 (35%), Positives = 201/356 (56%), Gaps = 19/356 (5%)

Query: 3   NKLIRKIVNLIKKN-GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           N ++  I  LI K+ G +++  + +  +   E+GYY    P G  GDF+TAPEISQ+FGE
Sbjct: 4   NNMLTYIHELIDKSQGSISISDFISAALYHKEYGYYMNKLPLGKDGDFITAPEISQLFGE 63

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
            +A++++  WE+ G PS   LVELGPG+G ++ DI+RV  K    FFS ++I++VE S  
Sbjct: 64  TIAVWIMNTWEKLGKPSKFSLVELGPGKGTLIHDIIRVTKKYSC-FFSSMNIHLVEISPL 122

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
           L  IQK++L   G  INW+T + ++P   T   ANE FD+LPI QF+  +    E  +  
Sbjct: 123 LQKIQKEKLK--GLDINWHTDVDNLPNQPTIFFANELFDALPIDQFIYRDEQWYENRVIK 180

Query: 182 DQHDSLVFNIGD-HEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
               SL  ++      K+ F T  +  F GA+ E        ++ + +++  +GG A++I
Sbjct: 181 QDDGSLSLSLQCLTRPKTGFQTGMTGGFNGAVVEVCLAGIEILKKLENKIVNNGGAALII 240

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN-GLTTQ 298
           DYGY+      TLQ+++ H Y + L N G +D+++ V+FQ L         ++N  + TQ
Sbjct: 241 DYGYVYPEYKSTLQSIRQHKYTNFLENVGNSDITALVNFQSLKDSL----RHVNCEILTQ 296

Query: 299 GKFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
            +FL   GI +RA +LMK  +  +K+ +     RL       ++MG LFK++++ H
Sbjct: 297 REFLHLFGIKERAQALMKNASNEQKNKIFSEFLRLT------ENMGTLFKVMLIHH 346


>gi|218188556|gb|EEC70983.1| hypothetical protein OsI_02631 [Oryza sativa Indica Group]
          Length = 504

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 190/345 (55%), Gaps = 29/345 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ + ++IK ++G ++V +Y    + +P+ G+Y   + FG  GDF+T+PE+SQ+FG
Sbjct: 106 DSELVKHLKSIIKFRSGPISVAEYMEEVLTNPQSGFYINRDVFGTSGDFITSPEVSQMFG 165

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM  ++ +C WEQ G P  V L+ELGPGRG ++ D+LR   K   +F   L+I +VE S 
Sbjct: 166 EMTGVWAMCLWEQMGQPEKVNLIELGPGRGTLLADLLRGSSKFV-NFTKALNINLVECSP 224

Query: 121 RLTLIQKKQLA----SYGDK-----------INWYTSLADVPLGF-TFLVANEFFDSLPI 164
            L  +Q   L       GDK           ++W+ SL  VP G  T ++A+EF+D+LPI
Sbjct: 225 TLQKVQYNTLKCEDEPIGDKTRTVSKLCGAPVHWHASLEQVPSGLPTIIIAHEFYDALPI 284

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKS--------NFLTCSDYFLGAIFENSP 216
            QF     G  E+M+D+ +  S  F +      S         + +  +       E  P
Sbjct: 285 HQFQKASRGWCEKMVDLAEDSSFRFVLSPQPTASLLFLSKRCGWASSEELEKVEHIEVCP 344

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                 + I+DR++ DGG A++IDYG     V D+LQA++ H +V  L NPG ADLS++V
Sbjct: 345 KAMEITEQIADRISSDGGGALIIDYGK-DGIVSDSLQAIRKHKFVHILDNPGSADLSAYV 403

Query: 277 DFQ--RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA 319
           DF   R S+      + ++G  TQ +FL  LGI  R  +L++  A
Sbjct: 404 DFASIRHSAKEASDDISVHGPMTQSQFLGSLGINFRVEALLQNCA 448


>gi|255264600|ref|ZP_05343942.1| ATP synthase beta subunit/transcription termination factor rho
           [Thalassiobium sp. R2A62]
 gi|255106935|gb|EET49609.1| ATP synthase beta subunit/transcription termination factor rho
           [Thalassiobium sp. R2A62]
          Length = 355

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 132/356 (37%), Positives = 192/356 (53%), Gaps = 20/356 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           + + L+R+I       G ++V  Y A C+  P+ GYY+T  PFG  GDF TAPEISQ+FG
Sbjct: 3   LTDYLLRRIA----AQGPLSVADYMAECLLHPDLGYYTTQQPFGRDGDFTTAPEISQMFG 58

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ + L  AW   G P    L ELG GRG +M D LR   +  P F   +++ MVE S 
Sbjct: 59  ELVGLSLAQAWIDAGAPDAFTLCELGGGRGTLMADALRA-ARAVPRFIDAMTVIMVEASP 117

Query: 121 RLTLIQKKQLASYGDKI-NWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
           +    Q+  L  Y     +  T L D PL    L+ANEFFD LP +QFV    G  ER+I
Sbjct: 118 QRQADQETLLMDYAPIFRDTLTDLPDQPL---LLIANEFFDCLPPRQFVRDGAGWAERVI 174

Query: 180 D-IDQHDSLVFNIGDHEIKSNF-LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
             +D    L + +   + ++      +D   G + E           I+  +A  GGTA+
Sbjct: 175 GAVD--GVLSWGLAPAQPRAELEHRLADTKDGDLVELHTLATAVTDEIAHHIASHGGTAL 232

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
           ++DYG  +S+ GDTLQA+KGH  + PL  PG +DL+  VDF+ ++  A       + +T 
Sbjct: 233 IVDYGDWRSQ-GDTLQALKGHAPIDPLAAPGLSDLTVQVDFEVIALAAQNVGARHSRVTP 291

Query: 298 QGKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           QG +LE LGI  RA +L +  Q A+ D  + + +RL  T  D+  MG LFK++ ++
Sbjct: 292 QGVWLERLGITDRAQALAQKMQGAQLDAHIAAHRRL--THPDE--MGNLFKVIAIT 343


>gi|226505940|ref|NP_001141575.1| hypothetical protein LOC100273691 [Zea mays]
 gi|194705134|gb|ACF86651.1| unknown [Zea mays]
          Length = 500

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 188/343 (54%), Gaps = 29/343 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           E++L++ I ++IK ++G +++ +Y    + +P+ G+Y   + FG  GDF+T+PE+SQ+FG
Sbjct: 102 ESELVKHIKSIIKFRSGPISIAEYMEEVLTNPQSGFYINRDVFGESGDFITSPEVSQMFG 161

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++ +C WEQ G P+ V L+ELGPGRG ++ D+LR   K   +F   LSI +VE S 
Sbjct: 162 EMIGVWAMCLWEQMGKPAKVNLIELGPGRGTLLADLLRGSAKFA-NFTKALSINLVECSP 220

Query: 121 RLTLIQKKQLASY---------------GDKINWYTSLADVPLGF-TFLVANEFFDSLPI 164
            L  IQ   L                  G  + W+ SL  VP G  T ++A+EF+D+LPI
Sbjct: 221 TLQKIQYNTLKCEDEHVGDGKRTVSKICGAPVCWHASLEQVPSGSPTIIIAHEFYDALPI 280

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKS--------NFLTCSDYFLGAIFENSP 216
            QF     G  E+M+DI +     F +  H   S         + +  +       E  P
Sbjct: 281 HQFQKASRGWCEKMVDIAEDSLFRFVLSPHPTASLIYLAKRCGWASSEELEKIEHIEVCP 340

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                 + I+DR++ DGG A++IDYG     V D+LQA++ H +V  L +PG ADLS++V
Sbjct: 341 KAMELTEQIADRISSDGGGALIIDYGK-NGIVSDSLQAIRKHKFVDILDDPGSADLSAYV 399

Query: 277 DFQRL--SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
           DF  +  S+      + ++G  TQ +FL  LGI  R  +L++ 
Sbjct: 400 DFASIKRSAEEASDDISVHGPMTQSQFLGSLGINFRVEALLQN 442


>gi|157123049|ref|XP_001653802.1| hypothetical protein AaeL_AAEL009374 [Aedes aegypti]
 gi|108874528|gb|EAT38753.1| conserved hypothetical protein [Aedes aegypti]
          Length = 426

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 133/382 (34%), Positives = 189/382 (49%), Gaps = 54/382 (14%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGAVGDFVTAPEISQIFGEMLAIFLICAW 71
           I+  G + V  Y    + +P  GYY T  + FG+ GDF+T+PEI QIFGEM+A++ +  W
Sbjct: 54  IRATGPIPVATYMKQVLTNPSAGYYMTSRDVFGSKGDFITSPEIGQIFGEMIAVWCVNEW 113

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL- 130
            + G P   +L+ELGPG+G MM D+LRV  KLK      +++ MVE SE L+ +Q + L 
Sbjct: 114 SKFGRPVPFQLIELGPGKGTMMRDVLRVFDKLK--VSQGMAVQMVEMSEHLSEVQARLLC 171

Query: 131 ----------------ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI 174
                            + G KI WY  L DVP GF  ++A+EFFD+LP+ +FV  ++  
Sbjct: 172 RSSMEYTDKPYYRSGITASGTKIYWYRQLEDVPEGFAVVLAHEFFDALPVHKFVKQDNAW 231

Query: 175 RERMIDID--QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSP--CRDRE--------- 221
           +E +IDI+    D   F +   E            L     N P   +DR          
Sbjct: 232 KEVLIDIEPKSEDGFRFIVSKSETP---------MLRLFLNNYPDLVKDRNQIEISFEAE 282

Query: 222 --MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQ 279
             ++ I  R   +GG  +V+DYG+L  + GDT +A K H    PL  PG ADL++ VDF 
Sbjct: 283 TIIRQIGSRFNGNGGFGLVVDYGHLGEK-GDTFRAFKNHKLHDPLQEPGSADLTADVDFS 341

Query: 280 RLSSIAI-LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA----RKDILLDSVKRLVST 334
            LS       +L   G T+Q  FLE  G  +R   LM         K  L D  + L   
Sbjct: 342 LLSRFCEDTTQLVTIGPTSQRAFLEAAGAQERLNVLMGNGGLSEEEKQRLSDGFRMLT-- 399

Query: 335 SADKKSMGELFKILVVSHEKVE 356
             D + MGE FK   +  +++E
Sbjct: 400 --DPEQMGERFKFFGLYPKELE 419


>gi|85375189|ref|YP_459251.1| hypothetical protein ELI_11810 [Erythrobacter litoralis HTCC2594]
 gi|84788272|gb|ABC64454.1| hypothetical protein ELI_11810 [Erythrobacter litoralis HTCC2594]
          Length = 351

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 176/350 (50%), Gaps = 17/350 (4%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M   L      LI+  G ++V Q+     A     YY + +P G+ GDF+TAPEISQ+FG
Sbjct: 1   MAETLAEIFRRLIRNTGPISVSQFMGESNAR----YYDSRDPLGSAGDFITAPEISQMFG 56

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++L   W   G    V+ VELGPGRG +  D LR   K    +  V  ++ VE S 
Sbjct: 57  ELIGLWLADMWINAGRDEYVQYVELGPGRGTLAKDALRAARK----YGFVPPVHFVEGSA 112

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            L   Q K  A      +  T   DVPL F   VANEF D+LP++Q V T  G RERM+ 
Sbjct: 113 TLREEQAKAFAEAQFHNDLSTLPVDVPLVF---VANEFLDALPVRQLVRTGQGWRERMVA 169

Query: 181 IDQHDSLVFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
           + + +  VF  GD  + S       D   G I E  P     +  ++ RL   GGTA+ I
Sbjct: 170 LGEDERFVFVAGDRPMDSAVPADWRDADPGTILETCPGAAATLYEVAGRLVEQGGTALFI 229

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYGY     G TLQAV+ H  V PL  PG ADL++ VDF  L+ +A   +    G   QG
Sbjct: 230 DYGYETLEAGSTLQAVRAHDKVDPLAEPGSADLTALVDFGTLARVAQSREARHIGTVEQG 289

Query: 300 KFLEGLGIWQRAFSLMKQTARKDILLDSVK-RLVSTSADKKSMGELFKIL 348
            +L  LGI  RA +L  +       L+  K RL++       MG LFK++
Sbjct: 290 AWLSALGIEARAQALAAKAPHYAAELEEAKQRLIA----PDQMGSLFKVM 335


>gi|189184598|ref|YP_001938383.1| hypothetical protein OTT_1691 [Orientia tsutsugamushi str. Ikeda]
 gi|189181369|dbj|BAG41149.1| hypothetical protein OTT_1691 [Orientia tsutsugamushi str. Ikeda]
          Length = 384

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 123/361 (34%), Positives = 195/361 (54%), Gaps = 18/361 (4%)

Query: 7   RKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIF 66
           + I  +I+    +TV+   ++ +      YY    P G  GDF+TAPEISQ+FGEM+ I+
Sbjct: 5   QHIRQIIRSENNITVENLMSIVMESRYNSYYRIQQPLGKAGDFITAPEISQMFGEMIGIW 64

Query: 67  LICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQ 126
            I  W +   P  + L+ELGPG+G ++ DIL     +K  F + +S+ +VE +  L  IQ
Sbjct: 65  CIDLWHKLNRPQKIDLIELGPGKGTLLCDILNATRHIK-KFSTAISLTLVEINCSLKKIQ 123

Query: 127 KKQLASYGDKINWYTSLADVPLGF-TFLVANEFFDSLPIKQFVMT------EHGIRERMI 179
           +  L S+   I W  S+  +   + T ++ANEFFD+LPIKQ++        +    ER++
Sbjct: 124 QDNLLSFNVPIKWVKSVNHIVSSYPTIILANEFFDALPIKQYIKKINQQSGQINWLERVV 183

Query: 180 DIDQHDSLVFNIGDHEIKSN-FLTCSDYFL-GAIFENSPCRDREMQSISDRLACDGGTAI 237
            ID ++ L F+  D +I  + FL   +    G + E SP + + +Q++S+ L  +GG ++
Sbjct: 184 KIDNNNKLYFDTIDADINEHKFLKLHNNAPNGGVLEISPAQHQTIQAVSNLLKKNGGGSL 243

Query: 238 VIDYGYLQS-------RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
           +IDYGY  S       +   +LQAVK H Y   L N G ADLS+HVDF  L +IA+   +
Sbjct: 244 IIDYGYDISPEQRKNYQYNSSLQAVKHHQYHPLLENLGCADLSAHVDFWSLKNIAVAEGI 303

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
              G  +Q   L  LGI  R  +++KQ    + L   +    +     ++MGELFK + +
Sbjct: 304 ASFGSISQNVLLHKLGIKTR-LNMLKQINSDENLASKLDLQYNRLTYVRAMGELFKAIAI 362

Query: 351 S 351
           +
Sbjct: 363 T 363


>gi|85710056|ref|ZP_01041121.1| hypothetical protein NAP1_14263 [Erythrobacter sp. NAP1]
 gi|85688766|gb|EAQ28770.1| hypothetical protein NAP1_14263 [Erythrobacter sp. NAP1]
          Length = 324

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 122/325 (37%), Positives = 173/325 (53%), Gaps = 20/325 (6%)

Query: 29  VADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPG 88
           +A+    YY++ +P G   DF+TAPE+SQ+FGE++ ++L   W + G    +  VELGPG
Sbjct: 1   MAESNMRYYTSRDPLGEDADFITAPEVSQMFGELIGLWLADLWVRMGSRKRIHYVELGPG 60

Query: 89  RGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPL 148
           RG +  D LR   +    +     ++ VETS  L  IQ +         +  T   D PL
Sbjct: 61  RGTLASDALRTAAR----YEFAPQVHFVETSPALRKIQLEAFPDAQHHDDLSTLPDDAPL 116

Query: 149 GFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKS----NFLTCS 204
               +VANEFFD+LPI Q V + +G  ER++ ++  D  VF  GD  + S    ++ + S
Sbjct: 117 ---LIVANEFFDALPIHQLVRSANGWHERLVGLED-DEFVFVAGDKPMDSIVPRSWKSAS 172

Query: 205 DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPL 264
               G + E S      MQ I+ RL   GG A++IDYG  + R G TLQA++ H  V   
Sbjct: 173 Q---GTMIETSAAASAVMQEIAGRLKEQGGAALIIDYGAFELRAGSTLQAIRSHEKVDVF 229

Query: 265 VNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM-KQTARKDI 323
            +PGQADL++HVDF+ L  +A      + GL  QG++L  +GI  R  +L  K  A KD 
Sbjct: 230 AHPGQADLTAHVDFEMLKDVAEKNGADVMGLQMQGEWLRQMGIETRLEALQRKNPAEKDK 289

Query: 324 LLDSVKRLVSTSADKKSMGELFKIL 348
           L     RLV    D   MG LFK+L
Sbjct: 290 LKRQFDRLV----DDGQMGLLFKVL 310


>gi|195607964|gb|ACG25812.1| uncharacterized ACR, COG1565 family protein [Zea mays]
          Length = 500

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 188/343 (54%), Gaps = 29/343 (8%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           E++L++ I ++IK ++G +++ +Y    + +P+ G+Y   + FG  GDF+T+PE+SQ+FG
Sbjct: 102 ESELVKHIKSIIKFRSGPISIAEYMEEVLTNPQSGFYINRDVFGESGDFITSPEVSQMFG 161

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++ +C WEQ G P+ V L+ELGPGRG ++ D+LR   K   +F   LSI +VE S 
Sbjct: 162 EMIGVWAMCLWEQMGKPAKVNLIELGPGRGTLLADLLRGSAKFA-NFTKALSINLVECSP 220

Query: 121 RLTLIQKKQLASY---------------GDKINWYTSLADVPLGF-TFLVANEFFDSLPI 164
            L  IQ   L                  G  + W+ SL  VP G  T ++A+EF+D+LPI
Sbjct: 221 TLQKIQYNTLKCEDEHVGDGKRTVSKICGAPVCWHASLEQVPSGSPTIIIAHEFYDALPI 280

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKS--------NFLTCSDYFLGAIFENSP 216
            QF     G  E+M+DI +     F +  H   S         + +  +       E  P
Sbjct: 281 HQFQKASRGWCEKMVDIAEDSLFRFVLSPHPTASLIYLAKRCGWASSEELEKIEHIEVCP 340

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                 + I+DR++ DGG A++IDYG     V ++LQA++ H +V  L +PG ADLS++V
Sbjct: 341 KAMELTEQIADRISSDGGGALIIDYGK-NGIVSNSLQAIRKHKFVDILDDPGSADLSAYV 399

Query: 277 DFQRL--SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
           DF  +  S+      + ++G  TQ +FL  LGI  R  +L++ 
Sbjct: 400 DFASIKRSAEEASDDISVHGPMTQSQFLGSLGINFRVEALLQN 442


>gi|315498178|ref|YP_004086982.1| hypothetical protein Astex_1155 [Asticcacaulis excentricus CB 48]
 gi|315416190|gb|ADU12831.1| protein of unknown function DUF185 [Asticcacaulis excentricus CB
           48]
          Length = 357

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 190/350 (54%), Gaps = 16/350 (4%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           +++  IK  G +T+  Y   C+ DP+ GYY+T    G  GDF+TAP ++Q+FGE LA++ 
Sbjct: 7   RLIEQIKLEGPLTIADYMWACLFDPQEGYYATRPALGEAGDFITAPLVTQMFGERLALWA 66

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           + AW+  G P+ +R++E+GPG G +M D+LR    L P F     I ++E S+ L  +Q 
Sbjct: 67  MQAWQDMGAPAKIRVLEIGPGDGTLMGDLLRTFRAL-PAFVKAAEIGLIEPSQPLRALQT 125

Query: 128 KQLASYGDKINWYTSLADVPLGFTFL-VANEFFDSLPIKQFVMTEHGIRERMIDIDQHDS 186
            +L     ++  Y SL  VP     L +ANE  D LP +QF +T  G  ER + + + + 
Sbjct: 126 DRLG----EVLHYDSLDHVPTDAPLLIIANEVLDCLPARQFQLTPDGWFERCVGMHEGEL 181

Query: 187 LVFNI-GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ 245
           ++  +    + K+ F   +    G + E S  ++R ++++   +    G A+ IDYG  +
Sbjct: 182 VIGLVPAPQDFKAPFAAET----GQVCEVSLAQNRLIEAVGALIHEATGAALFIDYGRDR 237

Query: 246 SRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGL 305
              GDTLQA+  H    PL  PG  DL+   DF  L+  A+   L ++ +T QG FL+ L
Sbjct: 238 PEPGDTLQALYRHEKTDPLAEPGAHDLTQWADFPSLAITALNMGLGVSQITPQGVFLQRL 297

Query: 306 GIWQRAFSLMKQTARK-DILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
           GI +R   L  +   + D L   V RL++     + MGELFK+L +S+ +
Sbjct: 298 GIIERFDELRAENPEETDRLARQVHRLIA----GEEMGELFKVLALSYPR 343


>gi|58579001|ref|YP_197213.1| hypothetical protein ERWE_CDS_03370 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417627|emb|CAI26831.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 367

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 186/343 (54%), Gaps = 26/343 (7%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G ++V+Q+  + + D   GYY T  PFG  GDFVT+PEISQ+FGE++A++++  WE+ G 
Sbjct: 42  GAISVEQFMRIALYDMNCGYYMTQMPFGVFGDFVTSPEISQLFGEVIALWVLLYWEKMGS 101

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           PS   L+ELGPGRG ++ DI+RV+ K K   +S + IY++E S +L  +Q   L   G+K
Sbjct: 102 PSKFVLLELGPGRGTLISDIIRVLKKFK-QCYSAVDIYLLEVSPKLQEVQYNTLQDVGEK 160

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI 196
           + W  ++  +P     ++ANEFFD+LPIKQF+       ER I ++ +    F   +  I
Sbjct: 161 VLWCRNINSIPNYPILVIANEFFDALPIKQFICISDSWYERYITVEDNK---FRFINKLI 217

Query: 197 KSNFLTCSDYFLGAIFENSP----CRD--REMQSISDRLACDGGTAIVIDYGYLQSRVGD 250
             NF       L     N P    C D    ++ I  ++  + G A++IDYGY+      
Sbjct: 218 DKNF-----QILNVNNINDPIIEVCDDAISIIKLIEHKILQNKGAAVIIDYGYIDPPYKS 272

Query: 251 TLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           T+Q+VK H Y +   N G +D++ HVDF  L         YI    TQ  FL   GI +R
Sbjct: 273 TMQSVKNHQYNNIFENVGNSDITVHVDFTALRKSLSFLNSYI---MTQRDFLYNFGIRER 329

Query: 311 AFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
              L++     ++  L+    RL       ++MG +FK+L+++
Sbjct: 330 LQILIENATEVQQQNLMTGFLRLT------ENMGSMFKVLLIN 366


>gi|224141343|ref|XP_002324033.1| predicted protein [Populus trichocarpa]
 gi|222867035|gb|EEF04166.1| predicted protein [Populus trichocarpa]
          Length = 377

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 118/335 (35%), Positives = 178/335 (53%), Gaps = 33/335 (9%)

Query: 29  VADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPG 88
           + +P+FG+Y + + FG  GDF+T+PE+SQ+FGEM+ ++ +C WEQ G P  V LVELGPG
Sbjct: 5   LTNPKFGFYISRDVFGTEGDFITSPEVSQMFGEMVGVWAMCLWEQMGRPKQVNLVELGPG 64

Query: 89  RGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY--------------- 133
           RG +M D+LR   K K  F   L +++VE S  L  +Q   L                  
Sbjct: 65  RGTLMADLLRGASKFK-SFTESLHVHLVECSPTLQKLQHHNLKCLDEDDNGDGVEKRTIS 123

Query: 134 ---GDKINWYTSLADVPLGF-TFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVF 189
              G  ++W+  L  VP G  + ++A+EF+D+LP+ QF     G  E+M+D+ +     F
Sbjct: 124 TLAGTLVSWHALLEQVPSGLPSIIIAHEFYDALPVHQFQRASRGWCEKMVDVSEDSMFRF 183

Query: 190 NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREM--------QSISDRLACDGGTAIVIDY 241
            +      +           A  E       E+         +I+DR++CDGG A++IDY
Sbjct: 184 VLSPQPTPATLYLMKRCKWAAPEEIEKLSHIEVCPKAMDLTHAIADRISCDGGGALIIDY 243

Query: 242 GYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQ--RLSSIAILYKLYINGLTTQG 299
           G L   V D+LQA++ H +++ L NPG ADLS++VDF   R S+  +   + ++G  TQ 
Sbjct: 244 G-LNGVVSDSLQAIRKHKFINILDNPGSADLSAYVDFASIRHSAEEVSADISVHGPITQS 302

Query: 300 KFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLV 332
           +FL  LGI  R  SL++     + D L     RLV
Sbjct: 303 QFLGALGINFRVESLLQNCTDEQADSLRTGYWRLV 337


>gi|326402667|ref|YP_004282748.1| hypothetical protein ACMV_05190 [Acidiphilium multivorum AIU301]
 gi|325049528|dbj|BAJ79866.1| hypothetical protein ACMV_05190 [Acidiphilium multivorum AIU301]
          Length = 324

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 170/326 (52%), Gaps = 23/326 (7%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YY++ +PF    DFVTAPEISQ+FGE+L +++  AW   G P+   LVE GPGRG +M D
Sbjct: 16  YYASRDPFV---DFVTAPEISQVFGELLGLWVAMAWSMLGSPAPFALVEAGPGRGHLMTD 72

Query: 96  ILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVA 155
            LR   +  P F     I+++ETS RL  + K +L     +  ++  L+ +P     L+A
Sbjct: 73  ALRAAKRAMPAFVEAADIHLIETSPRLIGLLKDRL----PQAMFHADLSTIPDQSIILLA 128

Query: 156 NEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENS 215
           NEF D+LPI+QFV      RER +            G     S      D   G + E +
Sbjct: 129 NEFLDALPIRQFVRRGPAWRERYV----------ADGAFVEASAETALPDAPEGTVIERN 178

Query: 216 PCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSH 275
              +  + +++ R++  GG+A++IDYG+     G++LQA+       PL  PG+ DL++H
Sbjct: 179 ETAEAFVAALASRISRRGGSALLIDYGHEGGATGESLQAIMDGQPADPLAEPGRRDLTAH 238

Query: 276 VDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI--LLDSVKRLVS 333
           VDF RL+  A      I G   QG FL  LGI +R   L     + D   LL + +RL S
Sbjct: 239 VDFSRLAMAARNAGAEIRGPAAQGAFLAALGIHERTAQLGHHAGQDDALRLLAATRRLTS 298

Query: 334 TSADKKSMGELFKILVVSHEKVELMP 359
             A    MG LF+++ +    +E +P
Sbjct: 299 PEA----MGSLFRVMAICPRGMEPLP 320


>gi|57239058|ref|YP_180194.1| hypothetical protein Erum3300 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161137|emb|CAH58050.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 339

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 186/343 (54%), Gaps = 26/343 (7%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G ++V+Q+  + + D   GYY T  PFG  GDFVT+PEISQ+FGE++A++++  WE+ G 
Sbjct: 14  GAISVEQFMRIALYDMNCGYYMTQMPFGVFGDFVTSPEISQLFGEVIALWVLLYWEKMGS 73

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           PS   L+ELGPGRG ++ DI+RV+ K K   +S + IY++E S +L  +Q   L   G+K
Sbjct: 74  PSKFVLLELGPGRGTLISDIIRVLKKFK-QCYSAVDIYLLEVSPKLQEVQYNTLQDVGEK 132

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI 196
           + W  ++  +P     ++ANEFFD+LPIKQF+       ER I ++ +    F   +  I
Sbjct: 133 VLWCRNINSIPNYPILVIANEFFDALPIKQFICISDSWYERYITVEDNK---FRFINKLI 189

Query: 197 KSNFLTCSDYFLGAIFENSP----CRD--REMQSISDRLACDGGTAIVIDYGYLQSRVGD 250
             NF       L     N P    C D    ++ I  ++  + G A++IDYGY+      
Sbjct: 190 DKNF-----QILNVNNINDPIIEVCDDAISIIKLIEHKILQNKGAAVIIDYGYIDPPYKS 244

Query: 251 TLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           T+Q+VK H Y +   N G +D++ HVDF  L         YI    TQ  FL   GI +R
Sbjct: 245 TMQSVKNHQYNNIFENVGNSDITVHVDFTALRKSLSFLNSYI---MTQRDFLYNFGIRER 301

Query: 311 AFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
              L++     ++  L+    RL       ++MG +FK+L+++
Sbjct: 302 LQILIENATEVQQQNLMTGFLRLT------ENMGSMFKVLLIN 338


>gi|163794552|ref|ZP_02188523.1| hypothetical protein BAL199_05044 [alpha proteobacterium BAL199]
 gi|159180276|gb|EDP64799.1| hypothetical protein BAL199_05044 [alpha proteobacterium BAL199]
          Length = 360

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 175/354 (49%), Gaps = 14/354 (3%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I+  G ++V    A  +  PE GYY+T +PFGA GDFVTAPEISQ+FGE++ ++    W+
Sbjct: 11  IRAEGPLSVADMMASALVHPEHGYYTTRDPFGAAGDFVTAPEISQMFGELIGLWAAVVWQ 70

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P  V LVELGPGRG +M D LR    + P F +   +++VE S  L   Q  +L  
Sbjct: 71  GMGAPDPVALVELGPGRGTLMADALRAAVGV-PAFRAAAQVHLVEASPTLRQHQATRLEK 129

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDI--DQHD---SL 187
              +  W+  L  +P     ++ANEFFD+LPI Q V      RER + +  D  +   +L
Sbjct: 130 A--RPIWHDGLDTLPDQPAIVIANEFFDALPIVQLVRDGRNWRERRLAVVADAEEFFWTL 187

Query: 188 VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
                 H    +     +   GA+ E  P      + ++DRL   GG  + IDYG+  S 
Sbjct: 188 TPGASPHAGLLDPGLRQNAPDGALAEICPSGLSIARHLADRLNRFGGAVLAIDYGHAVSA 247

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
            GDTLQAV+ H     L   G ADL++HVDF  L           +G   QG FL  LGI
Sbjct: 248 AGDTLQAVQRHKPADILATLGNADLTAHVDFGALGRAVAEAGAVQHGPLGQGAFLRQLGI 307

Query: 308 WQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             RA +L +   T +   +  +  RL+        MG LFK++  +       P
Sbjct: 308 EARAEALCRAATTEQCAAVHSACARLIH----PDEMGTLFKVVAWTRADASPPP 357


>gi|148259441|ref|YP_001233568.1| hypothetical protein Acry_0424 [Acidiphilium cryptum JF-5]
 gi|146401122|gb|ABQ29649.1| protein of unknown function DUF185 [Acidiphilium cryptum JF-5]
          Length = 324

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 169/326 (51%), Gaps = 23/326 (7%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YY++ +PF    DFVTAPEISQ+FGE+L ++   AW   G P+   LVE GPGRG +M D
Sbjct: 16  YYASRDPFV---DFVTAPEISQVFGELLGLWAAMAWSMLGSPAPFALVEAGPGRGHLMTD 72

Query: 96  ILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVA 155
            LR   +  P F     I+++ETS RL  + K +L     +  ++  L+ +P     L+A
Sbjct: 73  ALRAAKRAMPAFVEAADIHLIETSPRLIGLLKDRL----PQAMFHADLSTIPDQSIILLA 128

Query: 156 NEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENS 215
           NEF D+LPI+QFV      RER +            G     S      D   G + E +
Sbjct: 129 NEFLDALPIRQFVRRGPAWRERYV----------ADGAFVEASAETALPDAPEGTVIERN 178

Query: 216 PCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSH 275
              +  + +++ R++  GG+A++IDYG+     G++LQA+       PL  PG+ DL++H
Sbjct: 179 ETAEAFVAALASRISRRGGSALLIDYGHDGGATGESLQAIMDGQPADPLAEPGRRDLTAH 238

Query: 276 VDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI--LLDSVKRLVS 333
           VDF RL+  A      I G   QG FL  LGI +R   L     + D   LL + +RL S
Sbjct: 239 VDFSRLAMAARNAGAEIRGPAAQGAFLAALGIHERTAQLGHHAGQDDALRLLAATRRLTS 298

Query: 334 TSADKKSMGELFKILVVSHEKVELMP 359
             A    MG LF+++ +    +E +P
Sbjct: 299 PEA----MGSLFRVMAICPRGMEPLP 320


>gi|307294381|ref|ZP_07574225.1| protein of unknown function DUF185 [Sphingobium chlorophenolicum
           L-1]
 gi|306880532|gb|EFN11749.1| protein of unknown function DUF185 [Sphingobium chlorophenolicum
           L-1]
          Length = 361

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 184/360 (51%), Gaps = 26/360 (7%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +E  L  ++   I   G ++V  Y    +A+    YY T +P GA GDF TAPEISQ+FG
Sbjct: 8   VELTLSERLARQIAAGGPISVAHY----MAEANQHYYGTRDPLGAAGDFTTAPEISQMFG 63

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICK--LKPDFFSVLSIYMVET 118
           E++ + L   W + G       VELGPGRG +  D LR +    L+P       ++ VET
Sbjct: 64  ELIGLCLADIWMRSGGRPEAHYVELGPGRGTLASDALRSMASAGLRP------RVHFVET 117

Query: 119 SERLTLIQKKQLASYGDKINWYTSLADVP-LGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
           S  L   Q   + +    ++ + +++ +P  G   +VANEFFD+LP++Q +   +  RER
Sbjct: 118 SPSLRERQSALIPN----VSHHDAVSSLPERGPLLVVANEFFDALPVRQLIRVGNEWRER 173

Query: 178 MI---DIDQHDSLVFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDG 233
           ++   D D+ D      G   ++S      +D   G I E           ++ R+A  G
Sbjct: 174 VVVRPDPDEPDRFAPMAGYRRVESGIPAMAADAPEGTILEMPLAGSAIALELAHRIAKQG 233

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           G AI++DYGY     GDTLQAV+ H Y  P + PG++DL++HVDF  + ++A    L + 
Sbjct: 234 GAAIIVDYGYEGPATGDTLQAVRAHRYADPFLEPGESDLTTHVDFTMIGNMARQAGLRVT 293

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQT-ARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
               QG FL  LGI  RA  L + T AR + +  +  RL +  A    MG LFK +   H
Sbjct: 294 QTVGQGAFLRQLGIDARADQLSRTTPARAEEVEAARHRLTADDA----MGTLFKAMAWVH 349


>gi|114799553|ref|YP_760100.1| hypothetical protein HNE_1383 [Hyphomonas neptunium ATCC 15444]
 gi|114739727|gb|ABI77852.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 348

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 182/353 (51%), Gaps = 19/353 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +E++LIR    LI+  G + +  Y  + + DP+ GYY+     G   DF TAPE SQIFG
Sbjct: 3   LEDRLIR----LIETEGPIPLSAYMQIALHDPKEGYYAARPGIGR--DFTTAPETSQIFG 56

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPD-FFSVLSIYMVETS 119
           EM+ ++++  W   G PS   LVE+GPGR ++M D L++      D F S L + ++E S
Sbjct: 57  EMIGLWIVHEWRAMGAPSPFHLVEIGPGRALLMHDALKIAALAGGDAFLSALQLTLIEPS 116

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             L L+Q ++L  +  K  +   L+DVP G   LVANE+ D LP +QF       RE +I
Sbjct: 117 PALRLLQTERLQRF--KPQFAAQLSDVPAGPMLLVANEYLDCLPARQFRRDGDQWRECVI 174

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
            +     L+  +   E +    T      G + E     D  +  +  R   D   A+ +
Sbjct: 175 GLSPERRLIMGLAADEPRPPMGTA---LTGDVVEVQSGLDLIIADLVSR--TDPFRALFV 229

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG +    GDTL+A +    VSP+  PG +DL+  VDF R + IA    L ++G T QG
Sbjct: 230 DYGPVDRAPGDTLRAYREGQQVSPMETPGASDLTVDVDFGRFARIAATIGLDVSGPTPQG 289

Query: 300 KFLEGLGIWQRAFSLMKQTA-RKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
            FL GLG   R   L++      + L ++ +RL+    D + MGE FK + +S
Sbjct: 290 MFLLGLGAQARLNQLIQANPDEAEALYNAAQRLI----DPQQMGERFKAICLS 338


>gi|157803232|ref|YP_001491781.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia canadensis
           str. McKiel]
 gi|157784495|gb|ABV72996.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia canadensis
           str. McKiel]
          Length = 358

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 126/359 (35%), Positives = 188/359 (52%), Gaps = 24/359 (6%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY       + GDF+TAPE+SQ+FGE++ ++ 
Sbjct: 6   KIRQLINQNGYITCDVLIQEILYSNPASYYRQTKSLASEGDFITAPEVSQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IKEWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINQNFIAHQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
             L      I   + + D+P   T +VANEFFD++PIKQ++  +    ER+  +      
Sbjct: 125 SNLQDINLPIKHLSFIEDIPKKPTIIVANEFFDAMPIKQYIKVKELWYERIFVVQPVDGR 184

Query: 183 -QHDSLVFNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            ++D +  N    E +    +   D   GA+ E S      ++ I+  L    G+ ++ID
Sbjct: 185 IKYDKISVNKQLQEYLLQTHIEAKD---GAVLEESYKSIEIIKFIAQHLKKLSGSCLIID 241

Query: 241 YGY---LQSR----VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY   L +R       TLQAVK H Y   L N G+ADLS+HVDF  L ++A   K+ + 
Sbjct: 242 YGYDIALSNRNRYQYNPTLQAVKNHKYCPILENCGKADLSAHVDFYTLKTVAKNSKINVI 301

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
               Q  FL   GI  R+ +L  +    +  I+   V+RL+S     K MG LFK+L +
Sbjct: 302 NTILQRDFLIENGILLRSKTLQDKLNNEQAQIIEKQVERLISP----KQMGVLFKVLQI 356


>gi|195107411|ref|XP_001998307.1| GI23700 [Drosophila mojavensis]
 gi|193914901|gb|EDW13768.1| GI23700 [Drosophila mojavensis]
          Length = 436

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 122/381 (32%), Positives = 197/381 (51%), Gaps = 50/381 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I+  G +TV +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 53  LAKQLAAKIQATGPITVAEYMREVLTNPQGGYYMNRDVFGREGDFITSPEISQIFGELVG 112

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+L+  W++ G PS  +LVELGPGRG +  D+L+V+ K K    +  +++MVE S  L+ 
Sbjct: 113 IWLMNEWQKLGSPSPFQLVELGPGRGTLARDVLKVLSKFKSG--AQFTMHMVEISPYLSQ 170

Query: 125 IQKK-------------QLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
            Q +             QL+ Y       G ++ W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 171 AQAQRFCYKHEVLPEGEQLSHYQLGTTATGTQVFWHRRLEDVPAGFSLVLAHEFFDALPV 230

Query: 165 KQFVMTEHGIRERMIDIDQHDS-----LVFNIGDHEIKSNF-------LTCSDYFLGAIF 212
            +  + +   +E +ID+D   +      V +     +   F        TC +Y L A  
Sbjct: 231 HKLQLIDGQWQEVLIDVDTKSTTADFRYVLSKAQTPVSQLFKPVQQEQRTCLEYSLEA-- 288

Query: 213 ENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADL 272
                 +R ++ +S+RL   GG A+++DYG+   +  DT +A K H    PL+ PG ADL
Sbjct: 289 ------ERHVRLLSERLEQHGGIALIMDYGHFGDKT-DTFRAFKQHALHEPLLAPGTADL 341

Query: 273 SSHVDFQRLSSIAILY-KLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVK 329
           ++ VDF+ L  +A ++  ++  G   QG FL  +    R   L+       + I+    +
Sbjct: 342 TADVDFRHLKHVAEMHGDIHCCGPVQQGAFLRNMQGEVRLEQLLAHALPENQSIIRSGYE 401

Query: 330 RLVSTSADKKSMGELFKILVV 350
            L     D   MG  FK L +
Sbjct: 402 MLT----DPNQMGSRFKFLAM 418


>gi|291242927|ref|XP_002741333.1| PREDICTED: protein midA homolog, mitochondrial-like [Saccoglossus
           kowalevskii]
          Length = 429

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 132/390 (33%), Positives = 199/390 (51%), Gaps = 61/390 (15%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +N L+ +I   I  NG ++V  Y    +  P  GYY   + FG  GDF+T+PEISQ+F E
Sbjct: 38  KNLLLNQIKQTIHINGPISVADYMQTVLTSPLSGYYMKKDVFGVQGDFITSPEISQMFSE 97

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ I+++  W   G P  +++VELGPGRG +  DILRV  K +      +S+++VE S +
Sbjct: 98  LIGIWIVHEWLISGKPKTLQVVELGPGRGTLSDDILRVFAKFQ-GIHDAVSLHLVEVSPK 156

Query: 122 LTLIQKKQL---------------------ASY-------GDKINWYTSLADVPLGF-TF 152
           L+ +Q+++L                      SY       G  I W+TS++D+P G  T 
Sbjct: 157 LSQMQEEKLTGDTKQNPSTNNKDNEHAVLSGSYKTALSKTGIPITWHTSISDIPKGVPTC 216

Query: 153 LVANEFFDSLPIKQFVMTEHGIRERMIDI--DQHDSLVFNIGDHEIKSNFLTCSDYF--- 207
            +ANEFFD+LPI +   T  G RE +ID+  D  D L F +   E  ++ L   D+    
Sbjct: 217 FIANEFFDALPIHKIQKTTKGWREILIDVANDSSDQLRFVLSPTETPASQLFIEDHVEVC 276

Query: 208 -LGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVN 266
            +G +          ++ I  R+   GG A+++DYG+  ++  DT +A K H     L  
Sbjct: 277 TMGGVI---------VEEIVKRIDHSGGNALIVDYGHNGNKT-DTFRAFKEHELHDVLKE 326

Query: 267 PGQADLSSHVDF----QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTAR-- 320
           PG ADL++ VDF    + +   A+ Y     G  TQ KFL  +GI  R  +LMK+  +  
Sbjct: 327 PGSADLTADVDFSYLRKTIGDTALCY-----GPITQEKFLLNMGIEVRLEALMKKATKTQ 381

Query: 321 KDILLDSVKRLVSTSADKKSMGELFKILVV 350
           +  L+   K LV    D KSMGE FK   +
Sbjct: 382 QKNLMSGYKMLV----DPKSMGERFKFFSI 407


>gi|302383938|ref|YP_003819761.1| hypothetical protein Bresu_2831 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194566|gb|ADL02138.1| protein of unknown function DUF185 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 357

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 177/355 (49%), Gaps = 18/355 (5%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           ++++L R+I       G MTV  Y   C+ DP  GYY+T    G  GDF+TAP ISQ+FG
Sbjct: 3   LKDRLAREIA----LTGPMTVADYVTRCLHDPTDGYYATRPALGEGGDFITAPLISQMFG 58

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++ +  W++ G P   RLVE+GPG G +M D LR   ++ P F     + ++E S 
Sbjct: 59  ELIGLWAVETWQRLGAPERFRLVEVGPGDGTLMDDALRA-ARVAPGFLEACDLILIEPSG 117

Query: 121 RLTLIQKKQLASYGDKINWYTSLA----DVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
            L  +Q ++LA       W  SL     D P+    L+ANE  D LP +QFV TE G  E
Sbjct: 118 PLREVQARRLAQADVSPRWVRSLGQIDTDAPV---ILIANEVLDCLPARQFVRTEGGWAE 174

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCS-DYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           R + +     L F +    I   F     +   G + E S  +    + ++  LA   G 
Sbjct: 175 RRVGVTDGGDLTFGL--VGITGGFERPGFEVEPGQVIEASEQQAAFGRDLAAMLAEASGA 232

Query: 236 AIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGL 295
           A++IDYG  +  VGDTLQA++ H  V  L  PG+AD++   DF  +   A+     + G 
Sbjct: 233 ALLIDYGRDRPGVGDTLQALRRHAKVDVLATPGEADVTQWADFPAVLEAAVRAGADVTGC 292

Query: 296 TTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
             QG FL  LGI  RA  L  +T R +     + R ++       MG LFK   +
Sbjct: 293 VGQGDFLRRLGIEARAERL--RTGRPEA-APVIGRQLARLTGPDQMGALFKAAAI 344


>gi|258543360|ref|YP_003188793.1| hypothetical protein APA01_23000 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634438|dbj|BAI00414.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256637496|dbj|BAI03465.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256640548|dbj|BAI06510.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256643605|dbj|BAI09560.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256646660|dbj|BAI12608.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256649713|dbj|BAI15654.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256652701|dbj|BAI18635.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655757|dbj|BAI21684.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 342

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/332 (35%), Positives = 171/332 (51%), Gaps = 28/332 (8%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YY++  P   + DF+TAPEISQ+FGE+L  +    W+  G P+ V L E GPGRG +M D
Sbjct: 23  YYAS-KPL--LSDFITAPEISQVFGELLGAWAATVWQNMGCPAQVILAEAGPGRGTLMAD 79

Query: 96  ILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVA 155
            LR+I +  PDF   L++++VETS  +   QK+ LA Y  +  W+  + D+P G   L+ 
Sbjct: 80  ALRLITRCAPDFAHALNVHLVETSPLMRQAQKQALAPYA-RPTWHDRIEDLPSGPLILLG 138

Query: 156 NEFFDSLPIKQFVMTEHGIRER-MIDIDQH----DSLVFNIGDH-EIKSNFLTCSDYFLG 209
           NEF D+LPI+QFV T  G  ER +ID   H    D+ V   G   E  +    C      
Sbjct: 139 NEFLDALPIRQFVQTHSGWHERYVIDEAFHLVPCDAPVMPDGRKLEPDTIVELCEPALEV 198

Query: 210 AIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQ 269
           A +            +  R A   G A+ IDYG+  +  G +LQA++      PL   G+
Sbjct: 199 ARY------------LGQRFAAQPGVALFIDYGHHSTLTGASLQALRHARPAHPLEAAGE 246

Query: 270 ADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKD--ILLDS 327
           ADL++HVDF    + A     +I G  TQG FL  LG+ +R   L  +   +D  IL  +
Sbjct: 247 ADLTAHVDFTAFGATAQQAGGHIYGAETQGTFLRALGLIERTEQLATRATTEDAAILRSA 306

Query: 328 VKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
             RL    A  + MG LF+++ ++   +   P
Sbjct: 307 AHRL----AAPEKMGHLFRVMALASPGLPSPP 334


>gi|58699083|ref|ZP_00373918.1| Uncharacterized ACR, COG1565 superfamily [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630423|ref|YP_002727214.1| hypothetical protein WRi_006580 [Wolbachia sp. wRi]
 gi|58534395|gb|EAL58559.1| Uncharacterized ACR, COG1565 superfamily [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592404|gb|ACN95423.1| hypothetical protein WRi_006580 [Wolbachia sp. wRi]
          Length = 349

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 192/350 (54%), Gaps = 25/350 (7%)

Query: 14  KKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQ 73
           K  G +++  +    +   ++GYY++  P G  GDF TAPEISQ+FGE++A++++  WE+
Sbjct: 11  KSQGSISISDFMNAVLYHEKYGYYTSKLPLGKDGDFTTAPEISQLFGEVIAVWIMHTWEK 70

Query: 74  HGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY 133
            G PS   LVELGPG+G ++ DI+RV  K    FF+ + I++VE S  L  IQK++L S 
Sbjct: 71  LGKPSKFSLVELGPGKGTLIHDIIRVTKKY-SSFFNSMLIHLVEISPTLRKIQKEKLKSL 129

Query: 134 GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGD 193
              +NW+ ++ ++P   T  +ANEFFD+LPI QFV  + G  E M+      SL+ +   
Sbjct: 130 D--VNWHKNIDNLPEQPTIFLANEFFDALPIDQFVYHDEGWYENMVTKQDDGSLLVSCQC 187

Query: 194 HEIKS-----------NFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
             ++S             +T   +F GA+ E        ++ +  ++  + G A+++DYG
Sbjct: 188 VTLESRKKESWIPVSATQMTNGKFFNGAVVEICSVGVEILKKLEKKIYNNKGAALIVDYG 247

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           Y+      TLQ++K H Y + L N G +D+++ V+FQ L       K     + TQ +FL
Sbjct: 248 YVYPAYKSTLQSIKQHKYANFLENVGNSDITALVNFQALRDSL---KHVDCEILTQREFL 304

Query: 303 EGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVV 350
              GI +R  +LMK  +  +K+ +     RL       ++MG LFK +++
Sbjct: 305 YLFGIKERTQALMKSASDEQKNRIFSEFLRLT------ENMGTLFKAMLL 348


>gi|170044535|ref|XP_001849900.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167867640|gb|EDS31023.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 428

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 131/381 (34%), Positives = 191/381 (50%), Gaps = 53/381 (13%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFLICAW 71
           I   G + V  Y    + +P  GYY +  + FG+ GDFVT+PEI QIFGE++A + +  W
Sbjct: 53  ILATGPIPVAAYMKQVLTNPAAGYYMNEADVFGSKGDFVTSPEIGQIFGELVAAWCLNEW 112

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL- 130
            + G P+  +L+ELGPG+G MM D+LRV  +L       LS+++VE SE L+ +Q + L 
Sbjct: 113 TKFGRPAPYQLIELGPGKGTMMRDVLRVFRRLGAS--DGLSVHLVEMSEHLSEVQAELLC 170

Query: 131 ---------ASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI 174
                    A Y       G K+ WY  L DVP GF+ ++A+EFFD+LPI +F   ++  
Sbjct: 171 RSSEECVDKAYYRAGVTRAGTKVFWYRHLEDVPAGFSIVLAHEFFDALPIHKFQKQDNVW 230

Query: 175 RERMIDI--DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSP--CRDRE--------- 221
           +E ++D+  D  D L F +   E            L  +  N P   +DRE         
Sbjct: 231 KEVLVDVDSDNKDKLRFVLSKAETP---------MLKLVLNNYPELVKDREHIEISLDSE 281

Query: 222 --MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQ 279
             ++ I+ R    GG A+V+DYG+   + GDT +A K H    PL  PG ADL++ VDF 
Sbjct: 282 SIIRQIAQRFNATGGYALVVDYGHTGEK-GDTFRAFKNHKLHDPLEEPGSADLTADVDFS 340

Query: 280 RLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTS 335
            L+       +++  G   QG FLE  G   R   L+   K    K  L D  K L    
Sbjct: 341 LLNRFCENTGQIFTMGPIEQGSFLEMAGAKDRLQVLLANAKSEEEKHRLSDGYKMLT--- 397

Query: 336 ADKKSMGELFKILVVSHEKVE 356
            D+  MG  FK   +  +++E
Sbjct: 398 -DRDQMGSRFKFFALFPKELE 417


>gi|42520561|ref|NP_966476.1| hypothetical protein WD0717 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410300|gb|AAS14410.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 349

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 192/350 (54%), Gaps = 25/350 (7%)

Query: 14  KKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQ 73
           K  G +++  +    +   ++GYY++  P G  GDF TAPEISQ+FGE++A++++  WE+
Sbjct: 11  KSQGSISISDFMNAVLYHEKYGYYTSKLPLGKDGDFTTAPEISQLFGEVIAVWIMHTWEK 70

Query: 74  HGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY 133
            G PS   LVELGPG+G ++ DI+RV  K    FF+ + I++VE S  L  IQK++L S 
Sbjct: 71  LGKPSKFSLVELGPGKGTLIHDIIRVTKKYS-SFFNSMLIHLVEISPTLRKIQKEKLKSL 129

Query: 134 GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGD 193
              +NW+ ++ ++P   T  +ANEFFD+LPI QFV  + G  E M+      SL+ +   
Sbjct: 130 D--VNWHKNIDNLPEQPTIFLANEFFDALPIDQFVYHDEGWYENMVTKQDDGSLLVSCQC 187

Query: 194 HEIKS-----------NFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
             ++S             +T   +F GA+ E        ++ +  ++  + G A+++DYG
Sbjct: 188 VTLESRKKESWIPVSATQMTNGKFFNGAVVEICSVGVEILKKLEKKIYNNKGAALIVDYG 247

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           Y+      TLQ++K H Y + L N G +D+++ V+FQ L       K     + TQ +FL
Sbjct: 248 YVYPAYKSTLQSIKQHKYANFLENVGNSDITALVNFQALRDPL---KHVDCEILTQREFL 304

Query: 303 EGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVV 350
              GI +R  +LMK  +  +K+ +     RL       ++MG LFK +++
Sbjct: 305 YLFGIKERTQALMKSASDEQKNRIFSEFLRLT------ENMGTLFKAMLL 348


>gi|99034193|ref|ZP_01314271.1| hypothetical protein Wendoof_01000933 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 348

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 192/350 (54%), Gaps = 25/350 (7%)

Query: 14  KKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQ 73
           K  G +++  +    +   ++GYY++  P G  GDF TAPEISQ+FGE++A++++  WE+
Sbjct: 11  KSQGSISISDFMNAVLYHEKYGYYTSKLPLGKDGDFTTAPEISQLFGEVIAVWIMHTWEK 70

Query: 74  HGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY 133
            G PS   LVELGPG+G ++ DI+RV  K    FF+ + I++VE S  L  IQK++L S 
Sbjct: 71  LGKPSKFSLVELGPGKGTLIHDIIRVTKKYS-SFFNSMLIHLVEISPTLRKIQKEKLKSL 129

Query: 134 GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGD 193
              +NW+ ++ ++P   T  +ANEFFD+LPI QFV  + G  E M+      SL+ +   
Sbjct: 130 D--VNWHKNIDNLPEQPTIFLANEFFDALPIDQFVYHDEGWYENMVTKQDDGSLLVSCQC 187

Query: 194 HEIKS-----------NFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
             ++S             +T   +F GA+ E        ++ +  ++  + G A+++DYG
Sbjct: 188 VTLESRKKESWIPVSATQMTNGKFFNGAVVEICSVGVEILKKLEKKIYNNKGAALIVDYG 247

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           Y+      TLQ++K H Y + L N G +D+++ V+FQ L       K     + TQ +FL
Sbjct: 248 YVYPAYKSTLQSIKQHKYANFLENVGNSDITALVNFQALRDPL---KHVDCEILTQREFL 304

Query: 303 EGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVV 350
              GI +R  +LMK  +  +K+ +     RL       ++MG LFK +++
Sbjct: 305 YLFGIKERTQALMKSASDEQKNRIFSEFLRLT------ENMGTLFKAMLL 348


>gi|209543261|ref|YP_002275490.1| hypothetical protein Gdia_1092 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530938|gb|ACI50875.1| protein of unknown function DUF185 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 339

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 171/330 (51%), Gaps = 21/330 (6%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YY+  +PF    DF+TAPEISQ+FGE+L  ++   W+  G P    LVE GPGRG +M D
Sbjct: 20  YYAGRDPFA---DFITAPEISQMFGEILGAWVAVTWQGMGRPVPFALVEAGPGRGTLMAD 76

Query: 96  ILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY-GDKINWYTSLADVPLGFTFLV 154
           ++R++ ++ PD      +++VE S RL  +Q+  LA      + W+  + DVP G   L+
Sbjct: 77  MMRLLARVAPDCHDAARVHLVELSPRLRDVQQAALAGRTAHPVTWHDRIEDVPEGAVILL 136

Query: 155 ANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNF---LTCSDYFLGAI 211
           ANEF D+L I+QFV T  G  ER +   Q  + V           F   + C     G I
Sbjct: 137 ANEFLDALAIRQFVRTADGWAERFV---QGPAFVTQPASDLPPGPFDRPVPC-----GEI 188

Query: 212 FENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
            E  P      + ++ RL    GTA+ +DYGY  +  GDTLQA++      PL +PG AD
Sbjct: 189 LECCPDALAVARHVAARLCRAPGTALFVDYGYDGAVWGDTLQALRDGQPAWPLADPGLAD 248

Query: 272 LSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKD--ILLDSVK 329
           L++HVDF   ++         +G  TQG  L  LG++ RA  L +  A  +   + D+ +
Sbjct: 249 LTAHVDFAAFAAAVRDGGAVCHGSVTQGALLGALGLFARAEQLARNRAPGEAYAIRDAAQ 308

Query: 330 RLVSTSADKKSMGELFKILVVSHEKVELMP 359
           RL +       MG LFK L ++   + + P
Sbjct: 309 RLAA----PDRMGRLFKALAITSPGLPVPP 334


>gi|297667835|ref|XP_002812170.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 1
           [Pongo abelii]
          Length = 441

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 194/379 (51%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  ++WY  L DVP G++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPVSWYRDLQDVPKGYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 223 VHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S+R+A  GG A+V DYG+  +R  DT +   GH     L+ PG ADL++ VDF  L
Sbjct: 282 IEELSERIALTGGAALVADYGHDGTRT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 341 RRMA-QGKVASVGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 395

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 396 KKMGERFNFFALLPHQRLQ 414


>gi|195571791|ref|XP_002103886.1| GD20670 [Drosophila simulans]
 gi|194199813|gb|EDX13389.1| GD20670 [Drosophila simulans]
          Length = 437

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 191/378 (50%), Gaps = 36/378 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE
Sbjct: 49  DGSLAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGE 108

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ I+L+  W + G PS  +LVELGPGRG +  D+L+V+ K K D  +  S++MVE S  
Sbjct: 109 LVGIWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQD--AEFSMHMVEVSPF 166

Query: 122 L-------------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDS 161
           L             TL +  QL  Y       G K  W+  L DVP GF+ ++A+EFFD+
Sbjct: 167 LSKAQAQRFCYSHQTLPEDAQLPHYQEGTTASGTKAFWHHRLEDVPQGFSLVLAHEFFDA 226

Query: 162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC---- 217
           LP+ +  + +   +E +ID+   D        + +  +    S  +     E   C    
Sbjct: 227 LPVHKLQLVDGKWQEVLIDVASSDGAQEGSFRYVLSRSQTPVSSLYRPLPGETRSCLEHS 286

Query: 218 --RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSH 275
              +R++  +++R+  DGG A+V+DYG+   +  DT +A K H    PLV PG ADL++ 
Sbjct: 287 LETERQVGLLAERIERDGGIALVMDYGHFGEKT-DTFRAFKQHKLHDPLVEPGSADLTAD 345

Query: 276 VDFQRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLV 332
           VDF+ +  IA     ++  G   QG FL+ +    R   L+       ++I+    + L 
Sbjct: 346 VDFKLVRHIAETRGNVHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLT 405

Query: 333 STSADKKSMGELFKILVV 350
               D   MG  FK L +
Sbjct: 406 ----DPSQMGSRFKFLAM 419


>gi|51473296|ref|YP_067053.1| hypothetical protein RT0085 [Rickettsia typhi str. Wilmington]
 gi|51459608|gb|AAU03571.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 358

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 191/361 (52%), Gaps = 24/361 (6%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI ++G +T D      ++     YY       + GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIDQHGYITCDVLMQEVLSLHPNAYYKQVKSLASEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F++ LSI ++E ++     QK
Sbjct: 66  IREWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYNSLSITLIEINKNFIAHQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
             L      I     + ++P   T ++ NEFFD++PIKQ++  +    ER+  +      
Sbjct: 125 SNLQDINLPIKHLEFIEEIPQKPTIIITNEFFDTMPIKQYIKVKELWYERIFSVQPVDGS 184

Query: 183 -QHDSLVFNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            ++D +  N    E +    +   D   GA+ E S      ++ I++ L    G+ ++ID
Sbjct: 185 IKYDKISINKRLQEYLLRTHIAAKD---GAVLEESYKSIEIIKFIAEHLKKVSGSCLIID 241

Query: 241 YGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY        + +   TLQAV+ H Y   L N G+ADLS+HVDF  L ++A   K+ + 
Sbjct: 242 YGYDIAPYNRTRYQYNPTLQAVRKHKYCPILENLGEADLSAHVDFYSLKTVAKNSKINVI 301

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQTARKDILL--DSVKRLVSTSADKKSMGELFKILVVS 351
              +Q  FL   GI  R  +L ++   + +L+    V+RL+      K MG+LFK+L + 
Sbjct: 302 DTISQRNFLIQNGILLRKQALKEKLNDEQVLIIEKQVERLILP----KQMGKLFKVLQIM 357

Query: 352 H 352
           H
Sbjct: 358 H 358


>gi|16768500|gb|AAL28469.1| GM06493p [Drosophila melanogaster]
          Length = 406

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 122/375 (32%), Positives = 190/375 (50%), Gaps = 36/375 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 21  LAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVG 80

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL-- 122
           I+L+  W + G PS  +LVELGPGRG +  D+L+V+ K K D  +  S++MVE S  L  
Sbjct: 81  IWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQD--AEFSMHMVEVSPFLSK 138

Query: 123 -----------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
                      TL +  QL  Y       G K  W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 139 AQAQRFCYSHQTLPEDAQLPHYQEGTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDALPV 198

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC------R 218
            +  + +   +E +ID+   D        + +  +    S  +     E   C       
Sbjct: 199 HKLQLVDGKWQEVLIDVASSDGAQEASFRYVLSRSQTPVSSLYRPLPGETRSCLEHSLET 258

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
           +R++  +++R+  DGG A+++DYG+   +  DT +A K H    PLV PG ADL++ VDF
Sbjct: 259 ERQVGLLAERIERDGGIALIMDYGHFGEKT-DTFRAFKQHKLHDPLVEPGSADLTADVDF 317

Query: 279 QRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTS 335
           + +  IA     ++  G   QG FL+ +    R   L+       K+I+    + L    
Sbjct: 318 KLVRHIAETRGNVHCCGPVEQGLFLQRMQGEARLEQLLAHALPENKEIIRSGYEMLT--- 374

Query: 336 ADKKSMGELFKILVV 350
            D   MG  FK L +
Sbjct: 375 -DPAQMGTRFKFLAM 388


>gi|256071528|ref|XP_002572092.1| hypothetical protein [Schistosoma mansoni]
 gi|238657243|emb|CAZ28322.1| conserved hypothetical protein [Schistosoma mansoni]
          Length = 360

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 177/329 (53%), Gaps = 27/329 (8%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +   L ++++  I   G +TV +Y   C+++P +GYY+T + FG  GDF T+PEI QIFG
Sbjct: 33  LSETLKKQLLERINTFGPLTVSEYMKECLSNPLYGYYNTHSVFGKSGDFTTSPEICQIFG 92

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ ++L+  W++   P  ++LVELGPGRG +  DILRV  K  P+ +S LSI++VE S+
Sbjct: 93  ELIGVWLLEEWKRQNNPKHLQLVELGPGRGTLCSDILRVFSKF-PEIYSTLSIHLVEISQ 151

Query: 121 RLTLIQK----KQLASYGDK---INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHG 173
            +   QK    K L+   +K   I W+T L  VP  F+F + +EFFD LP+ +F   E  
Sbjct: 152 SMRQTQKQTIEKTLSHLNNKPPLIFWHTDLRQVPENFSFFIGHEFFDVLPVHRFQKHEGK 211

Query: 174 IRERMI-DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDR---------EMQ 223
             E ++  +   +SL F      ++S   T +      +  N   RD            Q
Sbjct: 212 WHEVLVSSMMNSNSLCF------VRSGTKTPASIVYLPLVPNLSNRDSVEVCPDMICVAQ 265

Query: 224 SISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
            +  R+   GG+A++IDYG+ +   GDT +    H+   PL+NPG  DL+  VDF  L  
Sbjct: 266 LLCKRINKTGGSALLIDYGH-EGEKGDTFRGFHKHSVCDPLINPGHTDLTCDVDFSILCH 324

Query: 284 IAIL--YKLYINGLTTQGKFLEGLGIWQR 310
                  K+ ++G  TQ  FL  +G++ R
Sbjct: 325 AVKNSDAKVRLHGPVTQAYFLINMGLFTR 353


>gi|254994910|ref|ZP_05277100.1| hypothetical protein AmarM_02202 [Anaplasma marginale str.
           Mississippi]
 gi|255003046|ref|ZP_05278010.1| hypothetical protein AmarPR_01940 [Anaplasma marginale str. Puerto
           Rico]
          Length = 343

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 120/354 (33%), Positives = 192/354 (54%), Gaps = 31/354 (8%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAW 71
           + + +  +T+D++ +L +   E GYY T  PFG  GDFVT+ EISQ+FGE++A++++   
Sbjct: 9   IFENSAHVTMDRFMSLALYHEEHGYYMTRVPFGRAGDFVTSAEISQLFGEVIALWILSCL 68

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA 131
           E  G      L+ELGPGRG +M DILRV  +  P + ++L ++++E S  L   Q+  L 
Sbjct: 69  ESAGISEKFSLLELGPGRGTLMHDILRVFEQF-PRYDALLEVHLLEISPLLRNTQRATLE 127

Query: 132 SYGDK--INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVF 189
           S+  +  I+W+  L ++P   T +VANEFFD+LP++QF+ T    +E  +  D  +  + 
Sbjct: 128 SFSARKEISWHCKLEELPERPTIVVANEFFDALPVRQFIRTGGAWKECCVCNDGGNLGIV 187

Query: 190 NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC-------DGGTAIVIDYG 242
            +   + + N     D   G I E         ++ SD LAC       +GG A + DYG
Sbjct: 188 AV---DTQYNLDEYGDVPEGGIIERC-------EAASDVLACLEKIIVRNGGAAAIFDYG 237

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           YLQ     T+Q+VK H Y   L N G+ D+++HVDF  L   A   +   + + TQ +FL
Sbjct: 238 YLQPPYRSTIQSVKSHHYCDFLDNIGECDITAHVDFGLLQKHA---QRLNSKVVTQREFL 294

Query: 303 EGLGIWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
              GI +R   L +    +    L  +  RL       ++MG +FK+L+++HE+
Sbjct: 295 YQFGIRERLACLERNATERQRRELKGAFLRLT------ENMGTMFKVLLLNHER 342


>gi|332227210|ref|XP_003262784.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 1
           [Nomascus leucogenys]
          Length = 441

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 194/379 (51%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  ++WY  L DVP G++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPVSWYRDLHDVPKGYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 223 VHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DTL+   GH     L+ PG ADL++ VDF  L
Sbjct: 282 IEELSQRIALTGGAALVADYGHEGTKT-DTLRGFCGHKLHDVLIAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 341 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 395

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 396 KKMGERFNFFALLPHQRLQ 414


>gi|56416701|ref|YP_153775.1| hypothetical protein AM487 [Anaplasma marginale str. St. Maries]
 gi|222475067|ref|YP_002563482.1| hypothetical protein AMF_360 [Anaplasma marginale str. Florida]
 gi|56387933|gb|AAV86520.1| hypothetical protein AM487 [Anaplasma marginale str. St. Maries]
 gi|222419203|gb|ACM49226.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 343

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 120/354 (33%), Positives = 192/354 (54%), Gaps = 31/354 (8%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAW 71
           + + +  +T+D++ +L +   E GYY T  PFG  GDFVT+ EISQ+FGE++A++++   
Sbjct: 9   IFENSAHVTMDRFMSLALYHEEHGYYMTRVPFGRAGDFVTSAEISQLFGEVVALWILSYL 68

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA 131
           E  G      L+ELGPGRG +M DILRV  +  P + ++L ++++E S  L   Q+  L 
Sbjct: 69  ESAGISEKFSLLELGPGRGTLMHDILRVFEQF-PRYDALLEVHLLEISPLLRNTQRATLE 127

Query: 132 SYGDK--INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVF 189
           S+  +  I+W+  L ++P   T +VANEFFD+LP++QF+ T    +E  +  D  +  + 
Sbjct: 128 SFSARKEISWHCKLEELPERPTIVVANEFFDALPVRQFIRTSGAWKECCVCNDGGNLGIV 187

Query: 190 NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC-------DGGTAIVIDYG 242
            +   + + N     D   G I E         ++ SD LAC       +GG A + DYG
Sbjct: 188 AV---DTQYNLDEYGDVPEGGIIERC-------EAASDVLACLEKIIVRNGGAAAIFDYG 237

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           YLQ     T+Q+VK H Y   L N G+ D+++HVDF  L   A   +   + + TQ +FL
Sbjct: 238 YLQPPYRSTIQSVKSHHYCDFLDNIGECDITAHVDFGLLQKHA---QRLNSKVVTQREFL 294

Query: 303 EGLGIWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
              GI +R   L +    +    L  +  RL       ++MG +FK+L+++HE+
Sbjct: 295 YQFGIRERLACLERNATERQRRELKGAFLRLT------ENMGTMFKVLLLNHER 342


>gi|156371594|ref|XP_001628848.1| predicted protein [Nematostella vectensis]
 gi|156215834|gb|EDO36785.1| predicted protein [Nematostella vectensis]
          Length = 425

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 192/376 (51%), Gaps = 35/376 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
            + L++ I+  I  +G ++V  Y    + +P  GYY   + FG  GDF+T+PEI+Q+FGE
Sbjct: 47  HSALMKHIIQRITISGAISVAAYMQEVLTNPLAGYYMKKDVFGQAGDFITSPEITQVFGE 106

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ ++ +  W Q G    +++VELGPGRG +M DILRV+ K K      LS+++VE S  
Sbjct: 107 LIGVWFVHQWMQTG-ERDIQIVELGPGRGTLMADILRVVKKFKA-LQECLSVHLVEVSPA 164

Query: 122 LTLIQKKQLASYGDKIN-----------------------WYTSLADVPLGFTFLVANEF 158
           L+ IQK  L    +  N                       WY+S+ D+P  ++F +A+EF
Sbjct: 165 LSDIQKTTLTGISEMTNKEPSKENKPYYKQCCSKDGIPVFWYSSIKDIPKAYSFFLAHEF 224

Query: 159 FDSLPIKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSP 216
           FD+LPI QF  T+ G RE ++D+D+    SL F +      ++             E  P
Sbjct: 225 FDALPIHQFQRTDRGWREVLVDVDKERTHSLRFVLAPGPTLASQTYVPKGTSSRQLEVCP 284

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                M+ I +R+  DGG+A++IDYG        TL++   H     L  PG AD++++V
Sbjct: 285 QGGVIMEEIGERIRHDGGSALIIDYGE-DGNNRHTLRSFSKHKLHDVLEAPGTADITANV 343

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVST-S 335
           DF+ L   A    +   G  TQ  FL+ +GI QR   L+ + +      D  K+L S   
Sbjct: 344 DFRFLRQ-AAGSDVNTYGPVTQVSFLKNMGIDQRMRILLSKASP-----DQAKQLYSGYK 397

Query: 336 ADKKSMGELFKILVVS 351
              + MGE FK+  V+
Sbjct: 398 MLTEEMGEKFKVFAVT 413


>gi|45825109|gb|AAS77462.1| AT11512p [Drosophila melanogaster]
          Length = 437

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 191/375 (50%), Gaps = 36/375 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 52  LAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVG 111

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL-- 122
           I+L+  W + G PS  +LVELGPGRG +  D+L+V+ K K D  +  S++MVE S  L  
Sbjct: 112 IWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQD--AEFSMHMVEVSPFLSK 169

Query: 123 -----------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
                      TL +  QL  Y       G K  W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 170 AQAQRFCYSHQTLPEDAQLPHYQEGTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDALPV 229

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC------R 218
            +  + +   +E +ID+   D        + +  +    S  +     E   C       
Sbjct: 230 HKLQLVDGKWQEVLIDVASSDGAQEASFRYVLSRSQTPVSSLYRPPPGETRSCLEHSLET 289

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
           +R++  +++R+  DGG A+++DYG+   +  DT +A K H    PLV PG+ADL++ VDF
Sbjct: 290 ERQVGLLAERIERDGGIALIMDYGHFGEKP-DTFRAFKQHELHDPLVEPGRADLTADVDF 348

Query: 279 QRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTS 335
           + +  IA     ++  G   QG FL+ +    R   L+       ++I+    + L    
Sbjct: 349 KLVRHIAETRGNVHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLT--- 405

Query: 336 ADKKSMGELFKILVV 350
            D   MG  FK L +
Sbjct: 406 -DPAQMGTRFKFLAM 419


>gi|224047646|ref|XP_002192694.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 446

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 193/376 (51%), Gaps = 35/376 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  ++R +   ++ +G +TV +Y    + +P  GYYS     G  GDF+T+PEISQ+FGE
Sbjct: 46  DGTMLRHLTRKLRASGPVTVAEYMREALTNPGQGYYSRRGGVGESGDFITSPEISQVFGE 105

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSE 120
           ++ I+ I  W   G P+  +LVELGPGRG +  DILRV  +L     +  +S+++VE S 
Sbjct: 106 LIGIWYISEWMAMGKPTTFQLVELGPGRGTLTEDILRVFKQLASVLSTCDVSVHLVEVSP 165

Query: 121 RLTLIQK-------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDS 161
           +L+ IQ                    K ++  G  I WY  + DVP G++F +A+EFFD+
Sbjct: 166 KLSEIQAVMLTGGKVQPSPEDETAYMKGISKTGIPIFWYRDIQDVPPGYSFYLAHEFFDA 225

Query: 162 LPIKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKS--NFLTCSDYFLGAIFENSPC 217
           LPI +F  TE G RE ++DID    D L F +      +  NF+   +       E  P 
Sbjct: 226 LPIHKFQRTEKGWREVLVDIDPEVPDQLRFVLSPSRTPATQNFIQPEE--TRDHVEVCPE 283

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
               +Q ++ R+  DGG A+V DYG+  ++  DT +  + H     L  PG ADL++ VD
Sbjct: 284 AGVIVQRLASRIEKDGGAALVADYGHDGTKT-DTFRGFRNHKLHDVLSAPGTADLTADVD 342

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVST 334
           F  L  +A   K    G   Q +FL+ +GI  R   L++    TA  + LL S   L+  
Sbjct: 343 FSYLRKMA-QGKTATLGPIKQREFLKNMGIELRLQVLLQNSSDTATHEQLLHSYDMLM-- 399

Query: 335 SADKKSMGELFKILVV 350
             + + MG+ F    +
Sbjct: 400 --NPEKMGDCFNFFAL 413


>gi|68171253|ref|ZP_00544656.1| Protein of unknown function DUF185 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|67999335|gb|EAM85981.1| Protein of unknown function DUF185 [Ehrlichia chaffeensis str.
           Sapulpa]
          Length = 335

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 192/338 (56%), Gaps = 20/338 (5%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G ++V+Q+  + + D  +GYY T  PFG  GDF+TAPEISQ+FGE++A++++  W++ G 
Sbjct: 14  GAISVEQFMRIALYDVHYGYYMTQMPFGTYGDFITAPEISQLFGEVIALWILLNWQKMGS 73

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           PS   +VELGPGRG ++ D++RV+ K +   ++ + +Y+VE S  L  +Q+  L    +K
Sbjct: 74  PSKFIIVELGPGRGTLISDVVRVLRKFE-QCYAAMVVYLVEISPILEKLQRDVLKD--EK 130

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI 196
           + W   + D+P     ++ANEFFD+LP+KQFV T     E  + ++  +   F I   ++
Sbjct: 131 VFWCKDIKDLPDYPVLIIANEFFDALPVKQFVYTNDSWCETYVTVENDE---FKIAYKKV 187

Query: 197 KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVK 256
              F   +D     + E        ++ + +++   GG A+VIDYGY+      T+Q+VK
Sbjct: 188 NKIFEMSND-MKNPVIEICDEAVSIVKCMENKILQSGGAAVVIDYGYIDCPYKSTIQSVK 246

Query: 257 GHTYVSPLVNPGQADLSSHVDFQRL-SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM 315
            H Y + L N G++D++++V+F  L +S++ L  +    + TQ  FL   GI +R   L+
Sbjct: 247 NHQYNNLLKNVGESDITAYVNFAVLHNSLSTLSSV----IMTQRDFLYNFGIKERLQVLI 302

Query: 316 KQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
                 +K  L+    RL       ++MG +FK+ +V+
Sbjct: 303 ANATELQKQNLIAGFLRLT------ENMGSMFKVFLVN 334


>gi|241568973|ref|XP_002402617.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215500058|gb|EEC09552.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 409

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 192/388 (49%), Gaps = 58/388 (14%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           E +L++++ + I   G +TV +Y    + +P  GYY   + FG+ GDF T+PEISQ+FGE
Sbjct: 20  ETRLLQQLRSRILATGPITVAEYMKEVLTNPMSGYYMHRDVFGSSGDFTTSPEISQMFGE 79

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++A++ +  W + G P  + +VELGPGRG +  D+LRV  K   D   V+S+++VE S  
Sbjct: 80  LVAVWFLNEWVKAGKPKPLYIVELGPGRGTLSDDMLRVFSKYS-DAMEVVSLHLVEISPH 138

Query: 122 LTLIQ----------------------KKQLASYGDKINWYTSLADVPLGFTFLVANEFF 159
           L+ +Q                      K+ +  +G  + WY  L DVP GF+  VA+EF 
Sbjct: 139 LSQVQELKLCGTVSVVKDVLDHSPVTYKQSITKHGVPVGWYRHLHDVPRGFSCFVAHEFL 198

Query: 160 DSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIK---SNFLTCSDYFLGAIFENSP 216
           D+LP+ +F  T  G RE  ID+D         G H ++   S   T + +F         
Sbjct: 199 DALPVHKFQRTPEGWREVFIDLDD------GPGPHHLRYVLSRGPTPASFFADV------ 246

Query: 217 CRDRE-----------MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLV 265
           C+ R+            Q ++ R+   GG  +V+DYG+  ++  DT +A K HT    L 
Sbjct: 247 CKPRDHVEVCPEAGVIAQELASRMHEHGGCGLVVDYGHDGTKT-DTFRAFKNHTLHPVLS 305

Query: 266 NPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-- 323
            PG ADL++ VDF  L  I +  K    G  TQ +FL+ +GI  R   L+      ++  
Sbjct: 306 EPGTADLTADVDFSYLKRI-LAGKALTFGPVTQEQFLKNMGINIRLQKLLDNCQDANLRQ 364

Query: 324 -LLDSVKRLVSTSADKKSMGELFKILVV 350
            LL     L     + + MGE FK   V
Sbjct: 365 ELLSGYDMLT----NPEKMGERFKFFGV 388


>gi|9294283|dbj|BAB02185.1| unnamed protein product [Arabidopsis thaliana]
          Length = 378

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 178/318 (55%), Gaps = 32/318 (10%)

Query: 29  VADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPG 88
           + +P+ G+Y   + FGA GDF+T+PE+SQ+FGEM+ ++ +C WEQ G P  V LVELGPG
Sbjct: 5   LTNPKAGFYMNRDVFGAQGDFITSPEVSQMFGEMIGVWTVCLWEQMGRPERVNLVELGPG 64

Query: 89  RGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQ-------------KKQLASY-G 134
           RG +M D+LR   K K +F   L I++VE S  L  +Q             KK ++S  G
Sbjct: 65  RGTLMADLLRGTSKFK-NFTESLHIHLVECSPALQKLQHQNLKCTDESSSEKKAVSSLAG 123

Query: 135 DKINWYTSLADVPLGF-TFLVANEFFDSLPIKQFVM-----TEHGIRERMIDIDQHDSLV 188
             ++W+ +L +VP G  T ++A+EF+D+LP+ QF       +  G  E+M+D+ +     
Sbjct: 124 TPVHWHATLQEVPSGVPTLIIAHEFYDALPVHQFQTQYLQKSTRGWCEKMVDVGEDSKFR 183

Query: 189 FNIGDHEI--------KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
           F +             +  + T  +       E SP      Q ++ R+  DGG A++ID
Sbjct: 184 FVLSPQPTPAALYLMKRCTWATPEEREKMEHVEISPKSMDLTQEMAKRIGSDGGGALIID 243

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL--SSIAILYKLYINGLTTQ 298
           YG + + + D+LQA++ H +V+ L +PG ADLS++VDF  +  S+      + ++G  TQ
Sbjct: 244 YG-MNAIISDSLQAIRKHKFVNILDDPGSADLSAYVDFPSIKHSAEEASENVSVHGPMTQ 302

Query: 299 GKFLEGLGIWQRAFSLMK 316
            +FL  LGI  R  +L++
Sbjct: 303 SQFLGSLGINFRVDALLQ 320


>gi|330846878|ref|XP_003295218.1| hypothetical protein DICPUDRAFT_160448 [Dictyostelium purpureum]
 gi|325074101|gb|EGC28255.1| hypothetical protein DICPUDRAFT_160448 [Dictyostelium purpureum]
          Length = 483

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 132/378 (34%), Positives = 193/378 (51%), Gaps = 39/378 (10%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
           ++ K  G M+VD +    + +P+FGYY   + FG  GDFVTAPEIS +FGE+L I+ +  
Sbjct: 92  DVTKVKGPMSVDTFIREVLTNPKFGYYMNRDVFGKGGDFVTAPEISNLFGEILGIWCVAT 151

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL 130
           WEQ G P  + +VE+GPGRG +M DILR   K+  DF+S +S+YM+E S  L  IQK++L
Sbjct: 152 WEQMGRPKKLNIVEMGPGRGTLMKDILRS-TKVFKDFYSAISVYMLEASPALKKIQKEKL 210

Query: 131 ASYGD-----------------KINWYTSLADVP-LGFTFLVANEFFDSLPIKQFVMTE- 171
             + D                 KI W + L DVP    T  +A EF+D+LPI  F  ++ 
Sbjct: 211 LYFKDPAINFDDKTVGKTPEGVKITWVSRLDDVPDTTPTLFLAQEFYDALPIHVFRFSKD 270

Query: 172 -HGIRERMIDIDQHDSLVFNIG--DHEIKSNFLTCSDYFL------GAIFENSPCRDREM 222
            +   E ++D D   S  +++        +   T    +L      G   E         
Sbjct: 271 LNTWCEVLVDEDITASNDYHLRFVQSRGSTAMATAVKNYLPEFGIDGYQVELGVAGLAIS 330

Query: 223 QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
           Q IS R+   GG A++IDYGY    V ++LQA++ H +V  L  PG ADLS  VDFQ L 
Sbjct: 331 QLISKRIEKSGGAALIIDYGY-DKIVKNSLQAIRNHEFVELLDKPGSADLSVWVDFQTLR 389

Query: 283 SIAILYKLYIN--GLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSV---KRLVSTSAD 337
               + K      G   QG FL+  GI  R  +L+ +   K+ + + +   KRLV    D
Sbjct: 390 RCVKMMKNKTTAIGPVDQGIFLKECGIEPRLMNLLDKLDSKEKMEELILGYKRLV----D 445

Query: 338 KKSMGELFKILVVSHEKV 355
              MG  +K++ +  + +
Sbjct: 446 PAEMGTTYKVITICDKSI 463


>gi|73666939|ref|YP_302955.1| hypothetical protein Ecaj_0313 [Ehrlichia canis str. Jake]
 gi|72394080|gb|AAZ68357.1| protein of unknown function DUF185 [Ehrlichia canis str. Jake]
          Length = 335

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 196/338 (57%), Gaps = 20/338 (5%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G ++++Q+  + + D   GYY T  PFGA GDF+TAPEISQ+FGE++A++++ +W++ G 
Sbjct: 14  GAISIEQFMQVALYDVHHGYYMTQMPFGAHGDFITAPEISQLFGEIIALWVLLSWQKIGA 73

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           PS   +VELGPGRG ++ D++R++ + +   ++ +S+Y+VE S  L  +Q+  L +  +K
Sbjct: 74  PSKFVVVELGPGRGTLINDVIRILKRFE-QCYAAMSVYLVEISPVLENVQRDILKN--EK 130

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI 196
           + W  +++DVP     ++ANEFFD+LPI+QF   ++   E  + ++  +   F I    +
Sbjct: 131 VFWCRNVSDVPDCPILIIANEFFDALPIRQFTYFDNTWYETYVTLENDE---FKIIYKSV 187

Query: 197 KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVK 256
              F   SD     + E        ++ I +++  + G A++IDYGY+      T+Q+VK
Sbjct: 188 DERFEVSSD-IEKPVVETCNEAISIVKYIENKILQNSGAAVIIDYGYVNCPYKSTIQSVK 246

Query: 257 GHTYVSPLVNPGQADLSSHVDFQRL-SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM 315
            H Y   L N G++D++SHV+F  L  S++ L  + +N    Q  FL   GI +R   L+
Sbjct: 247 CHKYNDLLKNIGKSDITSHVNFAVLRDSLSTLDSVIMN----QRDFLYSFGIKERLRILI 302

Query: 316 KQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           +     ++  L+    RL       ++MG +FK+L+++
Sbjct: 303 ENATEVQRQNLITGFLRLT------ENMGSMFKVLLIN 334


>gi|195329908|ref|XP_002031652.1| GM23928 [Drosophila sechellia]
 gi|194120595|gb|EDW42638.1| GM23928 [Drosophila sechellia]
          Length = 437

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 121/378 (32%), Positives = 190/378 (50%), Gaps = 36/378 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE
Sbjct: 49  DGSLAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGE 108

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ I+L+  W + G PS  +LVELGPGRG +  D+L+V+ K K D  +  S++MVE S  
Sbjct: 109 LVGIWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQD--AEFSMHMVEVSPF 166

Query: 122 L-------------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDS 161
           L             TL +  QL  Y       G K  W+  L DVP GF+ ++A+EFFD+
Sbjct: 167 LSKAQAQRFCYSHQTLPEDAQLPHYQEGTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDA 226

Query: 162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC---- 217
           LP+ +  + +   +E +ID+   D        + +  +    S  +     E   C    
Sbjct: 227 LPVHKLQLVDGKWQEVLIDVASSDGAQEGSFRYVLSRSQTPVSSLYRPLPGETRSCLEHS 286

Query: 218 --RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSH 275
              +R++  +++R+  DGG  +V+DYG+   +  DT +A K H    PLV PG ADL++ 
Sbjct: 287 LETERQVGLLAERIERDGGITLVMDYGHFGEKT-DTFRAFKQHKLHDPLVEPGSADLTAD 345

Query: 276 VDFQRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLV 332
           VDF+ +  IA     ++  G   QG FL+ +    R   L+       ++I+    + L 
Sbjct: 346 VDFKLVRHIAETRGNVHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLT 405

Query: 333 STSADKKSMGELFKILVV 350
               D   MG  FK L +
Sbjct: 406 ----DPAQMGSRFKFLAM 419


>gi|24645885|ref|NP_650054.2| CG17726 [Drosophila melanogaster]
 gi|74868997|sp|Q9VGR2|MIDA_DROME RecName: Full=Protein midA homolog, mitochondrial
 gi|7299424|gb|AAF54614.1| CG17726 [Drosophila melanogaster]
 gi|202027956|gb|ACH95262.1| FI02863p [Drosophila melanogaster]
          Length = 437

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 190/375 (50%), Gaps = 36/375 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 52  LAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVG 111

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL-- 122
           I+L+  W + G PS  +LVELGPGRG +  D+L+V+ K K D  +  S++MVE S  L  
Sbjct: 112 IWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQD--AEFSMHMVEVSPFLSK 169

Query: 123 -----------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
                      TL +  QL  Y       G K  W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 170 AQAQRFCYSHQTLPEDAQLPHYQEGTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDALPV 229

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC------R 218
            +  + +   +E +ID+   D        + +  +    S  +     E   C       
Sbjct: 230 HKLQLVDGKWQEVLIDVASSDGAQEASFRYVLSRSQTPVSSLYRPLPGETRSCLEHSLET 289

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
           +R++  +++R+  DGG A+++DYG+   +  DT +A K H    PLV PG ADL++ VDF
Sbjct: 290 ERQVGLLAERIERDGGIALIMDYGHFGEKT-DTFRAFKQHKLHDPLVEPGSADLTADVDF 348

Query: 279 QRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTS 335
           + +  IA     ++  G   QG FL+ +    R   L+       ++I+    + L    
Sbjct: 349 KLVRHIAETRGNVHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLT--- 405

Query: 336 ADKKSMGELFKILVV 350
            D   MG  FK L +
Sbjct: 406 -DPAQMGTRFKFLAM 419


>gi|115529407|ref|NP_001070231.1| protein midA homolog, mitochondrial precursor [Danio rerio]
 gi|123908270|sp|Q08BY0|MIDA_DANRE RecName: Full=Protein midA homolog, mitochondrial; Flags: Precursor
 gi|115313407|gb|AAI24509.1| Zgc:153989 [Danio rerio]
 gi|220672997|emb|CAX14543.1| novel protein (zgc:153989) [Danio rerio]
          Length = 422

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 129/380 (33%), Positives = 199/380 (52%), Gaps = 42/380 (11%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +   +++ + + I   G ++V +Y    + +P  GYY   +  GA GDF+T+PEISQIFG
Sbjct: 26  INKSILKHLASKIIATGPISVAEYMREALTNPVLGYYVKNDMLGAGGDFITSPEISQIFG 85

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETS 119
           E+L ++ I  W   G  S ++LVELGPGRG +  DILRV  +LK       +SI++VE S
Sbjct: 86  ELLGVWCISEWMAAGKSSALQLVELGPGRGSLTSDILRVFSQLKGVLGETGISIHLVEVS 145

Query: 120 ERLTLIQKK-----QLASY--------------GDKINWYTSLADVPLGFTFLVANEFFD 160
            +L+ +Q +     Q  +Y              G  I WY S+ DVP GF+  +A+EFFD
Sbjct: 146 PKLSQVQAECLTGNQTQTYDNNHTFYRSGTTCTGLPIYWYHSIEDVPRGFSIFLAHEFFD 205

Query: 161 SLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDR 220
           +LPI +F  TE+G RE ++DID  +          + S+  T +   L  I ++   R  
Sbjct: 206 ALPIHKFQRTENGWREVLVDIDPENPGKLRF----VVSHRPTLASSTL--IQKDESRRHV 259

Query: 221 E--------MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADL 272
           E        +Q ++ R+A DGG A+++DYG+  ++  DT +  KGH     L  PG ADL
Sbjct: 260 EVCAEAGVIVQKLASRIAEDGGAALIVDYGHDGTKT-DTFRGFKGHQIHDVLEAPGLADL 318

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKR 330
           ++ VDF  L  +A    + + G  TQ  FL+ +GI  R   L+     + +  L+ S   
Sbjct: 319 TADVDFSYLRKMAGDQVICL-GPITQRSFLKNMGIDSRMQVLLSSNDPSIRAQLIHSYDM 377

Query: 331 LVSTSADKKSMGELFKILVV 350
           L+    + + MGE F+   V
Sbjct: 378 LI----NPEKMGERFQFFSV 393


>gi|255074399|ref|XP_002500874.1| predicted protein [Micromonas sp. RCC299]
 gi|226516137|gb|ACO62132.1| predicted protein [Micromonas sp. RCC299]
          Length = 378

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 179/355 (50%), Gaps = 52/355 (14%)

Query: 28  CVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGP 87
           C+  PEFGYY   + FG  GDFVT+PE+SQ FGE++  +    WE  G PS VR+VELGP
Sbjct: 4   CLTHPEFGYYMHRDVFGEAGDFVTSPEVSQAFGELMGAWAAWTWESMGKPSTVRIVELGP 63

Query: 88  GRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL--------ASYGDK--- 136
           GRG +M D+LR    LK  F   ++++MV+ S      Q++ L        A  GD    
Sbjct: 64  GRGTLMADLLRGTKNLK-GFADAVTVHMVDVSPANRKAQREALKCGPKTDDAENGDDNTG 122

Query: 137 --------INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
                     W+ ++  VP G T ++A+EFFD++P+ QF  TE G  ER++ I       
Sbjct: 123 KNPTRHGLGKWHETMDAVPPGPTIVIAHEFFDAMPVHQFTRTERGWCERLVAIS------ 176

Query: 189 FNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE--------------MQSISDRLACDGG 234
              GD  +           +    E      R+               + I+ RL   GG
Sbjct: 177 ---GDMVLSPGLTPAGALMVPRRLEGVEASRRDGLRQLEISPRSLAIWERIAARLEEHGG 233

Query: 235 TAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK---LY 291
            AI IDYG  +  +GDTLQA++ H +V  L +PG+ADLS++VDF  +  +    K   + 
Sbjct: 234 AAIAIDYGE-EGPLGDTLQAIRDHEFVDVLTDPGRADLSAYVDFGAMRRVIETRKNSGVE 292

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQTARK---DILLDSVKRLVSTSADKKSMGE 343
            +G  TQ   L GLGI Q    ++++ A +   D L+   +RLV  S ++ ++GE
Sbjct: 293 CHGPVTQRDLLFGLGIGQWLEKMVEKCATEKEVDKLIAGCERLV--SGEQGALGE 345


>gi|157825199|ref|YP_001492919.1| hypothetical protein A1C_00390 [Rickettsia akari str. Hartford]
 gi|157799157|gb|ABV74411.1| hypothetical protein A1C_00390 [Rickettsia akari str. Hartford]
          Length = 374

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 188/377 (49%), Gaps = 40/377 (10%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LIK+NG +T D      +      YY         GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIKQNGYITCDVLMQEVLNLNPTSYYKKVKSLAGEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IKEWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINQNFIAHQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
             L      I+  + + D+P   T ++ANEFFD++ IKQ++  +    ER+  +      
Sbjct: 125 ANLQDINLPISHRSFVEDIPKKPTIIIANEFFDAMTIKQYIKVKELWYERIFVVQPVDGR 184

Query: 183 -QHDSLVFNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            ++D +  N    E +    +   D   GA+ E S      ++ I+  L    G+ ++ID
Sbjct: 185 IKYDKISINKPLQEYLLRTHIEAKD---GAVLEESYKSIEIIKFIAQHLKTLSGSCLIID 241

Query: 241 YGY---LQSRVG----DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY      R G     TLQAVK H Y   L N G+ADLS+HVDF  L ++A   K+ + 
Sbjct: 242 YGYDIAPNDRTGYQYNPTLQAVKNHQYCPILENLGEADLSAHVDFYTLKTVAKNNKINVI 301

Query: 294 GLTTQGKFLEGLGIWQRAFSLM------------------KQTARKDILLDSVKRLVSTS 335
               Q  FL   GI  R  +L                   K + +  I+   V+RL+S  
Sbjct: 302 DTIAQRDFLIENGILLRKQTLQNKLNNRHLSKLPLEVEFEKVSKQAGIIEKQVERLISP- 360

Query: 336 ADKKSMGELFKILVVSH 352
              K MG LFK+L + H
Sbjct: 361 ---KQMGTLFKVLQIMH 374


>gi|72013976|ref|XP_781178.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115958909|ref|XP_001182552.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 384

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 190/370 (51%), Gaps = 39/370 (10%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I+  G +TV  Y    +  P  GYY   + FG  GDF+T+PEISQ+FGE++A+++I  W 
Sbjct: 8   IRTLGAITVADYMKEVLTSPVGGYYMQGDVFGERGDFITSPEISQMFGELIALWIIHEWS 67

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
           + G P  ++LVELGPGRG +  D+LRV  +        LS+++VE S  ++ +Q K L  
Sbjct: 68  RLGCPRPLQLVELGPGRGTLADDVLRVFKQFPQLPLDTLSLHLVEVSPGMSDVQHKTLTG 127

Query: 133 Y-------------------------GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQF 167
           +                         G  ++WYTSL+ VP GFT  +A+EFFD+LPI +F
Sbjct: 128 HQQRLKEEVSGGIVDGIPYRSASVKGGIPVSWYTSLSQVPNGFTCFLAHEFFDALPIHKF 187

Query: 168 VMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAI-----FENSPCRDREM 222
             +    RE M+D+D  DS   N     +       S+ F+ A       E  P      
Sbjct: 188 QKSSSRWREIMVDVDD-DSNSPNDLRFVLSPAPTPASNSFIQASETRDHVEVCPTAAVIA 246

Query: 223 QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
           Q ++ R+  DGG A++IDYG+  ++  DT +  K H     L+ PG ADL++ VDF  L 
Sbjct: 247 QEMASRIYSDGGMALIIDYGHDGTKT-DTFRGFKDHKLHDVLIEPGTADLTADVDFAYLR 305

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI--LLDSVKRLVSTSADKKS 340
            + +  ++   G   QG FL+ +GI  R  +L+K T  ++   L+   K L  T  D+  
Sbjct: 306 RM-VGDRVATYGPIHQGLFLQMMGIDTRLKALLKATPSEEHTNLISGYKML--TEPDQ-- 360

Query: 341 MGELFKILVV 350
           MGE FK   +
Sbjct: 361 MGERFKFFSI 370


>gi|88657760|ref|YP_507560.1| hypothetical protein ECH_0762 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599217|gb|ABD44686.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 335

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 192/338 (56%), Gaps = 20/338 (5%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G ++V+Q+  + + D  +GYY T  PFG  GDF+TAP+ISQ+FGE++A++++  W++ G 
Sbjct: 14  GAISVEQFMRIALYDVHYGYYMTQMPFGTYGDFITAPDISQLFGEVIALWILLNWQKMGS 73

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           PS   +VELGPGRG ++ D++RV+ K +   ++ + +Y+VE S  L  +Q+  L    +K
Sbjct: 74  PSKFIIVELGPGRGTLISDVVRVLRKFE-QCYAAMVVYLVEISPILEKLQRDVLKD--EK 130

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI 196
           + W   + D+P     ++ANEFFD+LP+KQFV T     E  + ++  +   F I   ++
Sbjct: 131 VFWCKDIKDLPDYPVLIIANEFFDALPVKQFVYTNDSWCETYVTVENDE---FKIAYKKV 187

Query: 197 KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVK 256
              F   +D     + E        ++ + +++   GG A+VIDYGY+      T+Q+VK
Sbjct: 188 NKIFEMSND-MKNPVIEICDEAVSIVKCMENKILQSGGAAVVIDYGYIDCPYKSTIQSVK 246

Query: 257 GHTYVSPLVNPGQADLSSHVDFQRL-SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM 315
            H Y + L N G++D++++V+F  L +S++ L  +    + TQ  FL   GI +R   L+
Sbjct: 247 NHQYNNLLKNVGESDITAYVNFAVLHNSLSTLSSV----IMTQRDFLYNFGIKERLQVLI 302

Query: 316 KQTA--RKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
                 +K  L+    RL       ++MG +FK+ +V+
Sbjct: 303 ANATELQKQNLIAGFLRLT------ENMGSMFKVFLVN 334


>gi|149596613|ref|XP_001514487.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
          Length = 426

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 177/351 (50%), Gaps = 44/351 (12%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  +K  G +TV +Y    + +P  GYY   +  G  GDFVT+PEISQIFGE+L 
Sbjct: 28  MLRHLLAKVKATGPITVAEYMREALTNPAKGYYVHHDVLGEKGDFVTSPEISQIFGELLG 87

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVL-----SIYMVETS 119
           I+ I  W   G  S  +LVELGPGRG +  DILRV  +L     SVL     S++MVE S
Sbjct: 88  IWYISEWMAAGKSSTFQLVELGPGRGTLTGDILRVFNQLG----SVLKNCDISVHMVEVS 143

Query: 120 ERLTLIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFF 159
           ++L+ IQ   L                       G  INWY  L DVP G++F +A+EFF
Sbjct: 144 QKLSEIQASTLTGEKTPLERDDGSPVYMSGVTKTGIPINWYRDLQDVPQGYSFYLAHEFF 203

Query: 160 DSLPIKQFVMTEHGIRERMIDIDQ--HDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC 217
           D+LP+ +F  T  G RE  ID+D    D L F +      +      +     + E  P 
Sbjct: 204 DALPVHKFQKTPQGWREIFIDVDPLVSDKLRFVLAPSSTPAELFIQKEETRDHV-EVCPD 262

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
               +Q +S R+   GG A++ DYG+  +++ DT +  +GH     L  PG ADL++ VD
Sbjct: 263 AGVIVQRLSQRIEETGGAALIADYGHDGTKM-DTFRGFQGHKLHDVLTAPGTADLTADVD 321

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSV 328
           F  L  + I  K+   G   Q  FL+ +GI           AR  +LLD+ 
Sbjct: 322 FSYLRRM-IRGKVASLGPIKQQTFLQNMGI----------DARLKVLLDNA 361


>gi|311252815|ref|XP_003125280.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 2 [Sus
           scrofa]
 gi|311252817|ref|XP_003125279.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 1 [Sus
           scrofa]
          Length = 441

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 196/379 (51%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY T +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMREVLTNPAKGYYVTHDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 103 IWFISEWIATGKNAAFQLVELGPGRGTLSGDILRVFSQLGSVLKNCDISIHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPLEREAGSPVYMKGVTKSGIPISWYRDLQDVPKGYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE +IDID    D L F +      +      D     + E  P     
Sbjct: 223 VHKFQKTPQGWREVLIDIDPQVSDKLRFVLAPCATPAEAFIQKDETRDHV-EVCPDAGVI 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q ++ R++  GG A++ DYG+  ++  DT +   GH     L+ PG ADL++ VDF  L
Sbjct: 282 IQELAQRISLTGGAALIADYGHDGTKT-DTFRGFCGHQLHDVLIAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADK 338
             ++   K+   G  +Q  FL  +GI  R   L+ ++   + ++ LL   + L+    + 
Sbjct: 341 RRMS-QGKVASLGPISQQTFLRNMGIDVRLKILLDKSDEPSLREQLLQGYRMLM----NP 395

Query: 339 KSMGELFKIL-VVSHEKVE 356
           + MGE F    +V H+++ 
Sbjct: 396 EKMGERFNFFALVPHQRLH 414


>gi|58697059|ref|ZP_00372516.1| DUF185 [Wolbachia endosymbiont of Drosophila simulans]
 gi|58536669|gb|EAL59966.1| DUF185 [Wolbachia endosymbiont of Drosophila simulans]
          Length = 324

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 115/331 (34%), Positives = 185/331 (55%), Gaps = 25/331 (7%)

Query: 33  EFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIM 92
           ++GYY++  P G  GDF TAPEISQ+FGE++A++++  WE+ G PS   LVELGPG+G +
Sbjct: 5   KYGYYTSKLPLGKDGDFTTAPEISQLFGEVIAVWIMHTWEKLGKPSKFSLVELGPGKGTL 64

Query: 93  MLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTF 152
           + DI+RV  K    FF+ + I++VE S  L  IQK++L S    +NW+ ++ ++P   T 
Sbjct: 65  IHDIIRVTKKY-SSFFNSMLIHLVEISPTLRKIQKEKLKSLD--VNWHKNIDNLPEQPTI 121

Query: 153 LVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKS-----------NFL 201
            +ANEFFD+LPI QFV  + G  E M+      SL+ +     ++S             +
Sbjct: 122 FLANEFFDALPIDQFVYHDEGWYENMVTKQDDGSLLVSCQCVTLESRKKESWIPVSATQM 181

Query: 202 TCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYV 261
           T   +F GA+ E        ++ +  ++  + G A+++DYGY+      TLQ++K H Y 
Sbjct: 182 TNGKFFNGAVVEICSVGVEILKKLEKKIYNNKGAALIVDYGYVYPAYKSTLQSIKQHKYA 241

Query: 262 SPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA-- 319
           + L N G +D+++ V+FQ L       K     + TQ +FL   GI +R  +LMK  +  
Sbjct: 242 NFLENVGNSDITALVNFQALRDSL---KHVDCEILTQREFLYLFGIKERTQALMKSASDE 298

Query: 320 RKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           +K+ +     RL       ++MG LFK +++
Sbjct: 299 QKNRIFSEFLRLT------ENMGTLFKAMLL 323


>gi|321254782|ref|XP_003193196.1| hypothetical protein CGB_C9220C [Cryptococcus gattii WM276]
 gi|317459665|gb|ADV21409.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 449

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 135/391 (34%), Positives = 198/391 (50%), Gaps = 41/391 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N+L + I + IK  G +   +Y   C++ P  GYYS  + FG  GDF+T+PEISQIFGE+
Sbjct: 53  NELAKVIRDSIKSTGPIPASRYMQFCLSHPVHGYYSKGDVFGQKGDFITSPEISQIFGEL 112

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +AI+ +  W +   P+ VR+VELGPGRG +M D+LR +        S+ S+++VE SE +
Sbjct: 113 VAIWFLTRWMEVDSPTRVRIVELGPGRGTLMDDVLRTLFNFPGIAASINSVHLVENSEAM 172

Query: 123 TLIQKKQLASYGD----KINWYTSLADVPLG---FTFLVANEFFDSLPIKQFVMTEHGIR 175
             +Q + L+   +    K+NWYTS+ ++P     FT  VA+EFFD++PI  F  T+ G R
Sbjct: 173 REVQSQTLSPRIEGKDVKLNWYTSVEEIPETKDEFTLFVAHEFFDAMPINVFEKTDMGWR 232

Query: 176 ERMIDIDQHDSLVFNIGDHEIKSNF-LTCSDYFLGAI-------FENSPCRDR-----EM 222
           E +ID D   S             F L+ S   L  I       F N P   R     + 
Sbjct: 233 EVLIDRDPSYSPDLPTSSSPSGLRFTLSSSPTTLSTILPSTSPRFANLPSGSRIEVSQDS 292

Query: 223 QSISDRLA-----CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
             I  RL        GG  +V+DYG  ++    + +A + H  V    +PG  DL+++VD
Sbjct: 293 YKIMHRLGQVINQGLGGCGLVVDYGADKA-FASSFRAFRKHEIVDVFEDPGSCDLTANVD 351

Query: 278 FQ--RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLVS 333
           F   R S   I   L   G  +Q +FL  LGI  R   L+      R++ +    KRL+ 
Sbjct: 352 FAYLRESLTGIATSL---GPISQAQFLLSLGIQPRLRKLLDTAPLDRREAIEKGAKRLI- 407

Query: 334 TSADKKSMGELFKIL-VVSHE---KVELMPF 360
              D   MG  ++++ VVS E   K  + PF
Sbjct: 408 ---DVLGMGSQYQVMGVVSGEPEMKEGIYPF 435


>gi|162146752|ref|YP_001601211.1| hypothetical protein GDI_0930 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785327|emb|CAP54873.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 339

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 115/330 (34%), Positives = 170/330 (51%), Gaps = 21/330 (6%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YY+  +PF    DF+TAPEISQ+FGE+L  ++   W+  G      LVE GPGRG +M D
Sbjct: 20  YYAGRDPFA---DFITAPEISQMFGEILGAWVAVTWQGMGRRVPFALVEAGPGRGTLMAD 76

Query: 96  ILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY-GDKINWYTSLADVPLGFTFLV 154
           ++R++ ++ PD      +++VE S RL  +Q+  LA      + W+  + DVP G   L+
Sbjct: 77  MMRLLARVAPDCHDAARVHLVELSPRLRDVQQAALAGRTAHPVTWHDRIEDVPEGAVILL 136

Query: 155 ANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNF---LTCSDYFLGAI 211
           ANEF D+L I+QFV T  G  ER +   Q  + V           F   + C     G I
Sbjct: 137 ANEFLDALAIRQFVRTADGWAERFV---QGPAFVTQPASDLPPGPFDRSVPC-----GEI 188

Query: 212 FENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
            E  P      + ++ RL    GTA+ +DYGY  +  GDTLQA++      PL +PG AD
Sbjct: 189 LECCPDALAVARHVAARLCRAPGTALFVDYGYDGAVWGDTLQALRDGQPAWPLADPGLAD 248

Query: 272 LSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKD--ILLDSVK 329
           L++HVDF   ++         +G  TQG  L  LG++ RA  L +  A  +   + D+ +
Sbjct: 249 LTAHVDFAAFAAAVRDGGAVCHGSVTQGALLGALGLFARAEQLARNRAPGEAYAIRDAAQ 308

Query: 330 RLVSTSADKKSMGELFKILVVSHEKVELMP 359
           RL +       MG LFK L ++   + + P
Sbjct: 309 RLAA----PDRMGRLFKALAITSPGLPVPP 334


>gi|125778362|ref|XP_001359939.1| GA14629 [Drosophila pseudoobscura pseudoobscura]
 gi|54639689|gb|EAL29091.1| GA14629 [Drosophila pseudoobscura pseudoobscura]
          Length = 437

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 192/389 (49%), Gaps = 64/389 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G +TV +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 52  LAKQLRAQILATGPITVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVG 111

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL-- 122
           I+L+  W + G PS  +LVELGPGRG +  D+L+++ K K    +  S++MVE S  L  
Sbjct: 112 IWLVAEWRKMGSPSPFQLVELGPGRGTLARDVLKILTKFK--LGAEFSMHMVEVSPFLSK 169

Query: 123 -----------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
                      TL ++ QL  Y       G K  W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 170 AQAQRFCYTHETLPEEAQLPHYQVGTTATGTKAYWHRRLEDVPQGFSLVLAHEFFDALPV 229

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNF---LTCSDYFLGAIFENSPCR--- 218
            +  +     +E +ID+                +NF   L+ S   +  +F   P     
Sbjct: 230 HKLQLANGQWQEVLIDVAPESE--------PEAANFRYVLSKSQTPVSRVFHPMPGETRQ 281

Query: 219 --------DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQA 270
                   +R++  +++RL  DGG  +++DYG+   +  DT +A K H    PL+ PG A
Sbjct: 282 TLEYSLETERQVGLLAERLERDGGIGLIMDYGHFGEKT-DTFRAFKQHALHEPLLEPGTA 340

Query: 271 DLSSHVDFQRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDS-- 327
           DL++ VDF+ + S A     L+  G   QG FL          S M+  AR + LL +  
Sbjct: 341 DLTADVDFKLVKSTAETRGHLHCCGPIEQGLFL----------SRMQGEARLEQLLANAL 390

Query: 328 ------VKRLVSTSADKKSMGELFKILVV 350
                 ++       D K MG  FK L +
Sbjct: 391 PENEAIIRSGYEMLTDPKQMGSRFKFLAM 419


>gi|56605714|ref|NP_001008319.1| protein midA homolog, mitochondrial precursor [Rattus norvegicus]
 gi|81883713|sp|Q5XI79|MIDA_RAT RecName: Full=Protein midA homolog, mitochondrial; Flags: Precursor
 gi|54035316|gb|AAH83810.1| Similar to PRO1853 homolog [Rattus norvegicus]
 gi|149050627|gb|EDM02800.1| similar to PRO1853 homolog, isoform CRA_a [Rattus norvegicus]
          Length = 436

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 125/377 (33%), Positives = 190/377 (50%), Gaps = 28/377 (7%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 38  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHHDMLGEKGDFITSPEISQIFGELLG 97

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           ++ +  W   G  +  +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 98  VWFVSEWMASGKSTAFQLVELGPGRGTLTADILRVFSQLGSVLKTCDISIHLVEVSQKLS 157

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 158 EIQALTLTEETVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPTGYSFYLAHEFFDVLP 217

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T HG RE  +DID    D L F +      +      D     + E  P     
Sbjct: 218 VHKFQKTPHGWREVFVDIDPQSPDKLRFVLAPCATPAEAFIQRDERREHV-EVCPDAGVV 276

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DTL+    H     L  PG ADL++ VDF  L
Sbjct: 277 IQELSQRIASTGGAALIADYGHDGTKT-DTLRGFYEHQLHDVLTAPGTADLTADVDFSYL 335

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSM 341
             +A   ++   G   Q  FL+ +GI  R   L+ + A    L   + R      + + M
Sbjct: 336 RRMA-QGRVASLGPVEQRTFLKNMGIDVRLKVLLDK-AGDPSLQQQLLRGYDMLMNPQKM 393

Query: 342 GELFKIL-VVSHEKVEL 357
           GE F    ++ H+++ +
Sbjct: 394 GERFHFFALLPHQRLHV 410


>gi|195157774|ref|XP_002019769.1| GL12571 [Drosophila persimilis]
 gi|194116360|gb|EDW38403.1| GL12571 [Drosophila persimilis]
          Length = 437

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 192/389 (49%), Gaps = 64/389 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G +TV +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 52  LAKQLRAKILATGPITVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVG 111

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL-- 122
           I+L+  W + G PS  +LVELGPGRG +  D+L+++ K K    +  S++MVE S  L  
Sbjct: 112 IWLVAEWRKMGSPSPFQLVELGPGRGTLARDVLKILTKFK--LGAEFSMHMVEVSPFLSK 169

Query: 123 -----------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
                      TL ++ QL  Y       G K  W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 170 AQAQRFCYTHETLPEEAQLPHYQVGTTATGTKAYWHRRLEDVPQGFSLVLAHEFFDALPV 229

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNF---LTCSDYFLGAIFENSPCR--- 218
            +  +     +E +ID+                +NF   L+ S   +  +F   P     
Sbjct: 230 HKLQLANGQWQEVLIDVAPKSE--------PEAANFHYVLSKSQTPVSRVFHPMPGETRQ 281

Query: 219 --------DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQA 270
                   +R++  +++RL  DGG  +++DYG+   +  DT +A K H    PL+ PG A
Sbjct: 282 TLEYSLETERQVGLLAERLERDGGIGLIMDYGHFGEKT-DTFRAFKQHALHEPLLEPGTA 340

Query: 271 DLSSHVDFQRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDS-- 327
           DL++ VDF+ + S A     L+  G   QG FL          S M+  AR + LL +  
Sbjct: 341 DLTADVDFKLVKSTAETRGHLHCCGPIEQGLFL----------SRMQGEARLEQLLANAL 390

Query: 328 ------VKRLVSTSADKKSMGELFKILVV 350
                 ++       D K MG  FK L +
Sbjct: 391 PENEAIIRSGYEMLTDPKQMGSRFKFLAM 419


>gi|62859273|ref|NP_001016145.1| protein midA homolog, mitochondrial precursor [Xenopus (Silurana)
           tropicalis]
 gi|82178636|sp|Q5BKM6|MIDA_XENTR RecName: Full=Protein midA homolog, mitochondrial; Flags: Precursor
 gi|60552371|gb|AAH91018.1| hypothetical protein LOC548899 [Xenopus (Silurana) tropicalis]
 gi|89268182|emb|CAJ81481.1| novel protein [Xenopus (Silurana) tropicalis]
          Length = 430

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 197/377 (52%), Gaps = 38/377 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N L+  ++  IK  G +TV +Y    + +P  GYY   +  G  GDFVT+PE+SQIFGE+
Sbjct: 41  NALLNHLIFKIKSTGPITVSEYMREVLTNPVKGYYMHHDMLGEHGDFVTSPELSQIFGEL 100

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSER 121
           L ++ I  W   G P  ++LVELGPGRG +  D+LRV         S  +S+++VE S +
Sbjct: 101 LGVWCISEWMSAGKPKSLQLVELGPGRGTLTDDLLRVFSNFGRLLNSCDISVHLVEVSPK 160

Query: 122 LTLIQ--------------------KKQLASYGDKINWYTSLADVPLGFTFLVANEFFDS 161
           L+ IQ                    KK +   G  + WY  + DVP GF+F +A+EFFD+
Sbjct: 161 LSDIQAQRLTGKAIEVELDKNSPVYKKGITKTGFPVCWYQDIQDVPTGFSFYIAHEFFDA 220

Query: 162 LPIKQFVMTEHGIRERMIDIDQ--HDSLVFNIGDH-EIKSNFLTCSDYFLGAIFENSPCR 218
           LPI +   T+ G RE +IDID    D L F +G +  + +N     D     + E  P  
Sbjct: 221 LPIHKLQKTKDGWREILIDIDPGIPDKLRFVLGPNVSLVANTFVQDDEPRDHV-EVCPSA 279

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
              +Q +++++   GG A++ DYG++  R  DT +  + H     L NPG ADL++ VDF
Sbjct: 280 AVIIQKLANQINSYGGAALIADYGHMGERT-DTFRGFRAHKLHDVLSNPGTADLTADVDF 338

Query: 279 QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVS----- 333
             +  I +       G  TQ +FL+ +GI  R   L+++++  D+ +   K+L+      
Sbjct: 339 NFMRRI-VGEAASCLGPVTQHEFLKNMGIDIRLKVLLEKSS--DVAVQ--KQLIHGYNIL 393

Query: 334 TSADKKSMGELFKILVV 350
            +AD+  MG+ FK   V
Sbjct: 394 MNADQ--MGQRFKFFSV 408


>gi|73980164|ref|XP_532933.2| PREDICTED: similar to CG17726-PA isoform 1 [Canis familiaris]
          Length = 440

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 132/379 (34%), Positives = 192/379 (50%), Gaps = 35/379 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R +V  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLVYKIKATGPITVAEYMKEVLTNPAKGYYVHRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPG+G +  DILRV  +L     +  +SI+MVE SE+L+
Sbjct: 103 IWFISEWMATGKNAAFQLVELGPGKGTLAGDILRVFSQLGSVLKNCDISIHMVEVSEKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKIPLERNAGSSVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  IDID    D L F +      +      D     + E  P     
Sbjct: 223 VHKFQKTPQGWREVFIDIDPQVSDKLRFVLAPCVTPAEVFIQRDEIRDHV-EVCPEAGVI 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DT +   GH     L  PG ADL++ VDF  L
Sbjct: 282 IQELSQRIALTGGAALIADYGHDGTKT-DTFRGFCGHKLHDVLTAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADK 338
             +A   ++   G   Q  FL+ +GI  R   L+ ++   AR+  LL     L+    + 
Sbjct: 341 RRMA-EGQVASLGPIKQQTFLKNMGIDVRLKVLLDKSDEPARQQ-LLQGYDMLM----NP 394

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H+++ 
Sbjct: 395 KKMGERFNFFALLPHQRLH 413


>gi|193643457|ref|XP_001944630.1| PREDICTED: protein midA homolog, mitochondrial-like [Acyrthosiphon
           pisum]
          Length = 421

 Score =  185 bits (470), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 131/384 (34%), Positives = 198/384 (51%), Gaps = 52/384 (13%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           ++  L +   + I+ NG +T+ +Y    +      YY++ N FG+ GDF+T+PEISQ++G
Sbjct: 25  VQQNLTKYFQDKIRINGPITLAEYMRESLKT----YYNSGNVFGSDGDFITSPEISQLYG 80

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++L+  WE+ G PS V L+ELGPG G+MM D+LR++ + +      LSI+MVETS+
Sbjct: 81  EMVMLWLLSLWEKAGCPSPVNLIELGPGTGVMMTDMLRLLKQTQYSSLD-LSIHMVETSK 139

Query: 121 RLTLIQKKQLA--------------------SYGDK-INWYTSLADVPLG-FTFLVANEF 158
           + +L Q  +L                      YG K I WY S+ D+P   F+ +VA EF
Sbjct: 140 KCSLEQADKLGCSDLRTDSGKCYYQHGITSEKYGMKEIFWYESIDDIPRNTFSLIVAQEF 199

Query: 159 FDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNI---GDHEIKSNFLTCSDYFLGAIFENS 215
           FD+LP+ +F       RE +IDI+   S  F           SN ++  DY+  +  +N 
Sbjct: 200 FDALPVHKFRKINEKWREIVIDIENDISGTFRYVLSKTSTTTSNLISTIDYYKCSNLKN- 258

Query: 216 PCRDRE--------MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNP 267
              + E        MQ +S+R+  DGG  + IDYG  +  + DT +A  GH  V+PL  P
Sbjct: 259 -VNEIEVGLDAAIVMQKLSERIILDGGIFLCIDYGQDKPII-DTFRAFSGHQQVNPLHKP 316

Query: 268 GQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI---WQRAFSLMKQTARKDIL 324
           G  DL++ VDF RL ++A    L   G   Q  FLE + I   +Q   +L K       L
Sbjct: 317 GTVDLTADVDFNRLKNVAGTDVLAF-GPIGQNIFLENMMINLRYQNLLTLTKNEKEATSL 375

Query: 325 LDSVKRLVSTSADKKSMGELFKIL 348
                +L+        MG+ FKI+
Sbjct: 376 TFGYNKLM-------EMGKKFKIM 392


>gi|327262391|ref|XP_003216008.1| PREDICTED: protein midA homolog, mitochondrial-like [Anolis
           carolinensis]
          Length = 457

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 169/324 (52%), Gaps = 24/324 (7%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           +++ +V  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE++ 
Sbjct: 65  MLKHLVMKIKSTGPITVAEYMREVLTNPVKGYYIQHDMLGESGDFITSPEISQIFGELIG 124

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ +  W  +G P+  +LVELGPGRG +  DI+RV  +L        +S+++VE S +L+
Sbjct: 125 IWFVSEWIANGKPNKFQLVELGPGRGSLTSDIIRVFNQLNSLLHKCDISVHLVEISPKLS 184

Query: 124 LIQK------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIK 165
            IQ                   + L   G  I WY  L DVP GF F +A+EFFD+LPI 
Sbjct: 185 EIQASVLTEGKIKLQESCLAYMQGLTKTGLPIFWYRDLNDVPGGFNFYLAHEFFDTLPIH 244

Query: 166 QFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ 223
           +F  TE G RE ++DID    D L F +      +      D       E SP     +Q
Sbjct: 245 KFQKTEKGWRELLVDIDPEAPDKLRFVLAPSATPAAEAFIHDKESRDHVEVSPDAGVTVQ 304

Query: 224 SISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
            ++     +GG A++IDYG+  ++  DT +  +GH     L++PG ADL++ VDF  L  
Sbjct: 305 KLAHNTEKNGGAALIIDYGHDGTKT-DTFRGFRGHKLHDVLISPGMADLTADVDFSYLRR 363

Query: 284 IAILYKLYINGLTTQGKFLEGLGI 307
           +A    +   G   Q  FL  +GI
Sbjct: 364 MA--QGVAALGPIKQQDFLRNMGI 385


>gi|291386928|ref|XP_002709807.1| PREDICTED: hypothetical protein [Oryctolagus cuniculus]
          Length = 442

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 125/376 (33%), Positives = 192/376 (51%), Gaps = 28/376 (7%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R +V  IK  G +TV +Y    + +P  GYY   +  G  GDFVT+PEISQIFGE+L 
Sbjct: 44  MLRHLVYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFVTSPEISQIFGELLG 103

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 104 IWFISEWMATGKSAAFQLVELGPGRGTLAGDILRVFNQLGSVLKNCDISIHLVEVSQKLS 163

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K ++  G  + WY +L DVP G++F +A+EFFD LP
Sbjct: 164 EIQAVTLTEEKVPLERNADSPVYMKGVSKTGIPVCWYRNLQDVPKGYSFYLAHEFFDVLP 223

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE +ID D    D L F +      +      D     + E  P     
Sbjct: 224 VHKFQKTPQGWREVLIDTDPQVSDKLRFVLAPCATPAEAFIHHDEKRDHV-EVCPDAGVV 282

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DT +   GH     L+ PG ADL++ VDF  L
Sbjct: 283 IQELSQRIALTGGAALIADYGHDGTKT-DTFRGFCGHKLHDVLIAPGMADLTADVDFSYL 341

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSM 341
             +A   ++   G  TQ  FL+ +GI  R   ++   + +  + + + +      + K M
Sbjct: 342 RRMA-QGQVASLGPITQQTFLKNMGIDVR-LKILADKSHEPSVREQLLQGYDMLMNPKKM 399

Query: 342 GELFKIL-VVSHEKVE 356
           GE F    ++ H+++ 
Sbjct: 400 GERFHFFALLPHQRLR 415


>gi|242005675|ref|XP_002423688.1| conserved hypothetical protein [Pediculus humanus corporis]
 gi|212506864|gb|EEB10950.1| conserved hypothetical protein [Pediculus humanus corporis]
          Length = 428

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 193/369 (52%), Gaps = 39/369 (10%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I  NG +TV  Y   C+A+P  GYY   +  G  GDF+T+PEISQ+FGE++  ++   + 
Sbjct: 50  ITANGPITVADYMRQCLANPSLGYYMQKDMIGEKGDFITSPEISQMFGEIIGTWIFHEFR 109

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA- 131
           + G P   +++ELGPG+G +M D+L+ +   K      LS+++VE S  L  +Q   L+ 
Sbjct: 110 KIGSPKPWQIIELGPGKGTLMKDVLKTLNTFKAT--DDLSVHLVEISPGLASLQATTLSS 167

Query: 132 --------SYGDKIN---------------WYTSLADVPLGFTFLVANEFFDSLPIKQFV 168
                   S+ DK N               WY  L  VP GF+ ++A+EFFD+LPI +F 
Sbjct: 168 DVINIGVVSFEDKSNSHYKTCSSLYKVPIYWYDKLEKVPKGFSVILAHEFFDALPIHKFQ 227

Query: 169 MTEHGIRERMID--IDQHDSLVFN--IGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQ 223
            T  G RE +ID  ++++ +  FN  I   E + S  L   D     + E S       Q
Sbjct: 228 KTSSGWREVLIDSTMNENGTNKFNYVISPKETVMSKLLIAKDEKRDHV-EISHEAGLVAQ 286

Query: 224 SISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
            I+ RL   GG ++ IDYG+   +  DT +A K H  V PL NPG +DL++ V+F  L+ 
Sbjct: 287 EIAQRLEEFGGFSLFIDYGHFGEK-QDTFRAFKNHQLVDPLTNPGLSDLTADVNFNYLTE 345

Query: 284 IAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSM 341
           I +  K++I+G   QGKFL  +G+  R   L+K  +  + + +L S   +++   D   M
Sbjct: 346 I-MKDKMFISGPIEQGKFLNNMGMNLRLKMLLKSCKNEQDEKILVSAYNMLT---DDDKM 401

Query: 342 GELFKILVV 350
           G  +K L  
Sbjct: 402 GSRYKCLAA 410


>gi|194743862|ref|XP_001954419.1| GF16742 [Drosophila ananassae]
 gi|190627456|gb|EDV42980.1| GF16742 [Drosophila ananassae]
          Length = 440

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/383 (31%), Positives = 193/383 (50%), Gaps = 47/383 (12%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L +++   I   G ++V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE
Sbjct: 53  KGSLAKQLRAKILATGPISVAEYMREVLTNPQAGYYMARDVFGREGDFITSPEISQIFGE 112

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ ++L+  W + G PS  +LVELGPGRG +  D+L+V+ K K    + LSI+MVE S  
Sbjct: 113 LVGVWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLSKFK--LGAELSIHMVEVSPF 170

Query: 122 LTLIQKK-------------QLASY-------GDKINWYTSLADVPLGFTFLVANEFFDS 161
           L+ IQ +             QL  Y       G K  W+  L DVP GF+ ++A+EFFD+
Sbjct: 171 LSKIQAQRFCYTHETLPEDSQLPHYQTGTTASGTKAFWHRRLEDVPQGFSLILAHEFFDA 230

Query: 162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCR--- 218
           LP+ +    +   +E +ID+   +       D       L+ S   +  +F+  P     
Sbjct: 231 LPVHKLQWLDGQWQEVLIDVASKEE------DQPGFRYVLSRSQTPVSRVFQPIPGEKRS 284

Query: 219 --------DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQA 270
                   +R++  +++R+  DGG A+++DYG+   +  DT +A K H    PLV+PG A
Sbjct: 285 CLEYSLETERQVGLLAERIERDGGIALIMDYGHFGEKT-DTFRAFKNHALHDPLVDPGSA 343

Query: 271 DLSSHVDFQRLSSIAILY-KLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDS 327
           DL++ VDF+ +   A     ++  G   QG FL+ +    R   L+       + I+   
Sbjct: 344 DLTADVDFKLIRHAAEKRGSIHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQQIIRSG 403

Query: 328 VKRLVSTSADKKSMGELFKILVV 350
            + L     D   MG  FK L +
Sbjct: 404 YQMLT----DAAQMGTRFKFLAM 422


>gi|94496200|ref|ZP_01302778.1| hypothetical protein SKA58_03780 [Sphingomonas sp. SKA58]
 gi|94424379|gb|EAT09402.1| hypothetical protein SKA58_03780 [Sphingomonas sp. SKA58]
          Length = 354

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/355 (34%), Positives = 184/355 (51%), Gaps = 24/355 (6%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
            L  ++   I   G ++V  Y    +A+    YY+T +P GA GDF TAPEISQ+FGE++
Sbjct: 7   PLADRLARQIASGGPISVAHY----IAEANQHYYATRDPLGAEGDFTTAPEISQMFGELV 62

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVI--CKLKPDFFSVLSIYMVETSER 121
            + L   W + G       VELGPGRG +  D LR +    L P       +++VETS  
Sbjct: 63  GLALADIWMRSGRSGQAAYVELGPGRGTLASDALRAMQRAALAP------PVHLVETSPA 116

Query: 122 LTLIQKKQLASYGDKINWYTSLADVP-LGFTFLVANEFFDSLPIKQFVMTEHGIRER-MI 179
           L   + +Q A     I+ + ++A +P  G   +VANEFFD+LP++Q +      RER ++
Sbjct: 117 L---RGRQQALLPTAIH-HDTIASLPEQGPLLVVANEFFDALPVRQCIRVGDEWRERVLL 172

Query: 180 DIDQHDSLVFNIGDHEIKSNFLT-CSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
             ++    +   G   I+S      +D   GAI E+         +++ ++A  GG AI+
Sbjct: 173 PREEPGRFIAVAGYRRIESGLPPIAADAPDGAILESPIAAAEIAYALAQKIARQGGAAII 232

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
           +DYGY    +GDTLQAVK H +  P  +PG+ DL++HVDF  L ++A    L ++G   Q
Sbjct: 233 VDYGYEGPALGDTLQAVKAHRFADPFADPGEVDLTTHVDFTMLGNMARQAGLRVHGPVGQ 292

Query: 299 GKFLEGLGI-WQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
           G FL  LGI  + A       AR   +  +  RL     D  +MG LFK +  +H
Sbjct: 293 GSFLRQLGIDARAAQLAAGAPARAQDVQAAAHRLT----DADAMGTLFKAMAWTH 343


>gi|195499996|ref|XP_002097185.1| GE26081 [Drosophila yakuba]
 gi|194183286|gb|EDW96897.1| GE26081 [Drosophila yakuba]
          Length = 437

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/375 (31%), Positives = 189/375 (50%), Gaps = 36/375 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 52  LAKQLRAKILATGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVG 111

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL-- 122
           I+L+  W + G PS  +LVELGPGRG +  D+L+V+ K K D  +  S++MVE S  L  
Sbjct: 112 IWLVSEWRKMGSPSPFQLVELGPGRGTLARDVLKVLTKFKQD--AEFSMHMVEVSPFLSK 169

Query: 123 -----------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
                      TL +  Q   Y       G K  W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 170 AQAQRFCYSHQTLPEDAQQPHYQEGTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDALPV 229

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC------R 218
            +  + +   +E +ID+   D        + +  +    S  +     E   C       
Sbjct: 230 HKLQLVDGKWQEVLIDVASSDGAEDAGFRYVLSRSQTPVSSLYRPMPGETRSCLEHSLET 289

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
           +R++  +++R+  DGG A+++DYG+   +  DT +A K H    PL+ PG ADL++ VDF
Sbjct: 290 ERQVGLLAERIERDGGIALIMDYGHFGEKT-DTFRAFKQHKLHDPLLEPGSADLTADVDF 348

Query: 279 QRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTS 335
           + +  IA     ++  G   QG FL+ +    R   L+       ++I+    + L    
Sbjct: 349 KLVRHIAETRGNIHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLT--- 405

Query: 336 ADKKSMGELFKILVV 350
            D   MG  FK L +
Sbjct: 406 -DPAQMGSRFKFLAM 419


>gi|15603924|ref|NP_220439.1| hypothetical protein RP045 [Rickettsia prowazekii str. Madrid E]
 gi|3860615|emb|CAA14516.1| unknown [Rickettsia prowazekii]
 gi|292571641|gb|ADE29556.1| hypothetical protein rpr22_CDS043 [Rickettsia prowazekii Rp22]
          Length = 358

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 188/359 (52%), Gaps = 24/359 (6%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI ++G +T D      ++     YY       + GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIYQHGYITCDVLMQEVLSSNPNSYYKQVKSLASEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IREWQRIGNPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIKLIEINKNFIAHQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
             L      I     + ++P   T ++ NEFFD++PIKQ++  +    ER+  +      
Sbjct: 125 SNLQDINLPIKHLAFIEEIPQKPTIIITNEFFDTMPIKQYIKVKELWYERIFLVQPVDGR 184

Query: 183 -QHDSLVFNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            ++D +  N    E +    +   D   GAI E S      ++ I++ L    G+ ++ID
Sbjct: 185 IKYDKISINKRLQEYLLRTHIEAKD---GAILEESYKSIEIIKFIAEHLKKVRGSCLIID 241

Query: 241 YGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY        + +   TLQAV+ H Y   L N G+ADLS+HVDF  L ++A   K+ + 
Sbjct: 242 YGYDIAPYDRTRYQYNPTLQAVRKHKYCPILENLGEADLSAHVDFYSLKTVAKNSKINVI 301

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQTARKDILL--DSVKRLVSTSADKKSMGELFKILVV 350
              +Q  FL   GI  R  +L  +   K +L+    ++RL+      + MG+LFK+L +
Sbjct: 302 DTISQRDFLIQNGILLRKQTLKDKLNDKQVLIIEKQMERLILP----EQMGKLFKVLQI 356


>gi|296114641|ref|ZP_06833294.1| hypothetical protein GXY_02651 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978997|gb|EFG85722.1| hypothetical protein GXY_02651 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 367

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/326 (34%), Positives = 164/326 (50%), Gaps = 18/326 (5%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YYS  +PF    DF+TAPEISQ+FGE+L  ++   W+  G P+   L E GPGRG +M D
Sbjct: 21  YYSGRDPFA---DFITAPEISQMFGELLGAWVAVTWQAMGTPTPFVLAEAGPGRGTLMAD 77

Query: 96  ILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKIN--WYTSLADVPLGFTFL 153
            LR++ ++ P  ++   ++MVETS RL  +Q   LA +       W+ ++  +P G   L
Sbjct: 78  ALRLLARVAPACYAAARVHMVETSPRLRQVQATSLAPHVGVCAPVWHDAVTGLPPGAMIL 137

Query: 154 VANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFE 213
           +ANEF D+LPI+QFV T  G  ER +     +  V            L   D   G + E
Sbjct: 138 LANEFLDALPIRQFVRTARGWDERSV---VGEVFVTAPATDLPADGPLATRDVPEGEVLE 194

Query: 214 NSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
                    + +  RL    G A+ IDYGY     GDTLQA+       PL  PG ADL+
Sbjct: 195 TCEGALGIARQLGRRLMDGMGAALFIDYGYDGPGWGDTLQALCDGHPAWPLARPGMADLT 254

Query: 274 SHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK----QTARKDILLDSVK 329
           +HVDF      A        G  TQG FL  LG++ RA  L +    + AR+  + ++ +
Sbjct: 255 AHVDFAAFGMAARAGGCTTWGSVTQGAFLSTLGLFPRAQQLARNQPHEVARQ--IGEAAQ 312

Query: 330 RLVSTSADKKSMGELFKILVVSHEKV 355
           RL    A    MG LF+++ ++   +
Sbjct: 313 RL----AAPDRMGGLFRVMALTSPGI 334


>gi|114576970|ref|XP_001167268.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 5 [Pan
           troglodytes]
          Length = 441

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/379 (33%), Positives = 192/379 (50%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 223 VHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DT +    H     L+ PG ADL++ VDF  L
Sbjct: 282 IEELSQRIALTGGAALVADYGHDGTKT-DTFRGFCDHKLHDVLIAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 341 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 395

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 396 KKMGERFNFFALLPHQRLQ 414


>gi|21396487|ref|NP_653337.1| protein midA homolog, mitochondrial isoform 1 [Homo sapiens]
 gi|74749891|sp|Q7L592|MIDA_HUMAN RecName: Full=Protein midA homolog, mitochondrial; Flags: Precursor
 gi|38197076|gb|AAH04548.2| Chromosome 2 open reading frame 56 [Homo sapiens]
 gi|62822267|gb|AAY14816.1| unknown [Homo sapiens]
 gi|119620807|gb|EAX00402.1| hypothetical protein PRO1853, isoform CRA_c [Homo sapiens]
          Length = 441

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/379 (33%), Positives = 192/379 (50%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 163 EIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 223 VHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DT +    H     L+ PG ADL++ VDF  L
Sbjct: 282 IEELSQRIALTGGAALVADYGHDGTKT-DTFRGFCDHKLHDVLIAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 341 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 395

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 396 KKMGERFNFFALLPHQRLQ 414


>gi|168033894|ref|XP_001769449.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679369|gb|EDQ65818.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 391

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 195/397 (49%), Gaps = 61/397 (15%)

Query: 5   LIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
           + + +  LI+ + G +TV +Y    + +P  G+Y   + FG  GDFVT+P+ISQ+FGEM+
Sbjct: 1   MAKHLKALIRFRGGPITVAEYMEEVLTNPNAGFYMNRDVFGTHGDFVTSPDISQMFGEMV 60

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            ++ +C W Q G P  V ++ELGPGRG +M D+LR   K K DF   LS+++VE S  L 
Sbjct: 61  GVWSMCLWHQMGQPEAVNIIELGPGRGTLMADLLRGTAKFK-DFSQTLSVHLVECSPALR 119

Query: 124 LIQKKQLASY---------------------------GDKINWYTSLADVPLGF-TFLVA 155
            IQ + L                              G  + W+  L  VP G  T ++A
Sbjct: 120 KIQHETLKCVYKGGAEEKPTADGQNSEVVDDRISQISGVPVAWHFDLDQVPRGVPTIIIA 179

Query: 156 NEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENS 215
           +EF+D+LPI QF  +  G  E+++D+ + D           +  + +  +       E  
Sbjct: 180 HEFYDALPIHQFQKSPRGWCEKLVDVAEDD----------WRMKWASLQEKAEIEHVEVC 229

Query: 216 PCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSH 275
           P   +    I+ R+  DGG A+++DYG  +  V D+LQA+K H +V  L +PG ADLS++
Sbjct: 230 PQAMKVTADIAKRVGGDGGGALIVDYGDSKI-VSDSLQAIKKHEFVHVLDSPGNADLSAY 288

Query: 276 VDFQRLSSI----AILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--RKDILLDSVK 329
           VDF  L  +    A+   +Y  G  TQ +FL  LGI  R  SL++     + + L     
Sbjct: 289 VDFAALKHVVEDAAVGAAVY--GPITQSQFLGALGINFRLESLVQNATDEQAEALQLGYW 346

Query: 330 RLVSTSAD------------KKSMGELFKILVVSHEK 354
           RLV                    MG  +K LVV ++K
Sbjct: 347 RLVGDGPAPWLDSDDDVNRVPPGMGSRYKALVVVNDK 383


>gi|114576978|ref|XP_515411.2| PREDICTED: hypothetical protein isoform 6 [Pan troglodytes]
          Length = 399

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/379 (33%), Positives = 192/379 (50%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 1   MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 60

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 61  IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 120

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 121 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLP 180

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 181 VHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 239

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DT +    H     L+ PG ADL++ VDF  L
Sbjct: 240 IEELSQRIALTGGAALVADYGHDGTKT-DTFRGFCDHKLHDVLIAPGTADLTADVDFSYL 298

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 299 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 353

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 354 KKMGERFNFFALLPHQRLQ 372


>gi|297265811|ref|XP_001108260.2| PREDICTED: protein midA homolog, mitochondrial-like isoform 2
           [Macaca mulatta]
          Length = 442

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 191/379 (50%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 44  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGKQGDFITSPEISQIFGELLG 103

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 104 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 163

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  + DVP G++F +A+EFFD LP
Sbjct: 164 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPISWYRHVHDVPKGYSFYLAHEFFDVLP 223

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  IDID    D L F +      +      D     + E  P     
Sbjct: 224 VHKFQKTPQGWREVFIDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 282

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++     +   GH     L+ PG ADL++ VDF  L
Sbjct: 283 IEELSQRIALTGGAALVADYGHDGTKT-XMFKGFCGHKLHDVLIAPGTADLTADVDFSYL 341

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 342 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 396

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ HE++E
Sbjct: 397 KKMGERFNFFALLPHERLE 415


>gi|255004169|ref|ZP_05278970.1| hypothetical protein AmarV_02142 [Anaplasma marginale str.
           Virginia]
          Length = 342

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 188/347 (54%), Gaps = 18/347 (5%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAW 71
           + + +  +T+D++ +L V   E GYY T  PFG  GDFVT+ EISQ+FGE++A++++   
Sbjct: 9   IFENSAHVTMDRFMSL-VYHEEHGYYMTRVPFGRAGDFVTSAEISQLFGEVVALWILSYL 67

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA 131
           E  G      L+ELGPGRG +M DILRV  +  P + ++L ++++E S  L   Q+  L 
Sbjct: 68  ESAGISEKFSLLELGPGRGTLMHDILRVFEQF-PRYDALLEVHLLEISPLLRNTQRATLE 126

Query: 132 SYGDK--INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVF 189
           S+  +  I+W+  L ++P   T +VANEFFD+LP++QF+ T    +E  +  D  +  + 
Sbjct: 127 SFSARKEISWHCKLEELPERPTIVVANEFFDALPVRQFIRTGGAWKECCVCNDGGNLGIV 186

Query: 190 NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVG 249
            +   + + N     D   G I E        +  +   +  +GG A + DYGYLQ    
Sbjct: 187 AV---DTQYNLDEYGDVPEGGIIERCEAASDVLARLEKIIVRNGGAAAIFDYGYLQPPYC 243

Query: 250 DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQ 309
            T+Q+VK H Y   L N G+ D+++HVDF  L   A   +   + + TQ +FL   GI +
Sbjct: 244 STIQSVKSHHYCDFLDNIGECDITAHVDFGLLQKHA---QRLNSKVVTQREFLYQFGIRE 300

Query: 310 RAFSLMKQTARKDI--LLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
           R   L +    +    L  +  RL       ++MG +FK+L+++HE+
Sbjct: 301 RLACLERNATERQRRELKGAFLRLT------ENMGTMFKVLLLNHER 341


>gi|149727989|ref|XP_001501018.1| PREDICTED: similar to CG17726 CG17726-PA [Equus caballus]
          Length = 442

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 130/380 (34%), Positives = 193/380 (50%), Gaps = 36/380 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 44  MLRHLMYKIKSTGPITVAEYMREVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 103

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 104 IWFISEWMATGKSAAFQLVELGPGRGTLAGDILRVFSQLGSVLKNCDISIHLVEVSQKLS 163

Query: 124 LIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ   LA                      G  I+WY  L DVP  ++F +A+EFFD LP
Sbjct: 164 EIQALTLAEEKIPLERNAGSPAYMKGVTKSGIPISWYRDLQDVPKEYSFYLAHEFFDVLP 223

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSN-FLTCSDYFLGAIFENSPCRDR 220
           + +F  T  G RE  IDID    D L F +      +  F+ C +       E  P    
Sbjct: 224 VHKFQKTPQGWREVFIDIDPQVSDKLRFVLAPCATPAEAFIQCDE--TRDHVEVCPDAGV 281

Query: 221 EMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQR 280
            +Q +S R+A  GG A++ DYG+  ++  DT +   GH     L+ PG ADL++ VDF  
Sbjct: 282 IIQELSQRIALTGGAALIADYGHDGTKT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSY 340

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSAD 337
           L  +A   K+   G   Q  FL+ +GI  R   L+ ++   + +  LL     L+    +
Sbjct: 341 LRRMA-QGKVASLGPVQQQTFLKNMGIDVRLKVLLDKSDDPSMRQQLLQGYDMLM----N 395

Query: 338 KKSMGELFKIL-VVSHEKVE 356
            K MGE F    ++ H+++ 
Sbjct: 396 PKKMGERFNFFALLPHQRLH 415


>gi|166225927|sp|Q9CWG8|MIDA_MOUSE RecName: Full=Protein midA homolog, mitochondrial; Flags: Precursor
          Length = 436

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 189/378 (50%), Gaps = 34/378 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 38  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGELLG 97

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFS-VLSIYMVETSERLT 123
           ++ +  W   G     +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 98  VWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQKLS 157

Query: 124 LIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ   LA                      G  I+WY  L DVP G++  +A+EFFD LP
Sbjct: 158 EIQALTLAEEKVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPEGYSLYLAHEFFDVLP 217

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +D+D    D L F +      +      D     + E  P     
Sbjct: 218 VHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHV-EVCPDAGVI 276

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DTL+   GH     L+ PG ADL++ VDF  L
Sbjct: 277 IQELSQRIASTGGAALIADYGHDGTKT-DTLRGFYGHQLHDVLIAPGTADLTADVDFSYL 335

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTAR---KDILLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ +      K  LL     L+    + 
Sbjct: 336 HRMA-QGKVASLGPVEQRTFLKNMGIDVRLKVLLDKAGEPSAKQQLLGGYDMLM----NP 390

Query: 339 KSMGELFKIL-VVSHEKV 355
           + MGE F    ++ H+++
Sbjct: 391 QKMGERFHFFALLPHQRL 408


>gi|148706528|gb|EDL38475.1| RIKEN cDNA 2410091C18, isoform CRA_b [Mus musculus]
          Length = 445

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 189/378 (50%), Gaps = 34/378 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 47  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGELLG 106

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFS-VLSIYMVETSERLT 123
           ++ +  W   G     +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 107 VWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQKLS 166

Query: 124 LIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ   LA                      G  I+WY  L DVP G++  +A+EFFD LP
Sbjct: 167 EIQALTLAEEKVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPEGYSLYLAHEFFDVLP 226

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +D+D    D L F +      +      D     + E  P     
Sbjct: 227 VHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHV-EVCPDAGVI 285

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DTL+   GH     L+ PG ADL++ VDF  L
Sbjct: 286 IQELSQRIASTGGAALIADYGHDGTKT-DTLRGFYGHQLHDVLIAPGTADLTADVDFSYL 344

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTAR---KDILLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ +      K  LL     L+    + 
Sbjct: 345 HRMA-QGKVASLGPVEQRTFLKNMGIDVRLKVLLDRAGEPSAKQQLLGGYDMLM----NP 399

Query: 339 KSMGELFKIL-VVSHEKV 355
           + MGE F    ++ H+++
Sbjct: 400 QKMGERFHFFALLPHQRL 417


>gi|296224076|ref|XP_002757896.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 1
           [Callithrix jacchus]
          Length = 449

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 132/385 (34%), Positives = 195/385 (50%), Gaps = 39/385 (10%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 44  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHRDMLGEKGDFITSPEISQIFGELLG 103

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 104 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFSQLGSVLKNCDISVHLVEVSQKLS 163

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            +Q                     K +   G  ++WY  L DVP G +F +A+EFFD LP
Sbjct: 164 EVQALTLTEEKVPLERNAESPVYMKGVTKSGIPVSWYRDLHDVPKGHSFYLAHEFFDVLP 223

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  IDID    D L F +      +      D     I E  P     
Sbjct: 224 VHKFQKTPQGWREVFIDIDPQVSDKLRFVLAPCATPAEVFIQHDETRDHI-EVCPDAGVI 282

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DT +   GH     L+ PG ADL++ VDF  L
Sbjct: 283 IEELSRRIALTGGAALVADYGHDGTKT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSFL 341

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLD-----SVKRLVSTSA 336
             +A   K+   G  TQ  FL+ +GI  R   L  +     +LLD     SVK+ +    
Sbjct: 342 RRMA-QGKVASLGPITQHTFLKNMGIDVR---LKVRIFFFPVLLDKSNEQSVKQQLLQGY 397

Query: 337 D----KKSMGELFKIL-VVSHEKVE 356
           D     K MGE F    ++ H++++
Sbjct: 398 DMLMNPKKMGERFNFFALLPHQRLQ 422


>gi|297265809|ref|XP_002799255.1| PREDICTED: protein midA homolog, mitochondrial-like [Macaca
           mulatta]
          Length = 399

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 191/379 (50%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 1   MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGKQGDFITSPEISQIFGELLG 60

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 61  IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 120

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  + DVP G++F +A+EFFD LP
Sbjct: 121 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPISWYRHVHDVPKGYSFYLAHEFFDVLP 180

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  IDID    D L F +      +      D     + E  P     
Sbjct: 181 VHKFQKTPQGWREVFIDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 239

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++     +   GH     L+ PG ADL++ VDF  L
Sbjct: 240 IEELSQRIALTGGAALVADYGHDGTKTF-MFKGFCGHKLHDVLIAPGTADLTADVDFSYL 298

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 299 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 353

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ HE++E
Sbjct: 354 KKMGERFNFFALLPHERLE 372


>gi|158937256|ref|NP_082887.2| protein midA homolog, mitochondrial precursor [Mus musculus]
          Length = 436

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 189/378 (50%), Gaps = 34/378 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 38  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGELLG 97

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFS-VLSIYMVETSERLT 123
           ++ +  W   G     +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 98  VWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQKLS 157

Query: 124 LIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ   LA                      G  ++WY  L DVP G++  +A+EFFD LP
Sbjct: 158 EIQALTLAEEKVPLERDAESLVYMKGVTKSGIPVSWYRDLKDVPEGYSLYLAHEFFDVLP 217

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +D+D    D L F +      +      D     + E  P     
Sbjct: 218 VHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHV-EVCPDAGVI 276

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DTL+   GH     L+ PG ADL++ VDF  L
Sbjct: 277 IQELSQRIASTGGAALIADYGHDGTKT-DTLRGFYGHQLHDVLIAPGTADLTADVDFSYL 335

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTAR---KDILLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ +      K  LL     L+    + 
Sbjct: 336 RRMA-QGKVASLGPVEQRTFLKNMGIDVRLKVLLDKAGEPSAKQQLLGGYDMLM----NP 390

Query: 339 KSMGELFKIL-VVSHEKV 355
           + MGE F    ++ H+++
Sbjct: 391 QKMGERFHFFALLPHQRL 408


>gi|331249458|ref|XP_003337346.1| hypothetical protein PGTG_19045 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309316336|gb|EFP92927.1| hypothetical protein PGTG_19045 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 438

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 123/377 (32%), Positives = 195/377 (51%), Gaps = 33/377 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYS------TCNPFGAVGDFVTAPEISQI 58
           L++ I   I  +G ++V  +  LC+  P  GYYS        +PFG  GDF+T+PEISQ+
Sbjct: 57  LLKIINQQILASGPISVPVWMKLCLHHPTLGYYSRTDRSNQADPFGKQGDFITSPEISQV 116

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGE++AI+ I  W+  G P   R++ELGPGRG +M DI+R    +K       SI+ +E 
Sbjct: 117 FGELIAIWFISRWQAAGCPRRTRIIELGPGRGTLMADIIRTFKSIKAFDDVDFSIHFIEN 176

Query: 119 SERLTLIQKKQLASYG----DKINWYTSLADVPL---GFTFLVANEFFDSLPIKQFVMTE 171
           S  +  +Q ++L+++     + ++W+  +  V      +T ++A+EFFD+LP+  F  T 
Sbjct: 177 SPFMRALQDQKLSTFDGLKKENVSWFDRIDQVGKENDQWTMVIAHEFFDALPVHIFQKTP 236

Query: 172 HGIRERMIDIDQHD------SLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDRE 221
            G RE MIDI+  D      SL F +      ++ +  S+      + A  E SP  ++ 
Sbjct: 237 RGFREVMIDINNADMSPTEKSLRFALSPGPTLASQMLISEEHQKLPVDAKLEVSPSANQI 296

Query: 222 MQSISDRLACD-GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQR 280
              IS  L  D GGT ++IDYG  +     +L+    H  V PL  PG  D++++VDF  
Sbjct: 297 AGQISQLLNSDAGGTGLIIDYG-AEHHFSHSLRGFYQHQIVDPLSRPGLTDITANVDFAS 355

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKS 340
           L   ++   +   G  TQ +FL  +GI  R   L + ++   +  DS +RL+S       
Sbjct: 356 LKR-SMSPNVLTYGPITQRQFLLSMGIEVRTKRLNQSSS---LTEDSSQRLISPFG---- 407

Query: 341 MGELFKILVVSHEKVEL 357
           MG+ +K L   H   +L
Sbjct: 408 MGDQYKFLGFEHPPSQL 424


>gi|58264370|ref|XP_569341.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134110145|ref|XP_776283.1| hypothetical protein CNBC6720 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258955|gb|EAL21636.1| hypothetical protein CNBC6720 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57225573|gb|AAW42034.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 449

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 199/391 (50%), Gaps = 41/391 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N+L + I + IK  G ++  +Y   C++ P  GYYS  + FG  GDF+T+PEISQIFGE+
Sbjct: 53  NELAKVIRDSIKSTGPISASRYMQFCLSHPVHGYYSKGDVFGQKGDFITSPEISQIFGEL 112

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           +AI+ +  W +   P+ VR++ELGPGRG +M D+LR +        S+ S+++VE SE +
Sbjct: 113 VAIWFLTRWMEVDSPTRVRIIELGPGRGTLMDDVLRTLFNFPGIAASINSVHLVENSEAM 172

Query: 123 TLIQKKQLASYGD----KINWYTSLADVPLG---FTFLVANEFFDSLPIKQFVMTEHGIR 175
             +Q + L         K+NWYTS+ ++P     FT  VA+EFFD++PI  F  T+ G R
Sbjct: 173 REVQSQTLTPRIKGKDVKLNWYTSIEEIPETKDEFTLFVAHEFFDAMPINVFEKTDMGWR 232

Query: 176 ERMIDIDQHDSLVFNIGDHEIKSNF---LTCSDYFLGAIFENSPCRDREMQS-------- 224
           E +ID D   S   N+      S     L+ S   L  I  ++  R  ++ S        
Sbjct: 233 EVLIDRDP--SYTPNLPTSSTPSGLRFTLSPSPTTLSTILPSTSPRFAKLPSGSRIEVSQ 290

Query: 225 ----ISDRLACD-----GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSH 275
               I  RL        GG  +V+DYG  ++    + +A + H  V    +PG  DL+++
Sbjct: 291 DSYKIMHRLGQVVNQGLGGCGLVVDYGADKA-FASSFRAFRKHEIVDVFEDPGNCDLTAN 349

Query: 276 VDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLVS 333
           VDF  L   ++       G  +Q +FL  LG+  R   L+      R++ +    KRL+ 
Sbjct: 350 VDFAYLRE-SLTGTATPLGPISQAQFLISLGLQPRLRKLLDTAPPERREAIEKGAKRLI- 407

Query: 334 TSADKKSMGELFKIL-VVSHE---KVELMPF 360
              D   MG  ++++ VVS E   K  + PF
Sbjct: 408 ---DVLGMGSQYQVMGVVSGEPEMKEGIYPF 435


>gi|194902098|ref|XP_001980588.1| GG18000 [Drosophila erecta]
 gi|190652291|gb|EDV49546.1| GG18000 [Drosophila erecta]
          Length = 437

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 118/375 (31%), Positives = 189/375 (50%), Gaps = 36/375 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 52  LGKQLRAKILATGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVG 111

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+L+  W + G PS  + VELGPGRG +  D+L+V+ K K D  +  S++MVE S  L+ 
Sbjct: 112 IWLVSEWRKMGSPSPFQFVELGPGRGTLARDVLKVLTKFKQD--AEFSMHMVEVSPFLSK 169

Query: 125 IQKK-------------QLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
            Q +             QL  Y       G K  W+  L DVP GF+ ++A+EFFD+LP+
Sbjct: 170 AQAQRFCYSHNALPEDAQLPHYQEGTTASGTKAFWHRRLQDVPQGFSLVLAHEFFDALPV 229

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC------R 218
            +  + +   +E +ID+   D        + +  +    S  +     E   C       
Sbjct: 230 HKLQLVDGKWQEVLIDVASSDGAQEAGFRYVLSRSQTPVSSLYRPMPGETRSCLEHSLET 289

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
           +R++  +++R+  DGG A+++DYG+   +  DT +A K H    PL+ PG ADL++ VDF
Sbjct: 290 ERQVGLLAERIERDGGIALIMDYGHFGEK-SDTFRAFKQHKLHDPLLEPGSADLTADVDF 348

Query: 279 QRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTS 335
           + +  IA     ++  G   QG FL+ +    R   L+       ++I+    + L    
Sbjct: 349 KLVRHIAETRGNIHCCGPVEQGLFLQRMQGEARLEQLLAHALPENQEIIRSGYEMLT--- 405

Query: 336 ADKKSMGELFKILVV 350
            D   MG  FK L +
Sbjct: 406 -DPAQMGSRFKFLAM 419


>gi|296482565|gb|DAA24680.1| protein midA homolog, mitochondrial [Bos taurus]
          Length = 441

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 124/379 (32%), Positives = 193/379 (50%), Gaps = 34/379 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQ+FGE+L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMKEVLTNPAKGYYMNRDMLGEEGDFITSPEISQMFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPG+G ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWIAAGKNAAFQLVELGPGKGTLLGDILRVFSQLGSLLKNCDISLHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  ++WY  L DVP  ++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPLERNAESPVYMKGVTKSGIPVSWYRDLQDVPKEYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T HG RE ++DID    D L F +      +     +D     + E  P     
Sbjct: 223 VHKFQKTPHGWREVLVDIDPQVSDKLRFVLAPCATPAEAFIQNDETRDHV-EVCPEAGVV 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R++  GG A++ DYG+  ++  DT +   GH     L  PG ADL++ VDF  L
Sbjct: 282 IQELSQRISLTGGAALIADYGHDGTKT-DTFRGFCGHRLHDVLTAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADK 338
             ++   K+   G   Q  FL  +GI  R   L+ +T   + +  LL     L+    + 
Sbjct: 341 RRMS-QGKVASLGPVEQQTFLRNMGIDVRLKILLDKTDDPSLRQQLLQGYNMLM----NP 395

Query: 339 KSMGELFKIL-VVSHEKVE 356
             MGE F  L +V H+++ 
Sbjct: 396 MKMGERFNFLALVPHQRLH 414


>gi|26354925|dbj|BAC41089.1| unnamed protein product [Mus musculus]
 gi|82568951|gb|AAI08351.1| 2410091C18Rik protein [Mus musculus]
          Length = 383

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 168/326 (51%), Gaps = 26/326 (7%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 38  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGELLG 97

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFS-VLSIYMVETSERLT 123
           ++ +  W   G     +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 98  VWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQKLS 157

Query: 124 LIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ   LA                      G  I+WY  L DVP G++  +A+EFFD LP
Sbjct: 158 EIQALTLAEEKVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPEGYSLYLAHEFFDVLP 217

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +D+D    D L F +      +      D     + E  P     
Sbjct: 218 VHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHV-EVCPDAGVI 276

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DTL+   GH     L+ PG ADL++ VDF  L
Sbjct: 277 IQELSQRIASTGGAALIADYGHDGTKT-DTLRGFYGHQLHDVLIAPGTADLTADVDFSYL 335

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGI 307
             +A   K+   G   Q  FL+ +GI
Sbjct: 336 HRMA-QGKVASLGPVEQRTFLKNMGI 360


>gi|238650512|ref|YP_002916364.1| hypothetical protein RPR_02415 [Rickettsia peacockii str. Rustic]
 gi|238624610|gb|ACR47316.1| hypothetical protein RPR_02415 [Rickettsia peacockii str. Rustic]
          Length = 406

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 169/318 (53%), Gaps = 12/318 (3%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY         GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLANEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IREWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINKNFIAYQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L      I+  + + D+P   T ++ANEFFD++PIKQ++  +    ER+  +   D  
Sbjct: 125 ANLQDINLPISHQSFVEDIPKKPTIIIANEFFDAIPIKQYIKVKELWYERIFVVQPVDER 184

Query: 188 VF--NIGDHEIKSNFLTCS--DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGY 243
           +    I  ++    +L C+  +   GA+ E S      ++ I+  L    G+ ++IDYGY
Sbjct: 185 IKYDKISVNKQLQEYLLCTHIEAKDGAVLEESYKSIEIIKFIAQHLKRLSGSGLIIDYGY 244

Query: 244 -------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
                   + +   TLQAVK H Y   L N G+ADLS+HVDF  L ++A   K+ +    
Sbjct: 245 DIAPNGRTRYQYNQTLQAVKNHKYCPTLENLGEADLSAHVDFYALKTVAKNSKINVIDTI 304

Query: 297 TQGKFLEGLGIWQRAFSL 314
           +Q  FL   GI  R  +L
Sbjct: 305 SQRDFLIENGILLRKQTL 322


>gi|148706527|gb|EDL38474.1| RIKEN cDNA 2410091C18, isoform CRA_a [Mus musculus]
          Length = 393

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 168/326 (51%), Gaps = 26/326 (7%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 48  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPEISQIFGELLG 107

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFS-VLSIYMVETSERLT 123
           ++ +  W   G     +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 108 VWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQKLS 167

Query: 124 LIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ   LA                      G  I+WY  L DVP G++  +A+EFFD LP
Sbjct: 168 EIQALTLAEEKVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPEGYSLYLAHEFFDVLP 227

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +D+D    D L F +      +      D     + E  P     
Sbjct: 228 VHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHV-EVCPDAGVI 286

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DTL+   GH     L+ PG ADL++ VDF  L
Sbjct: 287 IQELSQRIASTGGAALIADYGHDGTKT-DTLRGFYGHQLHDVLIAPGTADLTADVDFSYL 345

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGI 307
             +A   K+   G   Q  FL+ +GI
Sbjct: 346 HRMA-QGKVASLGPVEQRTFLKNMGI 370


>gi|157827945|ref|YP_001494187.1| hypothetical protein A1G_00455 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932633|ref|YP_001649422.1| hypothetical protein RrIowa_0094 [Rickettsia rickettsii str. Iowa]
 gi|157800426|gb|ABV75679.1| hypothetical protein A1G_00455 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907720|gb|ABY72016.1| hypothetical cytosolic protein [Rickettsia rickettsii str. Iowa]
          Length = 406

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 171/322 (53%), Gaps = 20/322 (6%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY         GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLANEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IREWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINKNFIAYQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRER---MIDIDQ- 183
             L      I+  + + D+P   T ++ANEFFD++PIKQ++  +    ER   M  +D+ 
Sbjct: 125 ANLQDINLPISHQSFVEDIPKKPTIIIANEFFDAIPIKQYIKVKELWYERIFVMQPVDER 184

Query: 184 --HDSLVFNIGDHEIKSNFLTCS--DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
             +D +  N    E    +L C+  +   GAI E S      ++ I+  L    G+ ++I
Sbjct: 185 IKYDKISVNKQLQE----YLLCTHIEAKDGAILEESYKSIEIIKFIAQHLKRLSGSGLII 240

Query: 240 DYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYI 292
           DYGY        + +   TLQAVK H Y   L N G+ADLS+HVDF  L ++A   K+ +
Sbjct: 241 DYGYDIAPNGRTRYQYNQTLQAVKNHKYCPILENLGEADLSAHVDFYALKTVAKNSKINV 300

Query: 293 NGLTTQGKFLEGLGIWQRAFSL 314
               +Q  FL   GI  R  +L
Sbjct: 301 IDTISQRDFLIENGILLRKQTL 322


>gi|195055476|ref|XP_001994645.1| GH14945 [Drosophila grimshawi]
 gi|193892408|gb|EDV91274.1| GH14945 [Drosophila grimshawi]
          Length = 445

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 191/379 (50%), Gaps = 42/379 (11%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   +   G +TV +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE++ 
Sbjct: 58  LTKQLTAKMLATGPITVAEYMREVLTNPQSGYYMHRDVFGREGDFITSPEISQIFGELVG 117

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERL 122
           I+L+  W++ G PS  +LVELGPGRG +  D+L+V+ K K   DF    +++MVE S  L
Sbjct: 118 IWLLAEWQKLGSPSPFQLVELGPGRGTLARDVLKVLTKFKAGADF----TMHMVEISPYL 173

Query: 123 -------------TLIQKKQLASY-------GDKINWYTSLADVPLGFTFLVANEFFDSL 162
                        T+ ++ QL  Y       G +  W+  L DVP GF+ ++A+EFFD+L
Sbjct: 174 SQAQAQRFCYKHETVPEEAQLPHYQVGTTATGVQAFWHRHLEDVPPGFSLVLAHEFFDAL 233

Query: 163 PIKQFVMTEHGIRERMIDIDQHDSLVFNIGD--HEIKSNFLTCSDYFLGAIFENSPC--- 217
           P+ +  +      E +ID+ +         D  + +  +    S  F     E   C   
Sbjct: 234 PVHKLQLVNGQWLEVLIDVPRTQETETKNADFSYVLPKSQTPVSRLFKPVPQETRSCLEY 293

Query: 218 ---RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSS 274
               +R +  ++DRL   GG A+++DYG+L  +  DT +A K H    PL+ PG ADL++
Sbjct: 294 SLETERHVGLLADRLERQGGIALIMDYGHLGDKT-DTFRAFKQHALHEPLLAPGTADLTA 352

Query: 275 HVDFQRLSSIAILY-KLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRL 331
            VDF+ +  +   + +++  G   QG FL  +    R   L+       +DI+    K L
Sbjct: 353 DVDFRHIKHVVETHNQVHCCGPVQQGDFLSRMQGELRLEQLLANALPENQDIIRSGYKML 412

Query: 332 VSTSADKKSMGELFKILVV 350
                D   MG  +K L +
Sbjct: 413 T----DANQMGSRYKFLAM 427


>gi|15891994|ref|NP_359708.1| hypothetical protein RC0071 [Rickettsia conorii str. Malish 7]
 gi|15619108|gb|AAL02609.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 406

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 169/318 (53%), Gaps = 12/318 (3%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY         GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLANEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IREWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINKNFIAYQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L      I+  + + D+P   T ++ANEFFD++PIKQ++  +    ER+  +   D  
Sbjct: 125 ANLQDINLPISHQSFVEDIPKKPTIIIANEFFDAIPIKQYIKVKELWYERIFVVQPVDER 184

Query: 188 VF--NIGDHEIKSNFLTCS--DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGY 243
           +    I  ++    +L C+  +   GA+ E S      ++ I+  L    G+ ++IDYGY
Sbjct: 185 IKYDKISVNKQLQEYLLCTHIEAKDGAVLEESYKSIEIIKFIAQHLKRLSGSGLIIDYGY 244

Query: 244 -------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
                   + +   TLQAVK H Y   L N G+ADLS+HVDF  L ++A   K+ +    
Sbjct: 245 DIAPNGRTRYQYNQTLQAVKNHKYCPILENLGEADLSAHVDFYALKTVAKNSKINVIDTI 304

Query: 297 TQGKFLEGLGIWQRAFSL 314
           +Q  FL   GI  R  +L
Sbjct: 305 SQRDFLIENGILLRKQTL 322


>gi|328867001|gb|EGG15384.1| DUF185 family protein [Dictyostelium fasciculatum]
          Length = 490

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 130/379 (34%), Positives = 186/379 (49%), Gaps = 44/379 (11%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G   VD     C+ +P++GYY   + FG  GDF+TAPEISQ+FGEML I+ +  WE  G 
Sbjct: 111 GPFPVDTLMKECLTNPKYGYYMNRDVFGRGGDFITAPEISQLFGEMLGIWCVATWESMGK 170

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD- 135
           PS +++VE GPGRG +M DILR   K+  DF+  + ++MVE S  L  +QK +L  Y D 
Sbjct: 171 PSKLQIVECGPGRGTLMHDILRS-TKVFKDFYQSIEVHMVEVSTHLKSMQKTRLLYYRDD 229

Query: 136 -------------KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTE-HGIRERMIDI 181
                         I W+ S+  VP G T  +  EF D+LPI  F  T+  G  E M+D 
Sbjct: 230 KPEASQGKSPEGINITWHQSIDTVPNGPTLYIGQEFLDALPINVFQFTKAKGWCEVMVDE 289

Query: 182 DQHDSLVFNIGDHEIK---SNFLTCS----DYFL------GAIFENSPCRDREMQSISDR 228
           D     +   G H ++   SN  T       Y L      G   E         Q I+ R
Sbjct: 290 D-----ISKDGPHHLRFVLSNGPTAMTKAVQYLLPEFGVEGYTVELGVAGLGISQKIALR 344

Query: 229 LACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY 288
           +A   G A+ IDYG     + ++LQA++ H +V  L  PG ADLS+ VDF  +       
Sbjct: 345 IAEHSGAALFIDYGK-DKILNNSLQAIRNHKFVDILDKPGSADLSTWVDFSAIRKCIKHL 403

Query: 289 KLYIN--GLTTQGKFLEGLGI---WQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGE 343
           K  +   G   QG FL+ +G     QR    + + ++ + L  S  +LVS       MG 
Sbjct: 404 KKDVTSVGPVDQGIFLKEMGAEHRLQRLVGKIDEKSKIEELAKSYHKLVSPD----EMGT 459

Query: 344 LFKILVVSHEKVELMPFVN 362
            +K++ +  +K+E + F  
Sbjct: 460 TYKVITILDKKLEPVGFAT 478


>gi|330993030|ref|ZP_08316968.1| Protein midA-like protein [Gluconacetobacter sp. SXCC-1]
 gi|329759800|gb|EGG76306.1| Protein midA-like protein [Gluconacetobacter sp. SXCC-1]
          Length = 350

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 180/344 (52%), Gaps = 29/344 (8%)

Query: 15  KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQH 74
           ++G   +D + A   A     YY+ C+PF    DF+T+PEISQ+FGE+L  ++  AW Q 
Sbjct: 2   RDGAERLDHFMARANA----AYYAGCDPFA---DFITSPEISQMFGELLGAWVAVAWGQL 54

Query: 75  GFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYG 134
           G P    LVE GPGRG +M D LR++ ++ P     + ++++ETS RL  +Q   L   G
Sbjct: 55  GSPDPFMLVEAGPGRGTLMADALRLVRRVAPACHRAVRLHLIETSPRLRGVQAHALEG-G 113

Query: 135 DKIN--WYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
             +   W+ SLA VP G   L+ANEF D+LPI+QF     G  ER +    H + V    
Sbjct: 114 TLLPPCWHDSLATVPDGPMILLANEFLDALPIRQFTRRAGGWEERFV---HHGAFVGAPA 170

Query: 193 D----HEIKSNFLTCSDYFLGAIFEN-SPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
                H  +   +       GA+ E   P  D   Q+++ RL    G A++IDYGY    
Sbjct: 171 SFPATHPARGRAVP-----EGAVLETCQPALD-FTQALAARLRRWSGAALLIDYGYDAPA 224

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
            GD+LQA++       L +PG ADL++HVDF+ ++  A  + + + G   QG+FL  LG+
Sbjct: 225 WGDSLQALRDGRPADLLRDPGTADLTAHVDFRSIAQAA--HGVDVWGSVPQGRFLSALGL 282

Query: 308 WQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
             R   L +    +     + +   +  A  + MG+LF++L ++
Sbjct: 283 AARCARLERAAPDQAA---ATRDAAARLAAPERMGQLFRVLGLA 323


>gi|195998351|ref|XP_002109044.1| hypothetical protein TRIADDRAFT_52674 [Trichoplax adhaerens]
 gi|190589820|gb|EDV29842.1| hypothetical protein TRIADDRAFT_52674 [Trichoplax adhaerens]
          Length = 434

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 194/385 (50%), Gaps = 47/385 (12%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L++ +++ IK +G +++  Y    +  P  GYY + + FG+ GDF T+PE++Q+FGE
Sbjct: 38  KTPLVKDLISQIKADGPISIASYMRQVLTGPMGGYYMSSDVFGSKGDFTTSPEVNQMFGE 97

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ I+L   W Q    S  +++ELGPGRG +  DILR I + + +    LS+++VE S +
Sbjct: 98  LIGIWLYYQWMQTRPKSHAQIIELGPGRGTLSADILRTIKQFR-NLQEGLSLHLVEISPK 156

Query: 122 LTLIQ--------------------------KKQLASYGDKINWYTSLADVPLG-FTFLV 154
           L+ IQ                          K  ++S G  I WY  L DVP   ++ +V
Sbjct: 157 LSKIQEDTICMHDTKTTQSVKELDVKPAGCYKALMSSDGIPIYWYYHLKDVPNNDYSLVV 216

Query: 155 ANEFFDSLPIKQFVMTEHGIRERMIDIDQHDS---LVFNIGDHEIKSNFLTCSDYFLGA- 210
           ANEFFD+LPI QF        E MID+D+ D    L F +         L   D      
Sbjct: 217 ANEFFDALPIHQFRKVNGNWNEVMIDVDEGDGKHHLKFVLAPKPTLQTKLYTQDVMFAKS 276

Query: 211 -----IFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLV 265
                I E SP      + I+DRL   GG A+++DYG   +   DT++A + H  V  L 
Sbjct: 277 SKVKDIMEVSPDSATIYKEIADRLRVHGGCALIVDYGEFGTGT-DTIRAFRKHKQVHVLD 335

Query: 266 NPGQADLSSHVDFQRLS-SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK--QTARKD 322
            PG ADL++ VDF  L  ++    K Y  G   QG+FL  +GI  R   L+K  + +++D
Sbjct: 336 APGSADLTADVDFAFLKYTVENTVKFY--GPIPQGQFLLQMGIQARLKMLIKELEKSQRD 393

Query: 323 ILLDSVKRLVSTSADKKSMGELFKI 347
            LL +   L++ +     MG  FK+
Sbjct: 394 DLLSAYYMLINPN----KMGLRFKV 414


>gi|195453489|ref|XP_002073810.1| GK12946 [Drosophila willistoni]
 gi|194169895|gb|EDW84796.1| GK12946 [Drosophila willistoni]
          Length = 441

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 195/394 (49%), Gaps = 46/394 (11%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           + N+L  KI+      G +TV  Y    + +P+ GYY   + FG  GDF+T+PEISQIFG
Sbjct: 54  LANQLKAKIL----ATGPITVADYMREVLTNPQGGYYMKRDVFGREGDFITSPEISQIFG 109

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ I+L+  W + G PS  + VELGPGRG +  D+L+V+ K K    +  S+++VE S 
Sbjct: 110 ELVGIWLVNEWRKLGSPSPFQFVELGPGRGTLARDVLKVLTKFK--LGAEFSMHLVEISP 167

Query: 121 RLTLIQKK---------------QLASY-------GDKINWYTSLADVPLGFTFLVANEF 158
            L+ +Q +               QL  Y       G K  W+  L DVP GF+ ++A+E+
Sbjct: 168 YLSKLQAQRFCYQHETLTEDAAAQLPHYQVGTTATGSKAFWHKRLEDVPEGFSLVLAHEY 227

Query: 159 FDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC- 217
           FD+LP  +  +      E +ID+++      N   + +  +    S  F     E   C 
Sbjct: 228 FDALPTHKLQLVNGKWHEVLIDVEEKPQNKENEFRYVLSKSQTPVSHVFRPLTEETRSCL 287

Query: 218 -----RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADL 272
                 +R++  ++ RL  +GG ++++DYG+   +  DT +A K H    PL+ PG ADL
Sbjct: 288 EYSLETERQVGLLAQRLEKNGGISLIMDYGHFGEKT-DTFRAFKQHALHDPLLEPGSADL 346

Query: 273 SSHVDFQRLSSIAILY-KLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVK 329
           ++ VDF+ + + A     +Y  G   QG FL+ +    R   L+       ++I+    +
Sbjct: 347 TADVDFKLVKNTAESQGNIYCCGPIEQGDFLKRMQGDVRLEQLLAHALPENQEIIRSGYQ 406

Query: 330 RLVSTSADKKSMGELFKILV----VSHEKVELMP 359
            L     D K MG  FK L     + HE +E  P
Sbjct: 407 MLT----DPKQMGSRFKFLAMFPGILHEHLEKYP 436


>gi|26371288|dbj|BAB27158.2| unnamed protein product [Mus musculus]
          Length = 436

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 189/378 (50%), Gaps = 34/378 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+P+ISQIFGE+L 
Sbjct: 38  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHQDMLGEKGDFITSPDISQIFGELLG 97

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFS-VLSIYMVETSERLT 123
           ++ +  W   G     +LVELGPGRG +  DILRV  +L     +  +SI++VE S++L+
Sbjct: 98  VWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVLKTCAISIHLVEVSQKLS 157

Query: 124 LIQKKQLAS--------------------YGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ   LA                      G  ++WY  L DVP G++  +A+EFFD LP
Sbjct: 158 EIQALTLAEEKVPLERDAESLVYMKGVTKSGIPVSWYRDLKDVPEGYSLYLAHEFFDVLP 217

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +D+D    D L F +      +      D     + E  P     
Sbjct: 218 VHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHV-EVCPDAGVI 276

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DTL+   GH     L+ PG ADL++ VDF  L
Sbjct: 277 IQELSQRIASTGGAALIADYGHDGTKT-DTLRGFYGHQLHDVLIAPGTADLTADVDFSYL 335

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTAR---KDILLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ +      K  LL     L+    + 
Sbjct: 336 RRMA-QGKVASLGPVEQRTFLKNMGIDVRLKVLLDKAGEPSAKQQLLGGYDMLM----NP 390

Query: 339 KSMGELFKIL-VVSHEKV 355
           + MGE F    ++ H+++
Sbjct: 391 QKMGERFHFFALLPHQRL 408


>gi|21064487|gb|AAM29473.1| RE41779p [Drosophila melanogaster]
          Length = 366

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 180/351 (51%), Gaps = 36/351 (10%)

Query: 29  VADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPG 88
           + +P+ GYY   + FG  GDF+T+PEISQIFGE++ I+L+  W + G PS  +LVELGPG
Sbjct: 5   LTNPQAGYYMNRDVFGREGDFITSPEISQIFGELVGIWLVSEWRKMGSPSPFQLVELGPG 64

Query: 89  RGIMMLDILRVICKLKPDFFSVLSIYMVETSERL-------------TLIQKKQLASY-- 133
           RG +  D+L+V+ K K D  +  S++MVE S  L             TL +  QL  Y  
Sbjct: 65  RGTLARDVLKVLTKFKQD--AEFSMHMVEVSPFLSKAQAQRFCYSHQTLPEDAQLPHYQE 122

Query: 134 -----GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
                G K  W+  L DVP GF+ ++A+EFFD+LP+ +  + +   +E +ID+   D   
Sbjct: 123 GTTASGTKAFWHRRLEDVPQGFSLVLAHEFFDALPVHKLQLVDGKWQEVLIDVASSDGAQ 182

Query: 189 FNIGDHEIKSNFLTCSDYFLGAIFENSPC------RDREMQSISDRLACDGGTAIVIDYG 242
                + +  +    S  +     E   C       +R++  +++R+  DGG A+++DYG
Sbjct: 183 EASFRYVLSRSQTPVSSLYRPLPGETRSCLEHSLETERQVGLLAERIERDGGIALIMDYG 242

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA-ILYKLYINGLTTQGKF 301
           +   +  DT +A K H    PLV PG ADL++ VDF+ +  IA     ++  G   QG F
Sbjct: 243 HFGEKT-DTFRAFKQHKLHDPLVEPGSADLTADVDFKLVRHIAETRGNVHCCGPVEQGLF 301

Query: 302 LEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           L+ +    R   L+       ++I+    + L     D   MG  FK L +
Sbjct: 302 LQRMQGEARLEQLLAHALPENQEIIRSGYEMLT----DPAQMGTRFKFLAM 348


>gi|229586282|ref|YP_002844783.1| hypothetical protein RAF_ORF0065 [Rickettsia africae ESF-5]
 gi|228021332|gb|ACP53040.1| Unknown [Rickettsia africae ESF-5]
          Length = 406

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 169/318 (53%), Gaps = 12/318 (3%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY         GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLANEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IREWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINKNFIAYQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L      I+  + + D+P   T ++ANEFFD++PIKQ++  +    ER+  +   D  
Sbjct: 125 ANLQDINLPISHQSFVEDIPKKPTIIIANEFFDAIPIKQYIKVKELWYERIFVVQPVDER 184

Query: 188 VF--NIGDHEIKSNFLTCS--DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGY 243
           +    I  ++    +L C+  +   GA+ E S      ++ I+  L    G+ ++IDYGY
Sbjct: 185 IKYDKISVNKQLQEYLLCTHIEAKDGAVLEESYKSIEIIKFIAQHLKRLSGSGLIIDYGY 244

Query: 244 -------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
                   + +   TLQAVK H Y   L N G+ADLS+HVDF  L ++A   K+ +    
Sbjct: 245 DIAPNGRTRYQYNQTLQAVKNHKYCPILDNLGEADLSAHVDFYALKTVAKNSKINVIDTI 304

Query: 297 TQGKFLEGLGIWQRAFSL 314
           +Q  FL   GI  R  +L
Sbjct: 305 SQRDFLIENGILLRKQTL 322


>gi|281205305|gb|EFA79497.1| DUF185 family protein [Polysphondylium pallidum PN500]
          Length = 502

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 190/378 (50%), Gaps = 45/378 (11%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G   VD     C+ +P++GYY   + FG+ GDF+TAPEISQ+FGEM+ I+ +  WE  G 
Sbjct: 122 GPFPVDTLIKECLTNPKYGYYMNKDVFGSGGDFITAPEISQLFGEMIGIWCVATWESMGM 181

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD- 135
           PS + +VELGPGRG +M DILR   K+  DF+  +S +MVE S  L  +QK +L  + D 
Sbjct: 182 PSKLNIVELGPGRGTLMHDILRS-TKVFKDFYKAISCHMVEVSPHLRGMQKTKLLYFKDD 240

Query: 136 -------------KINWYTSLADVPLGF-TFLVANEFFDSLPIKQFVMTE-HGIRERMID 180
                        +++WY ++  VP    T  +A EFFD+LPI  F  ++  G  E ++D
Sbjct: 241 KEGATTGKTPEGVQVSWYDNIDQVPNKVPTLYIAQEFFDALPINVFKFSKAKGWCEVLVD 300

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE-------------MQSISD 227
            D     +   G + ++    +       AI    P    E              Q I+ 
Sbjct: 301 ED-----ISKDGPYHLRFVMSSGPTLMTNAIQYLLPEFGVEDFTVELGVAGLGIAQKIAL 355

Query: 228 RLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAIL 287
           R+  + G A++IDYG    +V  +LQA++ H +V  L  PG ADLSS VDF  +      
Sbjct: 356 RIQENSGAALIIDYGQ-DKQVQTSLQAIRNHEFVDILDKPGSADLSSWVDFSSIRKCVKH 414

Query: 288 YKLYIN--GLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVK---RLVSTSADKKSMG 342
            K  ++  G   QG FL+ +GI  R   + K+   +  + D VK   +LVS       MG
Sbjct: 415 LKKNVSAIGPVDQGIFLKEMGIEHRIERIAKKITDESKVEDLVKSYHKLVSPD----EMG 470

Query: 343 ELFKILVVSHEKVELMPF 360
             +K++ +  +K+  + F
Sbjct: 471 STYKVITIIDKKLTPIGF 488


>gi|170099455|ref|XP_001880946.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644471|gb|EDR08721.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 441

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 132/418 (31%), Positives = 202/418 (48%), Gaps = 80/418 (19%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP----FGAVGDFVTAPEISQI 58
           +K+ + I++ IK  G +    Y  LC++ P  GYY   NP    FG  GDF+T+PEISQ+
Sbjct: 10  SKVEKIILDGIKATGPIPFSTYMQLCLSHPTHGYY--MNPSHPVFGTRGDFITSPEISQV 67

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGE++ ++L+  WE  G P+ VRLVELGPGRG +M D+LRVI ++ P   S+ ++++VET
Sbjct: 68  FGELVGVWLLSQWENAGRPAAVRLVELGPGRGTLMDDVLRVISRIIPGNSSI-NVHLVET 126

Query: 119 SERLTLIQKKQLASYGDK----INWYTSLADVPLG---FTFLVANEFFDSLPIKQFVMTE 171
           S  +  +Q+ +L S   +    I+W+ S++D+P     +T   A+EFFD+LPI     TE
Sbjct: 127 SSSMRSLQEAKLCSSSRQAKFDIHWHHSVSDIPPSVSEYTMFFAHEFFDALPIHTLQKTE 186

Query: 172 HGIRERMIDIDQHDSLVFNIGDHEIKSNFLTC---------------------------- 203
            G  E +ID +   +   +      K N L                              
Sbjct: 187 TGWHEVLIDANPDYNATGDCQTDVEKPNVLKTTTNSNSRLRRVLSRSPSATSTLLGQSSP 246

Query: 204 --SDYFLGAIFENSPCRDREMQSISDRLACD------------GGTAIVIDYG------- 242
             S+  +G+  E SP   R  + + + L  +            GG  ++IDYG       
Sbjct: 247 RFSEIPIGSSIEVSPTSFRTARQVGELLLGNVKNQEDESSRSPGGCGLIIDYGDDHVFGD 306

Query: 243 -YLQSRVGD--------TLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
            +  SR+            +A   H  V     PG  DL+S+VDF  L   A+   + ++
Sbjct: 307 SFRVSRMRKVNLHFFTAAAKAFSNHKLVDVFDQPGDCDLTSNVDFTYLRE-AVEDLVTVH 365

Query: 294 GLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           G   Q  FLE +G+  R  SL+   K  ARK  + D+ +RLVS    K  MG  +K++
Sbjct: 366 GPIPQYMFLEKMGLQLRLDSLVRAAKAEARKTAIRDAAERLVS----KSGMGTEYKVM 419


>gi|299749961|ref|XP_001836447.2| hypothetical protein CC1G_07094 [Coprinopsis cinerea okayama7#130]
 gi|298408676|gb|EAU85400.2| hypothetical protein CC1G_07094 [Coprinopsis cinerea okayama7#130]
          Length = 457

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 191/385 (49%), Gaps = 59/385 (15%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNP--FGAVGDFVTAPEISQIFGEMLAIFLICAWEQ 73
            G ++  +Y  LC++ P  GYY   N   FG  GDF+T+PEISQ+FGE++ ++L+  W  
Sbjct: 61  TGPISFAKYMQLCLSHPTHGYYMNPNNAVFGTSGDFITSPEISQVFGELVGVWLVSQWAD 120

Query: 74  HGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY 133
            G P  +RLVELGPGRG +M DILR++ K  P+  ++  +++VETSE L  +QK +L   
Sbjct: 121 AGTPPAIRLVELGPGRGTLMDDILRIVKKFLPE-KALTGVHLVETSEALRSVQKAKLGEK 179

Query: 134 GDKINWYTSLADVPLG---FTFLVANEFFDSLPIKQFVMTEHGIRERMIDI--------- 181
            D ++++  + ++P     +T LVA+EFFD+LP+     TE G  E MI           
Sbjct: 180 CD-LHFHNGIHEIPRNPSVYTMLVAHEFFDALPVHVVQKTEAGWNEVMIASNDSLSSSES 238

Query: 182 ------DQHDSLVFNI-------GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDR 228
                  Q   ++  +           + ++ L   +  +G+  E SP   R    I   
Sbjct: 239 SPSQPQTQKQGVLRRVLNPLPSPASTLLGNSSLRFRNLPIGSTIEVSPTSFRIAHQIGRL 298

Query: 229 LACD-------------------GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQ 269
           L+                     GG  +VIDYG   +  GD+ +A K H  V     PG+
Sbjct: 299 LSARGLEEKPLDLVEASQQETGVGGCGLVIDYGADHA-FGDSFRAFKEHKIVDVFHRPGE 357

Query: 270 ADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA---RKDILLD 326
            D++++VDF  L     +     +G  TQ  FLE + +  R  +L++  +   RK ++LD
Sbjct: 358 CDITANVDFAYLKEAMTVEP---HGPITQADFLERMALQTRVEALVRNASSEERKKVILD 414

Query: 327 SVKRLVSTSADKKSMGELFKILVVS 351
           +  RLV    D+  MG  +K+L ++
Sbjct: 415 AANRLV----DRSGMGTQYKVLGIT 435


>gi|166225925|sp|Q2KHV5|MIDA_BOVIN RecName: Full=Protein midA homolog, mitochondrial; Flags: Precursor
          Length = 441

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 125/388 (32%), Positives = 194/388 (50%), Gaps = 52/388 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQ+FGE+L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMKEVLTNPAKGYYMNRDMLGEEGDFITSPEISQMFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPG+G ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWIAAGKNAAFQLVELGPGKGTLLGDILRVFSQLGSLLKNCDISLHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  ++WY  L DVP  ++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPLERNAESPVYMKGVTKSGIPVSWYRDLQDVPKEYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDR- 220
           + +F  T HG RE ++DID    D L F +      +          GA  +N   RD  
Sbjct: 223 VHKFQKTPHGWREVLVDIDPQVSDKLRFVLAPCATPA----------GAFIQNDETRDHV 272

Query: 221 --------EMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADL 272
                    +Q +S R++  GG A++ DYG+  ++  DT +   G+     L  PG ADL
Sbjct: 273 EVCPEAGVVIQELSQRISLTGGAALIADYGHDGTKT-DTFRGFCGYRLHDVLTAPGTADL 331

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVK 329
           ++ VDF  L  ++   K+   G   Q  FL  +GI  R   L+ +T   + +  LL    
Sbjct: 332 TADVDFSYLRRMS-QGKVASLGPVEQQTFLRNMGIDVRLKILLDKTDDPSLRQQLLQGYN 390

Query: 330 RLVSTSADKKSMGELFKIL-VVSHEKVE 356
            L+    +   MGE F  L +V H+++ 
Sbjct: 391 MLM----NPMKMGERFNFLALVPHQRLH 414


>gi|126304576|ref|XP_001366666.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 513

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 190/378 (50%), Gaps = 34/378 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R +   IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 119 MLRHLTYKIKATGPITVAEYMKEVLTNPVKGYYVHQDMIGERGDFITSPEISQIFGELLG 178

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  S  +LVELGPGRG +  DILRV  +L     +  +S+++VE S++L+
Sbjct: 179 IWYISEWMASGKSSTFQLVELGPGRGTLTGDILRVFSQLGSVLKNCDISVHLVEVSQKLS 238

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I WY SL DVP G++F +A+EFFD+LP
Sbjct: 239 EIQALTLADETVTLEHNAESPVYMKGITKSGIPIYWYRSLQDVPQGYSFYLAHEFFDALP 298

Query: 164 IKQFVMTEHGIRERMIDIDQHDS--LVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T+ G RE  ID+D  DS  L F +      +      D     + E  P     
Sbjct: 299 VHKFQKTQQGWREVFIDVDPQDSDKLRFVLAPSATPAETFIQPDEKRDHV-EVCPDAGVI 357

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S  +  +GG A++ DYG+  ++  DT +   GH     L+ PG ADL++ VDF  L
Sbjct: 358 IQILSKCIEENGGAALIADYGHDGTKT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSYL 416

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTSADK 338
             +    K+   G   Q  FL+ +GI  R   L+     T  +  L+     L+    + 
Sbjct: 417 RRMT-QGKVASLGPIQQCSFLKNMGIDVRLKVLLDNSSDTTTRKQLIHGYDMLM----NP 471

Query: 339 KSMGELFKIL-VVSHEKV 355
           K MGE F    ++ H+++
Sbjct: 472 KKMGERFNFFALLPHQRL 489


>gi|67458526|ref|YP_246150.1| hypothetical protein RF_0134 [Rickettsia felis URRWXCal2]
 gi|67004059|gb|AAY60985.1| Uncharacterized conserved protein [Rickettsia felis URRWXCal2]
          Length = 407

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/321 (34%), Positives = 169/321 (52%), Gaps = 18/321 (5%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI   I++NG +T D      +      YY       + GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQSIEQNGYITCDVLMQEVLQSNPTSYYKQVKSLASEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IKEWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINQNFIAHQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
             L      I+  + + D+P   T ++ANEFFD++PIKQ++  +    ER+  +      
Sbjct: 125 ANLQDINLPISHRSFVEDIPKKPTIIIANEFFDAMPIKQYIKVKELWYERIFVVQPVDGR 184

Query: 183 -QHDSLVFNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            ++D +  N    E +    +   D   GA+ E S      ++ I+  L    G+ ++ID
Sbjct: 185 IKYDKISVNKQLQEYLLRTHIEAKD---GAVLEESYTSIEIIKFIAQHLKKLSGSCLIID 241

Query: 241 YGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY        + +   TLQAVK H Y   L N G+ADLS+HVDF  L ++A   K+ + 
Sbjct: 242 YGYDLAPGNRTRYQYNPTLQAVKNHKYCPILENLGEADLSAHVDFYTLKTVAKNSKINVI 301

Query: 294 GLTTQGKFLEGLGIWQRAFSL 314
              +Q  FL   GI  R  +L
Sbjct: 302 DTISQRDFLIENGILLRKQTL 322


>gi|198428937|ref|XP_002122246.1| PREDICTED: similar to CG17726 CG17726-PA isoform 1 [Ciona
           intestinalis]
 gi|198428939|ref|XP_002122317.1| PREDICTED: similar to CG17726 CG17726-PA isoform 2 [Ciona
           intestinalis]
          Length = 418

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 197/387 (50%), Gaps = 36/387 (9%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N ++    + IK  G ++V ++    + +P+ GYY   +  G  GDFVT+PE++QIFGE+
Sbjct: 30  NPVLEYFHSKIKATGPISVAEFMKETLTNPQSGYYMNRDMLGNDGDFVTSPELNQIFGEI 89

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY-MVETSER 121
           +AI+ I  W   G P+ +++VELGPGRG +  DILR   +L          Y  VE S  
Sbjct: 90  IAIWFINEWNALGSPAELQIVELGPGRGTLAEDILRTFHQLGHVLKDTKLWYSFVEVSPT 149

Query: 122 LTLIQKKQL--------------------ASYGDKINWYTSLADVPLG-FTFLVANEFFD 160
           L+ IQ ++L                    +++G  + WY SL DVP G  T  VA+EFFD
Sbjct: 150 LSKIQHERLLDSTSSKTSNGEEKWYLSGKSTHGVNLQWYKSLQDVPNGKVTIFVAHEFFD 209

Query: 161 SLPIKQFVMTEHGIRERMIDIDQHDSLV----FNIGDHEIKSNFLTCSDYFLGAIFENSP 216
           +LP+ +FV ++ G +E  +DI   D+ +      +    I S  L   D     I E SP
Sbjct: 210 ALPVHKFVNSDKGWQEVYVDICPDDAAMKLRYVVLPKPTIASRTLIKKDENRNQI-EVSP 268

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                +Q ++ R+  D G A+++DYG+  ++  DTL+A K H         G+ADL++ V
Sbjct: 269 QSGIIVQEMAQRIVADKGAALIVDYGHYGTK-QDTLRAFKSHQLCEVFSTVGEADLTADV 327

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSA 336
           DF+ L      Y +   G   Q  FL  +GI  R   L++ T   D+     ++L+ +  
Sbjct: 328 DFKYLKQSIEDYNVTTMGPIPQHVFLRNMGIDTRLMMLLRSTTDDDVR----RKLIGSYE 383

Query: 337 ---DKKSMGELFKIL-VVSHEKVELMP 359
              + K MGE F+   ++S +++E +P
Sbjct: 384 MIMNPKQMGERFQFFSLLSKQRLEEVP 410


>gi|157964110|ref|YP_001498934.1| hypothetical protein RMA_0077 [Rickettsia massiliae MTU5]
 gi|157843886|gb|ABV84387.1| hypothetical protein RMA_0077 [Rickettsia massiliae MTU5]
          Length = 418

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 170/326 (52%), Gaps = 28/326 (8%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY       + GDFVTAPEISQ+FGE++ ++ 
Sbjct: 18  KIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLASEGDFVTAPEISQLFGEIIGLWC 77

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 78  IREWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIALIEINKNFIAHQK 136

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L      I+  + + D+P   T ++ANEFFD++PIKQ++  +    ER+         
Sbjct: 137 ANLQDINLPISHQSFVEDIPQKPTIIIANEFFDAIPIKQYIKVKELWYERI--------F 188

Query: 188 VFNIGDHEIKSNFLTCS----DYFL--------GAIFENSPCRDREMQSISDRLACDGGT 235
           V    D  IK + ++ +    +Y L        GA+ E S      ++ I+  L    G+
Sbjct: 189 VVQPVDERIKYDKISINKQLQEYLLRTHIEAKDGAVLEESYKSIEIIKFIAQHLKRLSGS 248

Query: 236 AIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY 288
            ++IDYGY        + +   TLQAVK H Y   L N G+ADLS+HVDF  L ++A   
Sbjct: 249 GLIIDYGYDIAPNGRTRYQYNQTLQAVKNHKYCPILENLGEADLSAHVDFYTLKTVAKNS 308

Query: 289 KLYINGLTTQGKFLEGLGIWQRAFSL 314
           K+ +    +Q  FL   GI  R  +L
Sbjct: 309 KINVIDTISQRDFLIENGILLRKQTL 334


>gi|34580971|ref|ZP_00142451.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262356|gb|EAA25860.1| unknown [Rickettsia sibirica 246]
          Length = 406

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 169/326 (51%), Gaps = 28/326 (8%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY         GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIDQNGYITCDVLMQEVLNLNPTSYYKQVKSLANEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+LR   KL P+F+  LSI ++E ++     QK
Sbjct: 66  IREWQRIGCPKSLSLVELGPGRGLLMRDLLRT-AKLVPEFYKALSIELIEINKNFIAYQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
             L      I+  + + D+P   T ++ANEFFD++PIKQ++  +    ER+         
Sbjct: 125 ANLQDINLPISHQSFVEDIPKKPTIIIANEFFDAIPIKQYIKVKELWYERI--------F 176

Query: 188 VFNIGDHEIKSNFLTCS----DYFL--------GAIFENSPCRDREMQSISDRLACDGGT 235
           V    D  IK + ++ +    +Y L        GA+ E S      ++ I+  L    G+
Sbjct: 177 VVQPVDERIKYDKISVNKQLQEYLLRTHIEAKDGAVLEESYKSIEIIKFIAQHLKRLSGS 236

Query: 236 AIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY 288
            ++IDYGY        + +   TLQAVK H Y   L N G+ADLS+HVDF  L ++A   
Sbjct: 237 GLIIDYGYDIAPNGRTRYQYNQTLQAVKNHKYCPILENLGEADLSAHVDFYALKTVAKNS 296

Query: 289 KLYINGLTTQGKFLEGLGIWQRAFSL 314
           K+ +    +Q  FL   GI  R  +L
Sbjct: 297 KINVIDTISQRDFLIENGILLRKQTL 322


>gi|239946947|ref|ZP_04698700.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921223|gb|EER21247.1| succinate dehydrogenase iron-sulfur subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 406

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 167/321 (52%), Gaps = 18/321 (5%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           KI  LI +NG +T D      +      YY       + GDFVTAPEISQ+FGE++ ++ 
Sbjct: 6   KIRQLIDQNGYITCDVLMQQVLQSNPNSYYKQVKSLASEGDFVTAPEISQLFGEIIGLWC 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
           I  W++ G P  + LVELGPGRG++M D+L    KL P+F+  LSI ++E ++   + QK
Sbjct: 66  IKEWQRIGCPKSLSLVELGPGRGLLMRDLLST-AKLVPEFYKALSIELIEINQNFIVHQK 124

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
             L      I   + + D+P   T ++ANEFFD++PIKQ+V  +    ER+  +      
Sbjct: 125 ANLQDIDLPIKHLSFIEDIPKKPTIIIANEFFDAMPIKQYVKVKELWYERIFVVQPVDGR 184

Query: 183 -QHDSLVFNIGDHE-IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            ++D +  N    E +    +   D   GA+ E S      ++ I++ L    G+ + ID
Sbjct: 185 IKYDKISINKPLQEYLLRTHIEAKD---GAVLEESYKSIEIIKFIAEHLKTQSGSCLTID 241

Query: 241 YGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY        + +   TLQAVK H Y   L N G+ADLS+HVDF  L  +A   K+ + 
Sbjct: 242 YGYDIAPNGRTRYQYNPTLQAVKNHKYCPILENLGEADLSAHVDFYTLKIVAKNSKINVI 301

Query: 294 GLTTQGKFLEGLGIWQRAFSL 314
              +Q  FL   GI  R  +L
Sbjct: 302 DTISQRDFLIENGILLRKQTL 322


>gi|328770714|gb|EGF80755.1| hypothetical protein BATDEDRAFT_11090 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 408

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 199/386 (51%), Gaps = 58/386 (15%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQH- 74
           NG ++  Q+    +  P  GYY     FG  GDF+T+PEI+Q+FGE++AI+ +  W+ + 
Sbjct: 2   NGPISTAQFMRQALIHPLGGYYMKGKVFGPHGDFITSPEINQMFGELMAIWFMNHWQTYQ 61

Query: 75  GFPSCV-----RLVELGPGRGIMMLDILRVICKLKPDFFSVL-SIYMVETSERLTLIQKK 128
             PS        ++ELGPGRG +M D+L  + +LK    + L ++++VE S  L   Q +
Sbjct: 62  SIPSTAPQKPFNIIELGPGRGTLMADMLTTLTQLKTSTINPLNAVHLVEASPELRKTQAQ 121

Query: 129 QL-----------------------ASYGDKINWYTSLADVPLGFT---FLVANEFFDSL 162
            L                        S G K+ W+ +   +P+  T   F++A+EFFD++
Sbjct: 122 MLNCTMDPLENSTYRPGDGTTVTGTTSQGVKVYWHDTFDCIPVDETVASFIIAHEFFDAM 181

Query: 163 PIKQFVMTEHGIRERMIDIDQHDSLVFNI----GDHEIKSNFL----TCSDYF----LGA 210
           P+ +F  TE G RE M+D+D+  +L +N          K++      T +D F    +G 
Sbjct: 182 PVYKFQKTEQGWREIMVDLDETPTLPYNFRFICAPSATKASVALMQPTVTDRFANVQIGE 241

Query: 211 IFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQA 270
             E +P      ++I++R+A DGG A+ +DYG     + D+L+ ++ H  V PL  PG  
Sbjct: 242 RIELAPDVVGVSKAIAERVANDGGIALFVDYGR-DHVIDDSLRGIRNHKIVHPLSMPGDC 300

Query: 271 DLSSHVDFQRLSSIAILYKLYIN--GLTTQGKFLEGLGIWQRAFSLMK---QTARKDILL 325
           DLS+ VDF   S+I    K   N  G   QG FLE +GI  RA +L++       K  ++
Sbjct: 301 DLSADVDF---SAIQHAVKGIANAYGPVPQGLFLEKMGIGARAMALIQGATDNKTKAAVV 357

Query: 326 DSVKRLVSTSADKKSMGELFKILVVS 351
            + +RLV    D  +MG+ +KI+ ++
Sbjct: 358 AAYERLV----DPDAMGQAYKIMAIT 379


>gi|307189530|gb|EFN73907.1| UPF0511 protein C2orf56-like protein, mitochondrial [Camponotus
           floridanus]
          Length = 421

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 191/386 (49%), Gaps = 60/386 (15%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L R++   I   G +T+ +Y    +  P  GYY+T +  G  GDF T+PEISQ+FGE++A
Sbjct: 31  LYRQLYAKILACGPITLAEYMKEILTHPTVGYYTTKDTIGQRGDFTTSPEISQLFGEIIA 90

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           +++I  W +    S ++LVELGPGRG ++ DILRV  KL  +    +S+++VE S  L++
Sbjct: 91  VWIINEWRKITKES-IQLVELGPGRGTLISDILRVFKKL--NVLDKISVHLVEVSPVLSM 147

Query: 125 IQKKQL--------------------------ASYGDKINWYTSLADVPLGFTFLVANEF 158
           IQ K+L                             G KI WY S+ DVP  F+  +A EF
Sbjct: 148 IQAKKLCIESKNSELKVNENQKNSVTHYREGVTKDGVKIYWYYSINDVPREFSIFIAQEF 207

Query: 159 FDSLPIKQFVMTEHGIRERMIDIDQ---HDSLVFNIGDHEIKSNFLTCSDYFLGAIFENS 215
           FD+LPI +F  T+ G RE ++DI Q    +   + +      +    C  Y        S
Sbjct: 208 FDALPIHKFQKTDKGWREILVDIIQEVKQEKFRYVLSQMPTAA----CKVYL-------S 256

Query: 216 PCRDREMQSISDRLA------------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSP 263
           P   RE   +S + +            C GG A+VIDYG+ +    DT +A   H    P
Sbjct: 257 PNEKREHVEVSPQCSIIIDYMSQFLWEC-GGFALVIDYGH-EGEKTDTFRAFYQHKLHDP 314

Query: 264 LVNPGQADLSSHVDFQRLSSIAIL-YKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKD 322
           L+NPG ADL++ VDF  +  IA    +L   G  TQ KFL+ LGI  R   +++     +
Sbjct: 315 LLNPGTADLTADVDFSLMKEIAEKDNRLITFGPVTQRKFLKSLGIDLRLKMILQNAT--N 372

Query: 323 ILLDSVKRLVSTSADKKSMGELFKIL 348
           +    ++       D+  MG  F++L
Sbjct: 373 VQKQQIESGYHMITDEDKMGNCFQVL 398


>gi|261490670|ref|NP_001094519.2| protein midA homolog, mitochondrial [Bos taurus]
          Length = 441

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/378 (32%), Positives = 193/378 (51%), Gaps = 34/378 (8%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQ+FGE+L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMKEVLTNPAKGYYMNRDMLGEEGDFITSPEISQMFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPG+G ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWIAAGKNAAFQLVELGPGKGTLLGDILRVFSQLGSLLKNCDISLHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  ++WY  L DVP  ++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPLERNAESPVYMKGVTKSGIPVSWYRDLQDVPKEYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T HG RE ++DID    D L F +      +     +D     + E  P     
Sbjct: 223 VHKFQKTPHGWREVLVDIDPQVSDKLRFVLAPCATPAEAFIQNDETRDHV-EVCPEAGVV 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R++  GG A++ DYG+  ++  DT +   G+     L  PG ADL++ VDF  L
Sbjct: 282 IQELSQRISLTGGAALIADYGHDGTKT-DTFRGFCGYRLHDVLTAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADK 338
             ++   K+   G   Q  FL  +GI  R   L+ +T   + +  LL     L+    + 
Sbjct: 341 RRMS-QGKVASLGPVEQQTFLRNMGIDVRLKILLDKTDDPSLRQQLLQGYNMLM----NP 395

Query: 339 KSMGELFKIL-VVSHEKV 355
             MGE F  L +V H+++
Sbjct: 396 MKMGERFNFLALVPHQRL 413


>gi|158293643|ref|XP_315000.4| AGAP004909-PA [Anopheles gambiae str. PEST]
 gi|157016546|gb|EAA10494.4| AGAP004909-PA [Anopheles gambiae str. PEST]
          Length = 467

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 136/386 (35%), Positives = 191/386 (49%), Gaps = 62/386 (16%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGAVGDFVTAPEISQIFGEMLAIFLICAW 71
           I+  G MTV  Y    + +P  GYYST  N FG  GDF+TAPEI QIFGE++AI+ I   
Sbjct: 74  IRATGPMTVATYMREVLLNPAAGYYSTKENVFGTTGDFITAPEIGQIFGELVAIWCINEL 133

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICK--LKPDFFSVLSIYMVETSERLTLIQKKQ 129
           ++  +   ++L+ELGPG+G +M D+LRV  +  L  D    +S+++VE S  L  +Q  +
Sbjct: 134 QKFNYDGHIQLIELGPGKGTLMHDVLRVFERFGLSKD---RVSVHLVEMSSNLQRLQADK 190

Query: 130 L---------------------ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFV 168
           L                     AS G  I WYT + +VP GF+ ++ANEFFD+LP+  F 
Sbjct: 191 LCNGMAHRTPADQSEPHVQEGTASSGINIRWYTDVVEVPKGFSIILANEFFDALPVHVFC 250

Query: 169 --MTEHGI--RERMIDID---QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFE--NSPCRD 219
              +E G   +E ++DI+   +  S  F      I+SN  T      G  F+   S  RD
Sbjct: 251 KEASEGGASWKEMLVDINPELKEPSFRF------IQSNRATPYSVVFGKRFDGKESLLRD 304

Query: 220 RE-----------MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPG 268
           R             Q I+ R+   GG  ++IDYG+   +  DTL++ K H    PL +PG
Sbjct: 305 RNRVEVSFETEQIAQDIARRIDGHGGFGLIIDYGHEGDKT-DTLRSFKSHQLHDPLQDPG 363

Query: 269 QADLSSHVDFQRLSSIAILYKLYIN-GLTTQGKFLEGLGIWQRAFSLM---KQTARKDIL 324
            ADL+  VDF  L          I  G  +QG FLE +    R  SL+   K    + +L
Sbjct: 364 SADLTVDVDFGFLKHFLEQDDKAITLGPVSQGTFLEAMEGSARLKSLLSAAKDEKYRKML 423

Query: 325 LDSVKRLVSTSADKKSMGELFKILVV 350
            D    L + S     MGE FK+L V
Sbjct: 424 SDGYDELTNPS----KMGERFKLLSV 445


>gi|148554151|ref|YP_001261733.1| hypothetical protein Swit_1230 [Sphingomonas wittichii RW1]
 gi|148499341|gb|ABQ67595.1| protein of unknown function DUF185 [Sphingomonas wittichii RW1]
          Length = 351

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 117/355 (32%), Positives = 180/355 (50%), Gaps = 23/355 (6%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEML 63
           +L   +V +I+ NG + V  Y           YY+  +PFG  GDF+T+PEISQ+FGE++
Sbjct: 6   ELADALVRVIQANGPIPVADYMEAANGL----YYAAHDPFGVKGDFITSPEISQMFGELI 61

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            I++   W +         VELGPGRG +  D LR +  L+        ++ VETS  L 
Sbjct: 62  GIWIADLWTRSRALGAY-YVELGPGRGTLAADALRAMGALR----RHPEVHFVETSPVLR 116

Query: 124 LIQKKQLASYGDKINWYTSLADVPLGFTFL-VANEFFDSLPIKQFVMTEHGIRERMI--D 180
            +QK+++    D + W+  +  +P     + VANEFFD+LP +Q++ T  G RER++  D
Sbjct: 117 RLQKERVP---DAV-WHEGIETLPTDAPLIIVANEFFDALPYRQYIKTYSGWRERVVTHD 172

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
            D    +  +    ++    L   D   G+I+E SP      ++++ R+   GG  + ID
Sbjct: 173 ADGFRPVPGDAPAEDVVPEHL--HDAVAGSIYETSPAGLAVARALAARIVKQGGALLAID 230

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG+     GDTLQA+  H Y     NPG  D+++HVDF  L     L    I G  +Q  
Sbjct: 231 YGHENYAAGDTLQALNAHAYADVFSNPGANDITAHVDFTALGEAGRLGGARIEGPVSQSY 290

Query: 301 FLEGLGIWQRAFSLMKQTA-RKDILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
           FL  LGI  RA +L +    R + +  +  RL S    ++ MG LF+ + +   K
Sbjct: 291 FLATLGIAARAAALSRHHPDRTEEIGAAYHRLTS----EEEMGTLFRAIAMVSPK 341


>gi|308502085|ref|XP_003113227.1| hypothetical protein CRE_25213 [Caenorhabditis remanei]
 gi|308265528|gb|EFP09481.1| hypothetical protein CRE_25213 [Caenorhabditis remanei]
          Length = 430

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 174/344 (50%), Gaps = 38/344 (11%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP----FGAVGDFVTAPEISQI 58
           N L + I + IK +G +TV +Y    V+ P  GYY   +     FG  GDF+T+PE+SQ+
Sbjct: 63  NHLKKFIADKIKTSGPITVAEYMKTSVSAPLVGYYGQFSDDQKVFGEKGDFITSPELSQL 122

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGEM+ +++       G     +LVELGPGR  +M D+L  + K        +S+++VET
Sbjct: 123 FGEMIGVWVFHELANTGHKGSWQLVELGPGRAQLMNDVLNALSKFHD---KDVSVHLVET 179

Query: 119 SERLTLIQKKQLASY------------------GDKINWYTSLADVPLGFTFLVANEFFD 160
           S+ L   Q+K L  Y                  G  + WY ++ D+P GFT  +ANEF D
Sbjct: 180 SDALIDEQEKALCIYKSNNTEDTPHVRKNKSRTGVNVYWYKAIDDIPDGFTVFIANEFLD 239

Query: 161 SLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAI--------F 212
           +LP+ QF  T     E  I++ + D+L F     + K   L        AI        +
Sbjct: 240 ALPVHQFQKTGDTWNEIYINLTKDDNLCF----MKSKGENLNTKGLIPTAIRSDSKRVTW 295

Query: 213 ENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADL 272
           E SP     +  I DR+   GG +++IDYG+  +R   + +A K H  V PL NPG  DL
Sbjct: 296 ECSPESGTVVNQIVDRITTFGGFSLLIDYGHDGTRNTHSFRAYKNHKQVDPLANPGMVDL 355

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
           ++ VDF  LSS+ +  ++ + G   Q +FL  LGI  R   L++
Sbjct: 356 TADVDFGYLSSL-VKDRVLVYGAKEQREFLAQLGIEHRLRRLLQ 398


>gi|147904192|ref|NP_001085543.1| protein midA homolog, mitochondrial precursor [Xenopus laevis]
 gi|82184559|sp|Q6GQ37|MIDA_XENLA RecName: Full=Protein midA homolog, mitochondrial; Flags: Precursor
 gi|49118763|gb|AAH72911.1| MGC80371 protein [Xenopus laevis]
          Length = 437

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 195/386 (50%), Gaps = 43/386 (11%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           N L+  ++  IK  G +TV +Y    + +P  GYY   +  G  GDFVT+PEISQIFGE+
Sbjct: 44  NALLNHLIFKIKSTGPITVSEYMREVLTNPVKGYYMHNDMLGEHGDFVTSPEISQIFGEL 103

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSER 121
           L ++ I  W   G P  ++LVELGPGRG +  D+LRV         S  +S+++VE S +
Sbjct: 104 LGVWCISEWVSAGKPKAIQLVELGPGRGTLTDDLLRVFSNFGRLLDSCDISVHLVEVSPK 163

Query: 122 LTLIQKKQL--------------------ASYGDKINWYTSLADVPLGFTFLVANEFFDS 161
           L+ IQ ++L                       G  + WY  + DVP G++F +A+EFFD+
Sbjct: 164 LSDIQAQRLTGKSIEVELDSNSPVYKNGITKTGRPVCWYQDIQDVPNGYSFYIAHEFFDA 223

Query: 162 LPIKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLG-----AIFEN 214
           LPI +    + G RE +IDID    D L F +G     SN    +  F+         E 
Sbjct: 224 LPIHKLQKIKDGWREMLIDIDPKLPDKLRFVLG-----SNMSLVAKTFVQDDEPRDHVEV 278

Query: 215 SPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSS 274
            P     +Q ++ ++   GG A++ DYG++  +  DT +  + H     L +PG ADL++
Sbjct: 279 CPSAAVIIQKLAQQINSYGGAALIADYGHMGEKT-DTFRGFRAHQLHDVLTDPGTADLTA 337

Query: 275 HVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLV-- 332
            VDF  +  + +       G  TQ  FL+ +GI  R   L++++   D+ +   K+L+  
Sbjct: 338 DVDFNFMRRM-VGEAASCLGPVTQHVFLKNMGIDIRLKVLLEKS--NDVTVQ--KQLIHG 392

Query: 333 -STSADKKSMGELFKIL-VVSHEKVE 356
            +   +   MG+ FK   VV H +++
Sbjct: 393 YNVLMNPDQMGQRFKFFSVVPHSRLK 418


>gi|307195477|gb|EFN77363.1| UPF0511 protein CG17726 [Harpegnathos saltator]
          Length = 419

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 133/396 (33%), Positives = 190/396 (47%), Gaps = 60/396 (15%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L R++   I   G +T+ +Y    +  P  GYY T + FG  GDF T+PEISQ+FGE++A
Sbjct: 18  LYRQLYAKILACGPITLAEYMKEILIHPTAGYYMTRDVFGQKGDFTTSPEISQLFGEIIA 77

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I++I  W +      V+LVELGPGRG ++ DILRV  KL  +    +S+++VE S  L+ 
Sbjct: 78  IWIINEWRKIT-NGPVQLVELGPGRGTLINDILRVFKKL--NLLDKVSVHLVEISPVLSQ 134

Query: 125 IQKKQLASY---------------------------GDKINWYTSLADVPLGFTFLVANE 157
           +Q ++L +                            G K+ WY S+ DVP  F+  VA+E
Sbjct: 135 LQAEKLCTESRNNESIADANEKSSVTYYKEGIAKNGGVKMYWYYSINDVPRNFSIFVAHE 194

Query: 158 FFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC 217
           FFD+LPI +F  T+ G RE ++DI Q  +        E +  ++              P 
Sbjct: 195 FFDALPIHKFQKTDKGWREVLVDIVQETN--------EERFRYVLSQTVTAACKVYLPPN 246

Query: 218 RDRE-----------MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVN 266
             R+           M  +S  L   GG A+VIDYG+ + +  DT +A   H    PL+ 
Sbjct: 247 EKRDHVEISPQCLVIMDYMSQFLWECGGFALVIDYGHEREK-SDTFRAFYQHKLHDPLLR 305

Query: 267 PGQADLSSHVDFQRLSSIAILYKLYIN-GLTTQGKFLEGLGIWQRAFSLMKQTARKDILL 325
           PG ADL++ VDF  +  IA      I  G  TQ +FL  LGI  R   L++ T    I  
Sbjct: 306 PGTADLTADVDFLLMKEIAQKNNRLITFGPVTQRRFLRNLGIDLRLKILLQNTT--SIQK 363

Query: 326 DSVKRLVSTSADKKSMGELFKILVVSHEKVELMPFV 361
             ++       DK  MG  FK+L        L PFV
Sbjct: 364 QQIESGYHMITDKDKMGNCFKVLT-------LFPFV 392


>gi|193211224|ref|NP_499246.2| hypothetical protein ZK1128.1 [Caenorhabditis elegans]
 gi|166231760|sp|Q09644|MIDA_CAEEL RecName: Full=Protein midA homolog, mitochondrial
 gi|154147255|emb|CAA87427.3| C. elegans protein ZK1128.1, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 426

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 193/385 (50%), Gaps = 39/385 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP----FGAVGDFVTAPEISQI 58
           N L + +V+ I+ +G +TV +Y   CV+ P  GYY   +     FGA GDF+T+PE++Q+
Sbjct: 33  NHLKKFLVDKIRVSGPITVAEYMKTCVSAPLVGYYGQFSKDQKVFGAKGDFITSPELTQL 92

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGEM+ +++       G     +LVELGPGR  +M D+L  + K        +S+++VET
Sbjct: 93  FGEMIGVWVFHELANTGHKGSWQLVELGPGRAQLMNDVLNALAKFND---KDVSVHLVET 149

Query: 119 SERLTLIQKKQLASYGDK------------------INWYTSLADVPLGFTFLVANEFFD 160
           S+ L   Q+K L  Y  K                  I WY S+ D+P GFT  + NEF D
Sbjct: 150 SDALIDEQEKSLCIYTSKNSIDTPFIRKNKTRTGVNIYWYKSIDDIPDGFTVFIGNEFLD 209

Query: 161 SLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHE-IKSNFLTCS---DYFLGAIFENSP 216
           +LPI QF  +     E  +++ +   L F     E + +  L  S   D      +E SP
Sbjct: 210 ALPIHQFHKSGDSWNEVYVNLTKDGDLCFMKSKGENLHTKGLIPSAIRDDSSRVTWECSP 269

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                +  I DR+   GG ++++DYG+  SR   + +A K H  V  L NPG ADL++ V
Sbjct: 270 ESGTVVNQIVDRITTFGGFSLLVDYGHDGSRNTHSFRAYKNHKQVDTLENPGLADLTADV 329

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVS 333
           DF  LS++ +  ++ I G   Q +FL  LGI  R   L+   K   +++ L++S   L+ 
Sbjct: 330 DFGYLSTL-VKDRVVIYGPNEQREFLAQLGIEHRLRRLLQVCKDRKQQEQLIESYNMLMG 388

Query: 334 TSADKKSMGELFKILVVSHEKVELM 358
                  MG  FK   +  + +E +
Sbjct: 389 ------DMGLKFKAWALFPKTLEFI 407


>gi|320169715|gb|EFW46614.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 471

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 120/377 (31%), Positives = 184/377 (48%), Gaps = 51/377 (13%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G+++  ++    +  P  GYY   + FGA GDF T+PEIS +FGEM+  +L+  W+    
Sbjct: 77  GKVSTAEFMRTVLTAPSGGYYMRTDVFGAGGDFTTSPEISPLFGEMIGAWLLNHWQVSNS 136

Query: 77  PSCVRLVELGPGRGIMMLDILRVI-CKLKPDFFSVLSIYMVETSERLTLIQKKQLA---- 131
           P  V L+E GPGRG +M D+LR I  + K      + ++ VE S  L  +Q + L     
Sbjct: 137 PKKVNLIEFGPGRGTLMHDVLRKIFARFK--AVDAVHVHFVEKSPALLRVQAEMLGVPLG 194

Query: 132 --------------SYGDKINWYTSLADVP-LGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
                          +G ++ W+ S+  VP   F+ ++A+EFFD+LP   F  TE G RE
Sbjct: 195 ADLVQTEPVHGKSERFGIQVTWHQSVDTVPDDDFSLILAHEFFDALPALSFTRTERGWRE 254

Query: 177 RMIDIDQHDSLVFNI---GDHEIKSNFL------TCSDYFLGAIFENSPCRDREM----- 222
            ++D+D+     F +     H + S  L        S   LG +  + P   R +     
Sbjct: 255 VLVDLDEKGPYPFRLVTANAHTVASRSLLVDPNEAGSSSNLGRV--SPPAHVRSLTLSPD 312

Query: 223 -----QSISDRLACDGGTAIVIDYGYLQSRVGD-TLQAVKGHTYVSPLVNPGQADLSSHV 276
                +++S R+   GG A++IDYGY      + TL+A +GH  V      G +DL+  V
Sbjct: 313 SFILTENLSKRIINRGGAALIIDYGYATPAPKEMTLRAFRGHKEVHLFDKIGMSDLTVDV 372

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVS 333
           DF+ L++ A  +  Y    T QG+FLE LGI QR   L+   +Q      L   V+RL S
Sbjct: 373 DFEYLAAAAQAHGAYCTAATPQGEFLEALGIGQRLARLLGDPRQAEHHQTLKSGVERLTS 432

Query: 334 TSADKKSMGELFKILVV 350
            +     MG+ FK + +
Sbjct: 433 PT----DMGQRFKAMAI 445


>gi|332024460|gb|EGI64658.1| Protein midA-like protein, mitochondrial [Acromyrmex echinatior]
          Length = 410

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 133/389 (34%), Positives = 196/389 (50%), Gaps = 46/389 (11%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L R++   I   G +T+ +Y    +  P  GYY+T + FG  GD+ T+PEISQ+FGE++A
Sbjct: 15  LYRQLYAKILACGPITLAEYMKEILLHPTAGYYTTRDVFGQRGDYTTSPEISQLFGEIIA 74

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFS--VLSIYMVETSERL 122
           I++I  W +    S ++LVELGPGRG ++ DILRV  KL    FS  + S++++E S  L
Sbjct: 75  IWIINEWGKISRDS-IQLVELGPGRGTLINDILRVFKKLN---FSNKIRSVHLIEISPVL 130

Query: 123 TLIQKKQLASYGD--------------------------KINWYTSLADVPLGFTFLVAN 156
           + IQ ++L +                             KI WY S+ DVP  F+  +A 
Sbjct: 131 SAIQAEKLCTKSKSIEPRVNEDQKNSITHYREGVTRDNVKIYWYYSINDVPRKFSVFIAQ 190

Query: 157 EFFDSLPIKQFVMTEHGIRERMIDIDQ---HDSLVFNIGDHEIKSNFLTCSDYFLGAIFE 213
           EFFD+LPI +F  T+ G RE +IDI Q    +   + +      +  +  S +      E
Sbjct: 191 EFFDALPIHKFQKTDKGWREILIDIVQDSKEERFRYVLSQMPTAACKVYLSLHEKRDHVE 250

Query: 214 NSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
            SP     +  +S  L   GG A+VIDYG+ + +  DT +A   H    PL+NPG ADL+
Sbjct: 251 ISPQCSVIIDYMSQFLWEHGGFALVIDYGHEKEKT-DTFRAFCEHKLHDPLLNPGTADLT 309

Query: 274 SHVDFQRLSSIAIL-YKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLV 332
           + VDF  L  IA    +L   G  TQ KFL+ LGI  R   +++  +      + ++   
Sbjct: 310 ADVDFLLLKEIAQKDNRLITFGPVTQRKFLKSLGIDLRLKMILQNASNNQ--KEHIESGY 367

Query: 333 STSADKKSMGELFKILVVSHEKVELMPFV 361
               D+  MG  FK+L        L PFV
Sbjct: 368 HMIIDEDKMGNCFKVL-------SLFPFV 389


>gi|254456091|ref|ZP_05069520.1| ATP synthase beta subunit/transription termination factor rho
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083093|gb|EDZ60519.1| ATP synthase beta subunit/transription termination factor rho
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 324

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 111/318 (34%), Positives = 171/318 (53%), Gaps = 17/318 (5%)

Query: 41  NPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVI 100
           NPFG  GDF+TAP I+++F EM+AI+++  W+  G P    L ELG G G MM  I+  +
Sbjct: 4   NPFGKEGDFITAPNITRLFSEMIAIWIVTFWKSIGSPKKFNLFELGAGNGEMMKVIVETL 63

Query: 101 CKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFD 160
               P+ F     Y+ E S+ LT  Q+  L+S  + I W  ++  +    T  +ANEFFD
Sbjct: 64  KNF-PECFENCKFYIHEKSKLLTKQQQSNLSS--ENIEWVDNIKKINSNPTIFLANEFFD 120

Query: 161 SLPIKQFVMTEHGIRERMIDIDQHDSLVF-----NIGDHEIKSNFLTCSDYFLGAIFENS 215
           +LPIKQF   + G  ER ++  +    VF     NI + E K  F    D     I E S
Sbjct: 121 ALPIKQFFKKKEGWFERYVNFKEIKKAVFKDQIINIEEIEKKLKFKISKD---QDIIEYS 177

Query: 216 PCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSH 275
           P     +Q+I + +  + G  ++IDYGYL S++ +TLQAVK H Y   L + G +D++ +
Sbjct: 178 PSSFNYLQNICEIININNGGMLIIDYGYLDSKMHETLQAVKNHKYSDILKDIGNSDITYN 237

Query: 276 VDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVS 333
           ++F         +    + ++ Q KFL  +GI QRA  + +    ++K  L   V+RL+ 
Sbjct: 238 INFNLFKQFIDQFDDLNSIISNQKKFLTSMGILQRAEIISENIPFSKKTDLFYRVRRLI- 296

Query: 334 TSADKKSMGELFKILVVS 351
              D+K MG LFK++++ 
Sbjct: 297 ---DEKQMGNLFKVMLIK 311


>gi|126138720|ref|XP_001385883.1| hypothetical protein PICST_68115 [Scheffersomyces stipitis CBS
           6054]
 gi|126093161|gb|ABN67854.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 515

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 122/408 (29%), Positives = 196/408 (48%), Gaps = 67/408 (16%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQIFGE 61
           N L       IK  G +++  Y   C+  P+FGYY+T +P     GDF+T+PEIS +FGE
Sbjct: 101 NNLTDLFTQTIKTTGPISLSAYMRQCLTHPDFGYYTTRDPLDHRSGDFITSPEISSVFGE 160

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICK--LKPDFFSVLSIYMVETS 119
           M+ I+L   W+   FP  +R++E GPG+G +M D+L    K   K      + I ++E S
Sbjct: 161 MIGIWLYTVWQNQNFPGKIRIIEFGPGKGTLMHDVLNTFNKFVFKSRKAVKIEINLIEAS 220

Query: 120 ERLTLIQKKQLAS------------------YGDKINWYTSLADV---PLGFTFLVANEF 158
           + L   Q K L                    + + I W  +  D+   P    +++A+EF
Sbjct: 221 KVLRQEQWKLLCGEKNEFQTDNEGFNLSKTIWSNDIKWLDTEKDIIQDPDVANYVLAHEF 280

Query: 159 FDSLPIKQFVMTEHGIRERMID----------------IDQHDSLV-----FNIGDHEIK 197
           FD+LPIK F  TEHG RE +++                ID+ DSL+       +   E  
Sbjct: 281 FDALPIKGFERTEHGWRELLVEHTESVVNTQPKLPGTSIDEDDSLLNTEFHLTLSKKETP 340

Query: 198 SNFLTC-----SDYFLGAIFENSPCRDREM------QSISDRLACDGGTAIVIDYGYLQS 246
           S+ +        D  +G+  E   C + E+      Q +++      G  +VIDYG +  
Sbjct: 341 SSIIPTLHRRFKDLPVGSRIE--ICSEAELYIMKMAQLVNNEKKL--GAVLVIDYGLVNQ 396

Query: 247 RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLG 306
              ++L+ +  H +VSP + PG  DLS  VDF  L ++   +   + G   QG +L  +G
Sbjct: 397 IPENSLRGIYQHKFVSPFIKPGDVDLSVDVDFDNLVNLTSTH-CSVFGPIDQGDWLHNIG 455

Query: 307 IWQRAFSLMKQT----ARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           +  R   L+KQ      +++ + +S +RL  T  D+KSMG+++K L +
Sbjct: 456 VGYRVDQLIKQNDHDHEKQEKIYNSYRRL--TDKDEKSMGKIYKFLCL 501


>gi|66811954|ref|XP_640156.1| DUF185 family protein [Dictyostelium discoideum AX4]
 gi|74854952|sp|Q54S83|MIDA_DICDI RecName: Full=Protein midA, mitochondrial; AltName:
           Full=Mitochondrial dysfunction gene A; Flags: Precursor
 gi|60468157|gb|EAL66167.1| DUF185 family protein [Dictyostelium discoideum AX4]
          Length = 484

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 190/387 (49%), Gaps = 47/387 (12%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
           ++ K  G M++D +    + +P++GYY   + FG  GDF+TAPE+SQ+FGEM+ I+ +  
Sbjct: 95  DITKVRGPMSIDTFIKEVLTNPKYGYYMNKDVFGKGGDFITAPEVSQLFGEMIGIWCVAT 154

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL 130
           WE  G P  +++VE+GPGRG +M DILR   K+  +F+  +S+++VE S      QK+ L
Sbjct: 155 WEAMGKPKKLQIVEMGPGRGTLMKDILRS-TKVFKEFYDSISVHLVEASPANKKTQKQNL 213

Query: 131 ASYGDK-----------------INWYTSLADVPLGF-TFLVANEFFDSLPIK--QFVMT 170
             + DK                 + W   L +VP    T  +A EFFD+LPI   +F   
Sbjct: 214 LYFKDKAINFDHKTIGETPNGIKVTWVGKLEEVPTDIPTLFLAQEFFDALPIHVFRFSRE 273

Query: 171 EHGIRERMIDID--QHDSLVFNIGDHEIKSNFLTCSDYFL------GAIFENSPCRDREM 222
           ++   E ++D D  +H          +  +   T   + L      G   E         
Sbjct: 274 KNDWCEVLVDEDITEHGEYYLRFVQSKGPTLMTTAVKHLLPEFGLDGYQVELGLAGLAIS 333

Query: 223 QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
           Q I++R+   GG A++IDYGY    V  +LQA++ H +V  L  PG ADLS  VDFQ + 
Sbjct: 334 QQIANRIDKSGGAALIIDYGY-DKIVKSSLQAIRDHEFVDILDKPGTADLSVWVDFQTIR 392

Query: 283 SIAILYKLYIN--GLTTQGKFLEGLGIWQRAFSLMKQTARK-------DILLDSVKRLVS 333
               L K      G   QG FL+ +GI  R    + Q  RK       + L+   K+LV 
Sbjct: 393 KTVKLLKNKSTAIGPVDQGIFLKEMGIEHR----LAQIGRKLDSNEKFEELVMGYKKLV- 447

Query: 334 TSADKKSMGELFKILVVSHEKVELMPF 360
              D K MG  +K++ +  + +  + F
Sbjct: 448 ---DPKEMGTNYKVITICDKNITPIGF 471


>gi|195389881|ref|XP_002053602.1| GJ23258 [Drosophila virilis]
 gi|194151688|gb|EDW67122.1| GJ23258 [Drosophila virilis]
          Length = 444

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 190/380 (50%), Gaps = 38/380 (10%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L R++   +   G +TV +Y    + +P+ GYY   + FG  GDFVT+PEISQIFGE
Sbjct: 54  KTTLTRQLTAKMLATGPITVAEYMREVLTNPQGGYYMNRDVFGREGDFVTSPEISQIFGE 113

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++ ++L+  W++ G PS  +LVELGPGRG +  D+L+V+ K K    +  +++MVE S  
Sbjct: 114 LVGVWLMNEWQKLGSPSPFQLVELGPGRGTLARDVLKVLSKFKTG--AQFTMHMVEISPF 171

Query: 122 LTLIQKK-------------QLASY-------GDKINWYTSLADVPLGFTFLVANEFFDS 161
           L+  Q +             QL  Y       G +  W+  L DVP GF+ ++A+EFFD+
Sbjct: 172 LSKAQAQRFCYKHETVPDEAQLPYYQIGTTASGTQAYWHHRLEDVPPGFSLVLAHEFFDA 231

Query: 162 LPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHE-IKSNFLTCSDYFLGAI-------FE 213
           LP+ +  +     +E +ID+ Q  S      D   + S   T        +        E
Sbjct: 232 LPVHKLRLVNDQWQEVLIDVAQAQSTGSKSADFRYVVSKAQTPVSRLFKPVPQETRNYLE 291

Query: 214 NSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
            S   +R +  +++RL   GG A+++DYG+   +  DT +  K H    PL+ PG ADL+
Sbjct: 292 YSLEAERHVGILAERLEQHGGIALIMDYGHFGDK-KDTFRGFKQHALHDPLLAPGTADLT 350

Query: 274 SHVDFQRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKR 330
           + VDF+ +  +A     ++  G   QG FL+ +    R   L+       ++I+    + 
Sbjct: 351 ADVDFRLIKHVAETRGHIHCCGPVQQGDFLKRMQGEVRLEQLLAHALPENQNIIRSGYEM 410

Query: 331 LVSTSADKKSMGELFKILVV 350
           L     + K MG  FK L +
Sbjct: 411 LT----NPKQMGSRFKFLAM 426


>gi|269958880|ref|YP_003328669.1| hypothetical protein ACIS_00816 [Anaplasma centrale str. Israel]
 gi|269848711|gb|ACZ49355.1| hypothetical protein ACIS_00816 [Anaplasma centrale str. Israel]
          Length = 342

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 181/343 (52%), Gaps = 28/343 (8%)

Query: 19  MTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPS 78
           +T+D++  L +   + GYY T  PFG  GDF+T+ EISQ+FGE++A++++   E  G   
Sbjct: 16  VTMDRFMDLALYHEKHGYYMTRVPFGRAGDFITSAEISQLFGEVVALWILSYLESAGISE 75

Query: 79  CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK-- 136
              L+ELGPGRG +M D+LRV  +  P + ++L ++++E S  L   Q+  L S+  +  
Sbjct: 76  KFSLLELGPGRGTLMCDVLRVFERF-PKYDALLEVHLLEISPLLRNTQRATLESFSARKE 134

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEI 196
           I W+  L ++P   T +VANEFFD+LP+KQFV    G+ +         +L     D E 
Sbjct: 135 IFWHDKLEELPERPTVVVANEFFDALPVKQFVYAGSGMWKECCVYSDIGNLSVVALDTEY 194

Query: 197 KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVK 256
             N    +D   G I E        ++ +   +  +GG A + DYGYLQ     T+Q+VK
Sbjct: 195 SLN--EYNDVPEGGIIERCEAAKDVLECLEGIIVRNGGAAAIFDYGYLQPPYRSTIQSVK 252

Query: 257 GHTYVSPLVNPGQADLSSHVDF-------QRLSSIAILYKLYINGLTTQGKFLEGLGIWQ 309
           GH     L N G+ D+++HVDF       +RL+S  +          TQ +FL   GI +
Sbjct: 253 GHHRCDFLYNVGECDITAHVDFGFLQGHVRRLNSRVV----------TQREFLYQFGIRE 302

Query: 310 RAFSLM-KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           R   L    T R+   L S    ++     ++MG LFK+L++S
Sbjct: 303 RLAHLACNATERQKRELKSAFLRLT-----ENMGTLFKVLLLS 340


>gi|221109290|ref|XP_002159876.1| PREDICTED: similar to CG17726 CG17726-PA, partial [Hydra
           magnipapillata]
          Length = 700

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 128/385 (33%), Positives = 191/385 (49%), Gaps = 49/385 (12%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G MTV  Y    + +P++GYY   + FGA GDF T+PEISQ+FGE++ I+ +  W Q G 
Sbjct: 320 GPMTVANYMKEALTNPKWGYYMKNDVFGAKGDFTTSPEISQMFGELIGIWFVAQWIQIGK 379

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL------ 130
           P  V+LVELGPGRG +M DILRV+ K  P+  S   +  VE SE++  +QK+ L      
Sbjct: 380 PCGVQLVELGPGRGTLMADILRVM-KQFPETLSNFEVNFVEVSEKMISLQKQNLDISHEK 438

Query: 131 -----ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTE-------HGIR--- 175
                   G K++W+T + DVP G TF +A+EFFD+LP+  F + +         IR   
Sbjct: 439 KDFYITPSGTKVSWFTHVQDVPKGLTFYLAHEFFDALPVHLFKLLDLVLSPGLTNIRNVN 498

Query: 176 -------ERMIDIDQHDSLVFNIGDHEIKSNFLTC-SDYFLGAIFENSPCRDRE------ 221
                  + M+D  +    +      E +   +T      +   F NS     E      
Sbjct: 499 PFAQIPPDTMMDFGKFCLFIIGYCQSENELQLVTAPGPSPVAKTFLNSETNADECEVCPE 558

Query: 222 ----MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLV-NPGQADLSSHV 276
               M  IS+ ++  GG A++IDYG   S+   +L+  K H  V  +  NPG  D++++V
Sbjct: 559 AAVVMSYISENISMYGGCAMIIDYGESDSQRF-SLRGYKNHVLVDNIFKNPGSCDITANV 617

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI--LLDSVKRLVST 334
           DF  L    I  ++   G  TQ  FL  +GI QR   L+     +    L+ S+  L+S 
Sbjct: 618 DFGFLKR-CIRGEVRHYGPITQRSFLLQMGIQQRLKVLVSTATSEQARNLISSLDYLISP 676

Query: 335 SADKKSMGELFKILVVSHEKVELMP 359
               + MGE FK  V+++    + P
Sbjct: 677 ----EKMGEKFKCFVLTNLSSPVPP 697


>gi|302811396|ref|XP_002987387.1| hypothetical protein SELMODRAFT_126162 [Selaginella moellendorffii]
 gi|300144793|gb|EFJ11474.1| hypothetical protein SELMODRAFT_126162 [Selaginella moellendorffii]
          Length = 392

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 126/382 (32%), Positives = 189/382 (49%), Gaps = 57/382 (14%)

Query: 29  VADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPG 88
           + +P  GYY     FGA G F+T+P++SQ+FGEM+ I+ +  WE+ G P  ++LVELGPG
Sbjct: 5   LTNPSAGYYLHQEVFGAAGSFITSPDVSQMFGEMIGIWSVSLWEKMGKPRKLQLVELGPG 64

Query: 89  RGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK------------ 136
           RG +M D+LR     K DF   LSI+ VE S  L   Q++ L   G++            
Sbjct: 65  RGTLMQDLLRSTLTFK-DFSKALSIHFVECSPALRKQQRRALQCPGEEKKHEGGDRPAVE 123

Query: 137 ----------INWYTSLADVPLGF-TFLVANEFFDSLPIKQF-----VMTEHGIRERMID 180
                     ++WY  L DVP G  T ++A EFFD+LPI QF       T  G  E++ID
Sbjct: 124 NSRSQRFETNVSWYLDLKDVPRGVPTIIIAQEFFDALPIHQFQHRLSQKTPVGWCEKLID 183

Query: 181 ID--QHDSLVFNIGDHEIKSNFLTCSDY--FLGAIFENS-------PCRDREMQSISDRL 229
           +D  Q +   F +      +  L       ++ A+ E S       P   +  Q I+ R+
Sbjct: 184 VDSRQANPFRFVLSSQPTAATLLYLKKRLNWITAVEEESIHHIEVCPKALQVSQEIAKRV 243

Query: 230 ACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF---QRLSSIAI 286
           A D G  I+IDYG  +  V D+ QA++ H +V+ L  PG ADLS+HVDF   +R+ +   
Sbjct: 244 AEDSGGGIIIDYGKDEP-VTDSFQAIRNHEFVNVLDKPGTADLSAHVDFAAIKRMVAETA 302

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADK------ 338
              +   G   Q +FL  LGI  R  +L+K  +  + + L     RLV            
Sbjct: 303 SPTVSTYGPIFQQEFLAMLGINVRLEALVKDASDEQGEKLQLGYWRLVGEGPPPWLSEGD 362

Query: 339 -----KSMGELFKILVVSHEKV 355
                + MG+ +++L ++  K+
Sbjct: 363 DGYKIQGMGKHYRVLAIADSKL 384


>gi|258576949|ref|XP_002542656.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237902922|gb|EEP77323.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 486

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 133/433 (30%), Positives = 202/433 (46%), Gaps = 85/433 (19%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNP----FGAVGDFVTAPEISQ 57
             L + I   I   G +++  Y   C+  PE GYY S  +P    FG  GDF+T+PEISQ
Sbjct: 41  TPLAKTIAEAINTTGPISIAAYMRQCLTSPEGGYYTSRGSPGAEVFGRRGDFITSPEISQ 100

Query: 58  IFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
           +FGE+L ++ +  W   G  S  V+L+E+GPGRG +M D+LR +   K    S+ +IY+V
Sbjct: 101 MFGELLGVWTVTEWMAQGRRSRGVQLIEVGPGRGTLMADMLRSVRNFKSFASSIEAIYLV 160

Query: 117 ETSERLTLIQKKQL----------ASY-------GDKINWYTSLADVPLGFT---FLVAN 156
           E S  L  IQK+ L          A Y       G  + W   +  +P G T   F++A+
Sbjct: 161 EASPTLRAIQKQMLCGDAPMEEIEAGYKSTSKHLGVPVIWAEHIRSLPQGDTDVPFIIAH 220

Query: 157 EFFDSLPIKQF----------VMTEHGI--------------RERMIDIDQ------HDS 186
           EFFD+LPI  F          ++T  G               RE ++ ++        + 
Sbjct: 221 EFFDALPIHAFQSVASPPSDTIVTPTGPTKLRQPLASSPTQWRELVVSVNPAAEAHAENR 280

Query: 187 LVFNIG-----------DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLA--CDG 233
           L F +              E+   +        G+  E SP     +Q  + R+    DG
Sbjct: 281 LEFRLSLAKSTTPAAMVMPEMSERYKALKST-RGSTIEISPESHAYVQEFARRIGGKADG 339

Query: 234 --------GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
                   G A+++DYG   S   ++L+ +K H  VSP  +PGQ DLS+ VDF  L+  A
Sbjct: 340 RSPGRKPAGAALILDYGPSHSIPVNSLRGIKDHQLVSPFTSPGQVDLSADVDFVGLAEAA 399

Query: 286 ILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADKKS 340
           I     + ++G T QG FL+ LGI +RA  LMK+    +++  +    KRLV        
Sbjct: 400 IKASPGVEVHGPTEQGSFLQSLGIMERAAQLMKRAEDESKRKSIETGWKRLVERGGG--G 457

Query: 341 MGELFKILVVSHE 353
           MG+++K + +  E
Sbjct: 458 MGKIYKAMAIVPE 470


>gi|88607733|ref|YP_505157.1| hypothetical protein APH_0566 [Anaplasma phagocytophilum HZ]
 gi|88598796|gb|ABD44266.1| conserved hypothetical protein [Anaplasma phagocytophilum HZ]
          Length = 326

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 185/345 (53%), Gaps = 31/345 (8%)

Query: 19  MTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPS 78
           M +D++    + D   GYY T  PFG  GDF+T+P+ISQ+FGE +AI+L+   E      
Sbjct: 1   MPIDKFMREALYDRTCGYYMTHVPFGLSGDFITSPDISQLFGETIAIWLLQYLEYVKLSE 60

Query: 79  CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL--ASYGDK 136
              LVELGPGRG +M DILR++    P + S+  +++VE S  L  IQK+ L  A    K
Sbjct: 61  RCILVELGPGRGTLMSDILRILSCF-PQYDSLFEVHLVEISPLLRNIQKETLKEAMLRKK 119

Query: 137 INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMT-----EHGIRE--RMIDIDQHDSLVF 189
           I W+ S+ D+P   T L+ANEFFD+LPIKQFV       E+ +R     +DI    S  F
Sbjct: 120 IFWHDSVYDLPECTTILIANEFFDALPIKQFVFHDGMWFENYVRSCAEGLDIIPVKSTDF 179

Query: 190 NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVG 249
              D+ +            G + E        +++I   L   GGTA+++DYGY+     
Sbjct: 180 IFPDNNVPD----------GGVIEICEAATDIIRNIEGVLLKHGGTALIVDYGYMHPVYK 229

Query: 250 DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQ 309
            T+QAV+ H Y S L + G++D+S+ VDF  L     L ++    + TQ +FL   GI +
Sbjct: 230 STIQAVRNHQYCSFLDHIGESDISASVDFVMLQK--SLKEIKCEAM-TQREFLYRFGIRE 286

Query: 310 RAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
           R   LM+  Q  + + L     RL       ++MG LFK+L++++
Sbjct: 287 RLEFLMQRAQAKQAEDLKCGFLRLT------ENMGTLFKVLLLNY 325


>gi|156542526|ref|XP_001600721.1| PREDICTED: similar to conserved hypothetical protein [Nasonia
           vitripennis]
          Length = 440

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 196/388 (50%), Gaps = 50/388 (12%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L + +   IK +G ++V  Y    +  P  GYY+T + FG  GDF+T+PE+SQ+FGEM+ 
Sbjct: 52  LSKDLYTRIKLSGPISVANYMKTVLTHPTKGYYTTKDVFGQKGDFITSPEVSQLFGEMIG 111

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK-PDFFSVLSIYMVETSERLT 123
           +++I    +  + S  ++VELGPGRG +  DILRV  +L   D  S  +I  VE S  L 
Sbjct: 112 LWIITECNKIHYKS-FQIVELGPGRGTLTHDILRVFRQLGWTDRIS--AINYVEVSPVLA 168

Query: 124 LIQKKQLAS----------------YG---DKIN--WYTSLADVPLGFTFLVANEFFDSL 162
            IQK+ L S                +G   DKI   WY S+AD+P GFT  +A EFFD+L
Sbjct: 169 KIQKENLCSTVNSEEITAPSNKSYQFGKTKDKIEIYWYKSIADLPEGFTVFIAQEFFDAL 228

Query: 163 PIKQFVMTEHGIRERMIDIDQHDSLV----FNIGDHEIKSNFLTCSDYFLGAIFENSPCR 218
           PI +F  T+ G  E ++D+D +   V    + +   +   + L  SD       E SP  
Sbjct: 229 PIHKFQKTKDGWFEVLVDVDPNSEKVPKFRYVLAKTDACDSILDKSDK--REHVEISPEA 286

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
              M+ IS  +  +GG ++ +DYG+   +  DT +A + H    PL +PG ADL++ VDF
Sbjct: 287 MNIMRYISSAITQNGGFSLFVDYGHNGEKT-DTFRAFRDHKQCDPLKDPGTADLTADVDF 345

Query: 279 QRLSSIAI-LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSAD 337
             L  +A    KL   G   Q +FL+  GI  R  +L K    ++      K+ + +  D
Sbjct: 346 ALLKKVAKESNKLLCYGPLAQREFLKDTGIDIRLMNLCKNATEEE------KQQLQSGYD 399

Query: 338 K----KSMGELFKILVVSHEKVELMPFV 361
           K      MG  FK+       V + P+V
Sbjct: 400 KIMNPNEMGTCFKV-------VSMFPYV 420


>gi|302796294|ref|XP_002979909.1| hypothetical protein SELMODRAFT_111843 [Selaginella moellendorffii]
 gi|300152136|gb|EFJ18779.1| hypothetical protein SELMODRAFT_111843 [Selaginella moellendorffii]
          Length = 392

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 128/382 (33%), Positives = 188/382 (49%), Gaps = 57/382 (14%)

Query: 29  VADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPG 88
           + +P  GYY     FGA G F+T+P++SQ+FGEM+ I+ +  WEQ G P  ++LVELGPG
Sbjct: 5   LTNPSAGYYLHQEVFGAAGSFITSPDVSQMFGEMIGIWSVSLWEQMGKPRKLQLVELGPG 64

Query: 89  RGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA--------SYGDK---- 136
           RG +M D+LR     K DF   LSI+ VE S  L   Q++ L           GD+    
Sbjct: 65  RGTLMQDLLRSTLTFK-DFSKALSIHFVECSPALRKQQRRALQCPSEEKKHEGGDRPAVE 123

Query: 137 ----------INWYTSLADVPLGF-TFLVANEFFDSLPIKQF-----VMTEHGIRERMID 180
                     + WY  L DVP G  T ++A EFFD+LPI QF       T  G  E++ID
Sbjct: 124 NSRSQRFETNVAWYLDLKDVPRGVPTIIIAQEFFDALPIHQFQHRLSQKTPVGWCEKLID 183

Query: 181 ID--QHDSLVFNIGDHEIKSNFLTCSDY--FLGAIFENS-------PCRDREMQSISDRL 229
           +D  Q +   F +      +  L       ++ A+ E S       P   +  Q I+ R+
Sbjct: 184 VDSRQANPFRFVLSSQPTAATLLYLKKRLNWITAVEEESIHHIEVCPKALQVSQEIAKRV 243

Query: 230 ACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF---QRLSSIAI 286
           A D G  I+IDYG  +  V D+ QA++ H +V+ L  PG ADLS+HVDF   +R+ +   
Sbjct: 244 AEDSGGGIIIDYGKDEP-VTDSFQAIRNHEFVNVLDKPGTADLSAHVDFAAIKRMVAETA 302

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADK------ 338
              +   G   Q +FL  LGI  R  +L+K  +  + + L     RLV            
Sbjct: 303 SPTVSTYGPIFQQEFLAMLGINVRLEALVKDASDEQGEKLQLGYWRLVGEGPPPWLSEGD 362

Query: 339 -----KSMGELFKILVVSHEKV 355
                + MG+ +++L ++  K+
Sbjct: 363 DGYKIQGMGKHYRVLAIADSKL 384


>gi|255727811|ref|XP_002548831.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240133147|gb|EER32703.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 512

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 186/416 (44%), Gaps = 85/416 (20%)

Query: 7   RKIVNL-------IKKNGQMTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQI 58
           +KI NL       IK  G + +  Y   C+  PEFGYY+T NP     GDF+T+PEIS +
Sbjct: 99  KKINNLTDLFQQTIKLTGPLPLSAYMRQCLTHPEFGYYTTRNPLSLRTGDFITSPEISSV 158

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRV-------ICKLKPDFFSVL 111
           FGEM+ I+    W+Q  +P  +R VE GPG+G ++ D+L+        + K KP     +
Sbjct: 159 FGEMIGIWYFSIWQQQNYPKHIRFVEFGPGKGTLIFDVLKTFNKFVEKLSKEKP----TI 214

Query: 112 SIYMVETSERLTLIQ------------------KKQLASYGDKINWYTSLADVPLG---F 150
            I ++E S+ L   Q                   + +  +G++I+W  +  D+       
Sbjct: 215 EISLIEASKVLRKEQWKLMCDPEQPFETTEEGYNRSVTKWGNEISWLDTEKDIKHDNEIA 274

Query: 151 TFLVANEFFDSLPIKQFVMTEHGIRERMI----------------DIDQHDSLVFN---- 190
            F++A+EFFD+LPIK F+  E G RE M+                +  Q +    N    
Sbjct: 275 NFIIAHEFFDALPIKGFIREEKGWRELMVEHTPSVNNTQLKLESKETPQEEDESLNTEFH 334

Query: 191 --IGDHEIKSNFLT-----CSDYFLGAIFENSPCRDRE---MQSISDRLACDGGTAIVID 240
             I   E  S+ +        D  +G   E   C D E   M+ +      + G  +VID
Sbjct: 335 LTIAPKETPSSMIPQISKRYRDLPVGTRIEI--CPDAELYIMKMVQLLNNSNKGAILVID 392

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN------G 294
           YG       ++L+ +  H +VSP  NPG+ DLS  VDF+ L       KL  N      G
Sbjct: 393 YGTANEIPSNSLRGIHQHKFVSPFWNPGEVDLSIDVDFENL-------KLLTNDIVESFG 445

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            T+QG +L  +GI  R   L+K       + D +        DK  MG ++K L +
Sbjct: 446 PTSQGDWLHNIGIGYRVDQLIKMNNEAPHVQDKIYGAYRRLTDKDQMGNIYKFLAL 501


>gi|145347903|ref|XP_001418399.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578628|gb|ABO96692.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 461

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 153/288 (53%), Gaps = 41/288 (14%)

Query: 16  NGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQH 74
            G + V +Y   C+  PE+GYY    + FG  GDFVT+PEISQ+FGE++ ++    +E  
Sbjct: 107 GGSIPVSEYVRECLTHPEYGYYMRDADVFGKKGDFVTSPEISQVFGELIGVWAALQYEAL 166

Query: 75  GFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL---- 130
           G P  +R+VE GPGRG +M D+LR   K    F   +S++++E S  L   Q K L    
Sbjct: 167 GSPDTLRIVEFGPGRGTLMADLLRGTRKFA-KFRDAVSVHLIEVSPALRKTQAKTLRCGE 225

Query: 131 ---------ASYGDKIN-----WYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
                    A +  +IN     W+  L  VP G T ++ +EFFD+LP++QF  TE G  E
Sbjct: 226 LETTAAEGNARFVSEINDAEVFWHDGLESVPRGPTLVICHEFFDALPVRQFQRTERGWCE 285

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
           ++I ID              K++ L         + E SP       ++ DR+  + G  
Sbjct: 286 KLITIDSE------------KADSLR--------LIELSPPSMTLWDALVDRIEKNSGAV 325

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSI 284
           + IDYG  +  +G+TL+A+K H +V  L +PG+ADLS++VDF  L  I
Sbjct: 326 LAIDYGE-EGPLGNTLEAIKDHKFVHVLDSPGEADLSAYVDFGALRQI 372


>gi|254569706|ref|XP_002491963.1| hypothetical protein [Pichia pastoris GS115]
 gi|238031760|emb|CAY69683.1| Hypothetical protein PAS_chr2-2_0233 [Pichia pastoris GS115]
          Length = 457

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 184/409 (44%), Gaps = 67/409 (16%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVG---DFVTAPEISQIFGEMLAIFLIC 69
           IK  G + V  Y   C+  PEFGYY+T +P   +    DFVT+PEISQ FGEM+ I+   
Sbjct: 47  IKTTGPIPVSSYMKQCLVHPEFGYYTTRDPLSPISETSDFVTSPEISQTFGEMIGIYHYT 106

Query: 70  AWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQ 129
            W   G P  VR +E GPG+G ++ D +R   +L      +  + +VE S  L   Q+K+
Sbjct: 107 TWLLQGKPKEVRFIEFGPGKGTLIFDCIRTFERLSKGTV-LYEVILVEASPILREEQRKK 165

Query: 130 LAS-----------------YGDKINWYTSLADV-PLGFTFLVANEFFDSLPIKQFVMTE 171
           L                    G + +W  +  D+   G  +++A+EFFD+LP++Q+  T+
Sbjct: 166 LCGDTSLNVLEDGTWEAETLAGKRCHWVETELDIKKTGTNYIIAHEFFDALPVQQYEKTK 225

Query: 172 HGIRERMIDIDQHD-------------------------SLVFNIGDHEIKSNFLTCSDY 206
            G RE M+D  + +                         +L FN   H + S   T   Y
Sbjct: 226 DGWREYMVDFSEKNVIRAKTDPLALPNRTTITSKELENPALRFNF--HSVLSPHETPGSY 283

Query: 207 FL--GAIFENSPCRDR-----EMQSISDRLA------CDGGTAIVIDYGYLQSRVGDTLQ 253
                  +E  P   R     E  + S  +A      C  G  ++IDYG   +   +T++
Sbjct: 284 IPKNNPRYEALPVGSRIEICPEAHTYSKHIAALINSGCGAGGCLIIDYGPADTVPINTIR 343

Query: 254 AVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFS 313
            +K H  VSP  +PG  DLS+ VDF +L  I       ++G   QG +L  LG+  R   
Sbjct: 344 GIKNHKIVSPFDDPGNVDLSADVDFGQLKQIFENQSCQVHGPVAQGDWLHELGLGFRTDQ 403

Query: 314 LM---KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           L+   K    K  ++ + KRLV  S     MG ++K L V     ++ P
Sbjct: 404 LVHIAKSENDKQKIIKAYKRLVGKS--HGDMGSIYKFLAVLPNGSQIQP 450


>gi|329851271|ref|ZP_08266028.1| hypothetical protein ABI_41120 [Asticcacaulis biprosthecum C19]
 gi|328840117|gb|EGF89689.1| hypothetical protein ABI_41120 [Asticcacaulis biprosthecum C19]
          Length = 348

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 117/345 (33%), Positives = 175/345 (50%), Gaps = 21/345 (6%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           +++  I   G M V  Y A C+ DP+ GYY+     GA GDF+TAP +SQ+FGEM+ +++
Sbjct: 6   RLIEQITLEGPMNVADYMARCLFDPQDGYYTCHVRIGADGDFLTAPMVSQMFGEMIGVWV 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              W   G P   RLVE+G G G +M DILRV  K  P       + MVE S RL   Q+
Sbjct: 66  AQMWLALGSPPAFRLVEIGGGDGTLMSDILRV-AKRVPGLSDAAQVTMVEPSPRLRASQE 124

Query: 128 KQL--ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID-IDQH 184
           + +  A +   +N   +  D+P+    ++ANE  D LP +QFV T++G  E+ +  ID H
Sbjct: 125 QTISQAVFVPDVNALAT--DLPV---IVIANEVLDCLPARQFVRTDNGWAEKCVGVIDGH 179

Query: 185 DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYL 244
             L F +    + + +    D   G   E S  +      ++  L    G A+++DYG  
Sbjct: 180 --LAFGL----VPTEYTPQLDAEPGQTIEISAAQQHFAAQLTSLLKASTGAALLVDYGRD 233

Query: 245 QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEG 304
           Q   GDTLQA+  H    PL  PG  DL+   DF  ++ I     +  + + TQ  FL+ 
Sbjct: 234 QPEAGDTLQALHNHRKTDPLAAPGDHDLTVWADFPAIAQICN-TSVKFSTIKTQSAFLQA 292

Query: 305 LGIWQRAFSLMK-QTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           LG+  R  +L +      + L     RL  T+ D+  MG+LFK++
Sbjct: 293 LGMAARFNALCEAHPTEAEKLQRQYDRL--TAPDQ--MGDLFKVV 333


>gi|301758064|ref|XP_002914877.1| PREDICTED: protein midA homolog, mitochondrial-like [Ailuropoda
           melanoleuca]
 gi|281341951|gb|EFB17535.1| hypothetical protein PANDA_002819 [Ailuropoda melanoleuca]
          Length = 440

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 131/379 (34%), Positives = 193/379 (50%), Gaps = 35/379 (9%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLIYKIKATGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG +  DILRV  +L     +  +SI++VE SE+L+
Sbjct: 103 IWFISEWMAAGKNAAFQLVELGPGRGTLAGDILRVFSQLGSVLKNCDISIHLVEVSEKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 163 EIQALTLTEEKVPVERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLP 222

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE +IDID    D L F +      +      D     + E  P     
Sbjct: 223 VHKFQKTPQGWREVVIDIDPQVSDKLRFVLAPCVTPAEVFIQRDEMRDHV-EVCPEAGVI 281

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           +Q +S R+A  GG A++ DYG+  ++  DT +   GH     L  PG ADL++ VDF  L
Sbjct: 282 VQELSQRIAIAGGAALIADYGHDGTKT-DTFRGFCGHKLHDVLTAPGTADLTADVDFSYL 340

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADK 338
             +A   ++   G   Q  FL+ +GI  R   L+ ++   AR+  LL     L+    + 
Sbjct: 341 RRMA-EGQVASLGPIKQQTFLKNMGIDVRLKVLLAKSDEPARQQ-LLQGYDMLM----NP 394

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H+++ 
Sbjct: 395 KKMGERFNFFALLPHQRLH 413


>gi|302853902|ref|XP_002958463.1| hypothetical protein VOLCADRAFT_69474 [Volvox carteri f.
           nagariensis]
 gi|300256191|gb|EFJ40463.1| hypothetical protein VOLCADRAFT_69474 [Volvox carteri f.
           nagariensis]
          Length = 374

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 177/365 (48%), Gaps = 45/365 (12%)

Query: 28  CVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGP 87
           C+  P  G+Y T + FG+ GDFVT+PEISQ+FGEM+ ++ +  W   G P  + LVELGP
Sbjct: 2   CLTSPHGGFYMTRDVFGSSGDFVTSPEISQLFGEMVGVWCVHTWLSLGRPPRLLLVELGP 61

Query: 88  GRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD------------ 135
           GRG +M D+LR     + +F + L +++VE S  L  +Q   L    +            
Sbjct: 62  GRGTLMADLLRGTAAFR-EFSASLELHLVEISPALRAVQWAALRCTNNSSSSGGSDSSGR 120

Query: 136 --------KINWYTSLADVPLG--FTFLVANEFFDSLPIKQFVM-TEHGIRERMIDIDQH 184
                   +++W+TSL  VP G      +A+EFFD+LP+ QFV   + G  E+M+D+   
Sbjct: 121 GIHTFDRTQVSWHTSLDAVPDGPAPALYIAHEFFDALPVHQFVRDPKRGWLEKMVDVRTG 180

Query: 185 DSLVFNIGDHEIKS--------NFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
             +V + G     +             S   LGA+ E S       + ++ R+   GG A
Sbjct: 181 LRMVLSPGPTPASALLVPRRLGGLAPGSAGELGAL-EVSAVGMAVAEKLAQRIVRHGGAA 239

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS--------SIAILY 288
           +V+DYG  +   GD+L A++GH  V  L  PG ADLS+ VDF  L               
Sbjct: 240 LVVDYGREEPPYGDSLMAIRGHRGVGILDAPGSADLSAWVDFGALKLAPPSPAAVAPPAA 299

Query: 289 KLYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADKKSMGELF 345
            +  +G  +Q  FL  LGI  R   LM+        + L     RL+  S +   MGE +
Sbjct: 300 SVTTSGPVSQSSFLRALGIEMRLQWLMRGATDPGAAESLAAGCARLLG-STESGGMGESY 358

Query: 346 KILVV 350
           K++ +
Sbjct: 359 KVMAI 363


>gi|294657281|ref|XP_459587.2| DEHA2E06072p [Debaryomyces hansenii CBS767]
 gi|199432572|emb|CAG87814.2| DEHA2E06072p [Debaryomyces hansenii]
          Length = 522

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 196/404 (48%), Gaps = 69/404 (17%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAV-GDFVTAPEISQIFGEMLAIFLICAW 71
           IK  G +++  +   C+  P+FGYY+T +P  A  GDF+T+PEIS +FGEM+ I+L   W
Sbjct: 114 IKTTGPISLSAFMRQCLTHPQFGYYTTRDPLNASSGDFITSPEISSMFGEMIGIWLFSTW 173

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV--LSIYMVETSERLTLIQKKQ 129
                P  + ++E GPGRG +M D L+   K K +      + I M+E S  L   Q K 
Sbjct: 174 LNQNKPQKLNIIEFGPGRGTLMYDCLKSFNKFKKNLIQEENIEITMIEASSILRKEQWKL 233

Query: 130 L-----------------ASYGDKINWYTSLADVPLG---FTFLVANEFFDSLPIKQFVM 169
           L                   +G+++ W  +  D+        ++VA+EFFD+LPIK F  
Sbjct: 234 LCGSNEFITNSDGFNISRTQWGNRVKWVDNETDITKDENVANYIVAHEFFDALPIKSFQK 293

Query: 170 TEHGIRERMID----IDQ---------------HDSLVFNIGDHEIKSNFLTCSDYF--L 208
           T+HG RE +++    +D                 ++ + N   H   S   T S     L
Sbjct: 294 TKHGWRELVVEHTPSVDNTQLSLPEDASSKSTSENNDLLNTEFHLTLSPKETSSSVIPDL 353

Query: 209 GAIFENSP-------CRDREM------QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAV 255
              F++ P       C D E+      Q +++      G+ ++IDYG  +    +TL+ +
Sbjct: 354 NPRFKDLPIDSRIEICPDAELYVLKMAQLLNNEKGM--GSVLIIDYGISEGIPDNTLRGI 411

Query: 256 KGHTYVSPLVNPGQADLSSHVDFQRLSSIA-ILYKLYINGLTTQGKFLEGLGIWQRAFSL 314
             H +VSP +NPG+ DLS  VDF  L ++   + K +  G   QG +L  LGI  R   L
Sbjct: 412 YKHKFVSPFINPGEVDLSVDVDFTNLKNVTEKMCKSF--GPVEQGDWLHELGIGYRTDQL 469

Query: 315 MK----QTARKDILLDSVKRLVSTSADKKSMGELFKILVVS-HE 353
           +K        +D + ++ +RL  T  D++SMG+++K L ++ HE
Sbjct: 470 IKANDGNVNAQDKIYNAYQRL--TGKDERSMGKIYKFLCLTPHE 511


>gi|146413170|ref|XP_001482556.1| hypothetical protein PGUG_05576 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 520

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 122/410 (29%), Positives = 196/410 (47%), Gaps = 77/410 (18%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGA-VGDFVTAPEISQIFGEMLAIFL 67
           +  +IK NG +++  Y   C+  P++GYY+T NP     GDF+T+PEIS +FGEM+ I+L
Sbjct: 111 LAEIIKTNGPLSLLAYMRQCLTHPDYGYYTTTNPLDKYTGDFITSPEISSVFGEMIGIWL 170

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV--LSIYMVETS-----E 120
              W     P  +R++E GPG+G +M D++R   KL         + I ++E S     E
Sbjct: 171 FSTWTSQDNPQNIRIIEFGPGKGTLMFDVVRTFNKLAKSRIRSDQIEICLIEASPILRDE 230

Query: 121 RLTLIQKKQLAS-------------YGDKINWYTS----LADVPLGFTFLVANEFFDSLP 163
           +  L+   +L S             +G+ + W  +    L DV     +++A+EFFD+LP
Sbjct: 231 QAELLCGSKLNSADIKDSFYTKSSIWGNTVKWLETEKDILDDVQYA-NYILAHEFFDALP 289

Query: 164 IKQFVMTEHGIRERMIDIDQHDSLVFNI--------GDHEIKSNFLTCSDYFLGAIFENS 215
           IK F  ++ G RE ++   +H   V N            E   +  T  D+ L    +++
Sbjct: 290 IKSFQKSDSGWRELLV---EHSPSVLNTQGALPSGGSSSEFSPDLET--DFHLTVSPKDT 344

Query: 216 P----------------------CRDREMQSISDRLAC------DGGTAIVIDYGYLQSR 247
           P                      C D E+ ++  ++A         G A++IDYG     
Sbjct: 345 PSSLIPELSSRFNALPTGSRIEICTDAELYAL--KMASLINNEQGNGAALIIDYGLKSGI 402

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
             ++L+ +  H +VSP  +PG+ DLS+ VDF+ L++I     L   G   QG +L  +GI
Sbjct: 403 PSNSLRGIYKHKFVSPFFSPGKVDLSADVDFENLAAITAKACLSF-GPVDQGDWLHEMGI 461

Query: 308 WQRAFSLMKQT----ARKDILLDSVKRLVSTSADKKSMGELFKIL-VVSH 352
             R   L+K      A +D +  S +RL  T  ++ SMG  +KIL +V H
Sbjct: 462 GYRIDQLLKSNEGNPAEQDKVYASYRRL--TDKNENSMGGAYKILCLVPH 509


>gi|190348924|gb|EDK41478.2| hypothetical protein PGUG_05576 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 520

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 194/409 (47%), Gaps = 75/409 (18%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGA-VGDFVTAPEISQIFGEMLAIFL 67
           +  +IK NG +++  Y   C+  P++GYY+T NP     GDF+T+PEIS +FGEM+ I+L
Sbjct: 111 LAEIIKTNGPLSLSAYMRQCLTHPDYGYYTTTNPLDKYTGDFITSPEISSVFGEMIGIWL 170

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV--LSIYMVETS-----E 120
              W     P  +R++E GPG+G +M D++R   KL         + I ++E S     E
Sbjct: 171 FSTWTSQDNPQNIRIIEFGPGKGTLMFDVVRTFNKLAKSRIRSDQIEICLIEASPILRDE 230

Query: 121 RLTLIQKKQLAS-------------YGDKINWYTSLADVPLGF---TFLVANEFFDSLPI 164
           +  L+   +L S             +G+ + W  +  D+        +++A+EFFD+LPI
Sbjct: 231 QAELLCGSKLNSADIKDSFYTKSSIWGNTVKWLETEKDISDDVQYANYILAHEFFDALPI 290

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNI--------GDHEIKSNFLTCSDYFLGAIFENSP 216
           K F  ++ G RE ++   +H   V N            E   +  T  D+ L    +++P
Sbjct: 291 KSFQKSDSGWRELLV---EHSPSVLNTQGALPSGGSSSEFSPDLET--DFHLTVSPKDTP 345

Query: 217 ----------------------CRDREMQSISDRLAC------DGGTAIVIDYGYLQSRV 248
                                 C D E+ ++  ++A         G A++IDYG      
Sbjct: 346 SSLIPELSSRFNALPTGSRIEICTDAELYAL--KMASLINNEQGNGAALIIDYGLKSGIP 403

Query: 249 GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIW 308
            ++L+ +  H +VSP  +PG+ DLS+ VDF+ L++I         G   QG +L  +GI 
Sbjct: 404 SNSLRGIYKHKFVSPFFSPGKVDLSADVDFENLAAITAKACSSF-GPVDQGDWLHEMGIG 462

Query: 309 QRAFSLMKQT----ARKDILLDSVKRLVSTSADKKSMGELFKIL-VVSH 352
            R   L+K      A +D +  S +RL  T  ++ SMG  +KIL +V H
Sbjct: 463 YRIDQLLKSNEGNPAEQDKVYASYRRL--TDKNENSMGGAYKILCLVPH 509


>gi|328789699|ref|XP_623890.2| PREDICTED: protein midA homolog, mitochondrial-like [Apis
           mellifera]
          Length = 389

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 123/362 (33%), Positives = 185/362 (51%), Gaps = 37/362 (10%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G +TV  Y    +  P  GYY   + FG  GDF+T+PEISQ+FGEMLA+++   W++   
Sbjct: 15  GPITVADYMKEVLTHPIIGYYMNKDVFGKQGDFITSPEISQLFGEMLAVWMKYEWQKISK 74

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL------ 130
            S  ++VELGPGRG ++ DILRV  + K    + +SI++VE S  L+ IQ K L      
Sbjct: 75  DS-FQIVELGPGRGTLIKDILRVFKQFKS--LNDISIHLVEVSPILSQIQAKNLCKTIIE 131

Query: 131 ------------ASY--------GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMT 170
                        SY        G K+ WY S+ DVP  F+  +A+EFFD+LPI +F   
Sbjct: 132 YDQKKNKSKNNSTSYYKEGITEDGIKLYWYHSIKDVPKKFSIFLAHEFFDALPIHKFQKI 191

Query: 171 EHGIRERMIDIDQ---HDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISD 227
           ++  RE +IDI Q    +   + + +    +     +D     I E SP     +  ++D
Sbjct: 192 DNEWREVLIDIIQGCNEEKFRYVLSNTPTPATLFISNDEKREHI-EISPESLIIVDYLAD 250

Query: 228 RLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAIL 287
            L   GG A++ DYG+   +  DT +    H    PL++PG ADL++ VDF  +  IA  
Sbjct: 251 FLWECGGFALICDYGHNGDKT-DTFRGFSQHKVHDPLLHPGTADLTADVDFAAIKKIAEK 309

Query: 288 -YKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFK 346
             +L   G  +Q  FL+ LGI  R   L++  ++++    S++       DK  MG  FK
Sbjct: 310 DNRLITFGPVSQSNFLQNLGINVRLQILLQNASKEE--RKSLESGYHMIMDKDKMGIRFK 367

Query: 347 IL 348
           +L
Sbjct: 368 VL 369


>gi|312082569|ref|XP_003143498.1| hypothetical protein LOAG_07918 [Loa loa]
 gi|307761340|gb|EFO20574.1| hypothetical protein LOAG_07918 [Loa loa]
          Length = 431

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 122/380 (32%), Positives = 189/380 (49%), Gaps = 44/380 (11%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP--FGAVGDFVTAPEISQIFG 60
           ++L+  I   I  NG M+V  Y  L  + P  GYYS      FG  GDF+TAPE++QIFG
Sbjct: 43  DQLLHFIKQKINLNGPMSVADYMRLTASSPIGGYYSHHGSKIFGEKGDFITAPELTQIFG 102

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E++ I+        G     +LVE GPG G +M DI R + +LK    +  SI++VETS+
Sbjct: 103 ELVGIWCYYELSYTGHSGEWQLVENGPGTGQLMYDITRTLIQLKA---TEGSIHLVETSD 159

Query: 121 RLTLIQKKQLASY------------------GDKINWYTSLADVPLGFTFLVANEFFDSL 162
            L   Q+  L  +                  G  + WY S+ D+P  F+  ++NEF D+L
Sbjct: 160 ALLSQQESLLCEHTSQFVDGEPYVRCNVTKNGFPVYWYRSVDDIPAKFSVFISNEFLDAL 219

Query: 163 PIKQFVMTEHG-IRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           P+ QF   + G   E  +++D+ D L F +     +S  L         I E+   ++ E
Sbjct: 220 PVNQFKRDDKGKWHEVYVNLDKDDRLCFMLS----RSENLHTLGLLPKNIREDLSIKEWE 275

Query: 222 --------MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
                   +  ++D +   GG  +++DYG+  +R   +L+A KGH  V PL NPGQ D++
Sbjct: 276 ISIDAGTYINQVADSITKFGGFVLIVDYGHNGTRKDLSLRAYKGHQIVHPLENPGQHDIT 335

Query: 274 SHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI---WQRAFSLMKQTARKDILLDSVKR 330
           + V+F  L S+ +  +  + G   Q +FL  +GI    Q+  +  K    K+ L  S + 
Sbjct: 336 ADVNFGYLKSL-VKDRTLVFGPIEQREFLAQMGIGLRLQKLLACCKTKEEKENLFKSYEI 394

Query: 331 LVSTSADKKSMGELFKILVV 350
           L+S     K MGE FK++ V
Sbjct: 395 LLSA----KGMGERFKMMSV 410


>gi|289742045|gb|ADD19770.1| ATP synthase beta subunit/transcription termination factor rho-like
           protein [Glossina morsitans morsitans]
          Length = 431

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 128/381 (33%), Positives = 188/381 (49%), Gaps = 51/381 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L +++   I   G +TV  Y    +  P+ GYY   + FG  GDF+T+PEISQIF E++ 
Sbjct: 49  LTKQLKAKILSTGPITVADYMREVLTHPQGGYYMCKDVFGREGDFITSPEISQIFAELVG 108

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS----- 119
           I+ +  W + G     +LVELGPGRG ++ D+LRV+   K D     SI++VE S     
Sbjct: 109 IWFLTEWYKLG-SLEFQLVELGPGRGTLIRDLLRVLTHFKVD--PQFSIHLVEISPYLGG 165

Query: 120 ---ERL----TLIQ-------KKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIK 165
              ER+    TLI        +K     G K+ WY    DVP  F+ +VA+EFFD+LPI 
Sbjct: 166 LQAERICHGSTLIDDNNSRFYRKGETPSGIKVFWYKHFEDVPRNFSLVVAHEFFDALPIH 225

Query: 166 QFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNF---LTCSDYFLGAIF---------- 212
           +  +  +  +E +IDID       N+ +   KS F   L+     +  I+          
Sbjct: 226 KLQLDNNLWKEVLIDIDP------NVSE---KSEFRFVLSKEQTPVSKIYQPLENDTRLS 276

Query: 213 -ENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
            E S   DR +  ++ RL  DGG  +VIDYG+   +  DT +A + H    PLV+PG AD
Sbjct: 277 LEYSLESDRLISMLAKRLQEDGGIGLVIDYGHFGDKT-DTFRAFRKHALHDPLVDPGSAD 335

Query: 272 LSSHVDFQRLSSIAILYKLYIN-GLTTQGKFLEGLGIWQRAFSLMKQT-ARKDILLDSVK 329
           L++ VDF+R+   A      +  G   QG FL+ +    R   L+K        LL S  
Sbjct: 336 LTADVDFRRMKHTAEKNNEVVTFGPIKQGIFLQQMQGDVRLERLLKNALPENQSLLKSGY 395

Query: 330 RLVSTSADKKSMGELFKILVV 350
            +++   D K MG  +K   +
Sbjct: 396 EMLT---DPKQMGGRYKFFSI 413


>gi|326431506|gb|EGD77076.1| hypothetical protein PTSG_07416 [Salpingoeca sp. ATCC 50818]
          Length = 403

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 194/395 (49%), Gaps = 43/395 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPF-GAVGDFVTAPEISQIFGEM 62
           +++  + ++I   G M+V  Y    +  P  GYY    P     GDFVT+P++SQ+FGEM
Sbjct: 9   RVLADLHSVITTTGPMSVASYMKHVLTHPLHGYYVRQKPLDNDRGDFVTSPQLSQMFGEM 68

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL-KPDFFSVLSIYMVETSER 121
           +  + +  W+  G P+ V  VELGPG G++M DI++    L K +   V  +++VE S  
Sbjct: 69  VGAWTVKEWQLSGKPTSVNFVELGPGTGLLMHDIIQSFTSLTKQEANVVTDVHLVEASPV 128

Query: 122 LTLIQKKQL-----------------------ASYGDKINWYTSLADVPL--GFTFLVAN 156
           ++  Q + L                          G   +WY  L  +P   GFTFL A+
Sbjct: 129 MSQQQYETLGCGQAPDLSNVDLTRNEEYLTGRGHAGINFHWYRHLWALPKLPGFTFLYAH 188

Query: 157 EFFDSLPIKQFVMTEHGIRERMIDI--DQHDSLVFNIGDHEIKSNFLTCS-----DYFLG 209
           EFFD++P  QF +TE G RERM+D+  +    L F +   E   + L  S        +G
Sbjct: 189 EFFDTMPTHQFQLTEDGWRERMVDVCDEAPHQLRFVLSPKETVQSKLYASLPLVRTARVG 248

Query: 210 AIFENSPCRDREMQSISDRLACD--GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNP 267
            + E S     + + ++  LA    GG A++ DYG   ++  DT +A + H  V     P
Sbjct: 249 DVGEVSFEAMEQAELVAHTLATSTMGGRALIFDYGDT-TKFDDTFRAFRDHQQVHVFDQP 307

Query: 268 GQADLSSHVDFQR-LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDIL 324
           G ADL++ V+F   L + A  +++  +G  TQ +FL   G+ QRA +L+  T  A+    
Sbjct: 308 GSADLTTDVNFDHLLVAAARSHQVVSHGPVTQRQFLLRCGLQQRADALLASTTDAKARAS 367

Query: 325 LDSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
           ++   R+++   D   MGE FK++ ++    +  P
Sbjct: 368 IEKHTRMLT---DPDEMGERFKVMAMTDANADHTP 399


>gi|303280333|ref|XP_003059459.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226459295|gb|EEH56591.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 386

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 113/344 (32%), Positives = 169/344 (49%), Gaps = 44/344 (12%)

Query: 32  PEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGI 91
           PE+GYY   + FGA GDFVT+PEISQ+FGE++ ++    WE  G PS   LVELGPGRG 
Sbjct: 8   PEYGYYMHRDVFGARGDFVTSPEISQVFGELVGVWCASTWEALGKPSKFSLVELGPGRGT 67

Query: 92  MMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY------------------ 133
           +M D+LR   K K  F + + ++MVE S +L  +Q+++L                     
Sbjct: 68  LMSDLLRATSKFK-AFTAAMDVHMVEVSPKLREMQREKLRCSGGGGGGGGGDAGAAAATS 126

Query: 134 ---GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHD----- 185
              G  + W+ +   VP G   ++A+EFFD++P+ QF  TE G  E++ +          
Sbjct: 127 ELNGRPVRWHDTFDAVPEGPIIVIAHEFFDAMPVHQFTRTERGWCEKLTEAAAAADDGAL 186

Query: 186 SLVFNIGDHEIKSNFLTCSDYFLGA-------IFENSPCRDREMQSISDRLACDGGTAIV 238
            LV + G     +  +      L A         E SP      + ++ RL    G A+ 
Sbjct: 187 ELVLSPGLTPAGALMIPRRLDGLPAERKESIRQLEISPRSVAIWERVAGRLRVHPGAALA 246

Query: 239 IDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN----- 293
           +DYG  +   G+TLQA+K H +V  L +PG ADLS++VDF  +  +      +       
Sbjct: 247 VDYGS-EGPTGNTLQAIKDHKFVDLLADPGTADLSAYVDFGAMRKVIEDGPSFARDGVRC 305

Query: 294 -GLTTQGKFLEGLGIWQRAFSLMKQTARK---DILLDSVKRLVS 333
            G TTQ   L  L I  R   L+K+   +   D L++   RL++
Sbjct: 306 YGPTTQRDLLGSLQIGARLERLVKECGSEEEADRLIEGCTRLMA 349


>gi|114328975|ref|YP_746132.1| hypothetical protein GbCGDNIH1_2311 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317149|gb|ABI63209.1| hypothetical protein GbCGDNIH1_2311 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 366

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 113/334 (33%), Positives = 164/334 (49%), Gaps = 19/334 (5%)

Query: 21  VDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCV 80
           +D++ A   A     YY+T +PF    DF TAPEISQ FGE+L ++    W+Q G P+ +
Sbjct: 30  LDRFMARANA----AYYATHDPFA---DFTTAPEISQAFGEVLGLWAAMGWQQIGAPARI 82

Query: 81  RLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWY 140
            L E GPGRG +M D L  I +  P F    +I  +ETS RL  IQ +++     +  + 
Sbjct: 83  VLAEAGPGRGTLMADALSAIRRAIPAFADAATIMFIETSPRLRAIQAQRV----PEARFA 138

Query: 141 TSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNF 200
             L ++P     L+ NEF D+LPI++FV  +   RE+ +++    S        E     
Sbjct: 139 ADLDEIPDAPLILLGNEFLDALPIRRFVRQKAEWREQFVEVQPDGSATLTTDPMEPPFPC 198

Query: 201 LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTY 260
           L       G I E S      +  ++ RL    G A+ +DYG  QS  GD+LQA+     
Sbjct: 199 LP-ETVAEGTIREWSEASHDIITRLAGRLTRQSGMALFLDYGPAQSGFGDSLQALAQGVP 257

Query: 261 VSPLVNP-GQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM--KQ 317
           V P   P G ADL++HVDF  L   A        G   QG+FL  LG+ QR   L   K 
Sbjct: 258 VDPFSLPAGAADLTAHVDFSALLDTARSAGANGYGPVAQGRFLLSLGLMQRCQRLASGKP 317

Query: 318 TARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
            A    ++++ +RL       + MG LFK + ++
Sbjct: 318 AAMARQIMNAGQRLTQA----EYMGTLFKAMALT 347


>gi|91762777|ref|ZP_01264742.1| possible cyclopropane-fatty-acyl-phospholipid synthase [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718579|gb|EAS85229.1| possible cyclopropane-fatty-acyl-phospholipid synthase [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 347

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 182/350 (52%), Gaps = 20/350 (5%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           IK N   T+D++    + +   GYY   NPFG  GDF+T+P IS +F EM+AI+++  W+
Sbjct: 3   IKNNQSFTLDKFIEESLYNETSGYYMKKNPFGKKGDFITSPNISVLFSEMIAIWVVSFWQ 62

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P    L+ELG G G MM  ++    K +  F +   I ++E S+ L   QK  +  
Sbjct: 63  NLGCPKKFNLIELGAGNGEMMKVLVNTFEKFQI-FKNSCHIKILERSKLLRKKQKININK 121

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI----DIDQHDSLV 188
              +  W   L+++       +ANEFFD+LPIKQF+  E    ER +    +  ++  + 
Sbjct: 122 KNIQ--WLNDLSELDNSPCIFLANEFFDALPIKQFIKKERKWFERHVRFFNNKFEYFDVP 179

Query: 189 FNIGDHEIKSNF-LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSR 247
           F+I   E K  F +T    F+    E SP     ++ I +++  + G  ++IDY Y   +
Sbjct: 180 FDIEKFENKIKFKITNQQNFI----EYSPQSTEYLKIIFNKIKRNNGGILIIDYAYTDKK 235

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI 307
           + +TLQAV  H Y   L   G +D++ ++ F  L+ I        +  TTQG+FL  LGI
Sbjct: 236 MKNTLQAVSKHKYCDVLKGFGNSDITYNLSFSLLNRIVKELSSLTSMNTTQGEFLTKLGI 295

Query: 308 WQRAFSLMKQ---TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
            +RA  L K+   + + DI    +KRL+    DK  MGELFK ++++  K
Sbjct: 296 LERAEILSKKMLFSEKADIYF-RIKRLI----DKNQMGELFKAMLITTNK 340


>gi|50740671|ref|XP_419525.1| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 448

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 124/380 (32%), Positives = 192/380 (50%), Gaps = 40/380 (10%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVG-DFVTAPEISQIFGEML 63
           ++R ++  ++  G +TV +Y    + +P  GYY+     G VG DF+T+PEISQIFGE++
Sbjct: 53  VLRHLLLKLRATGPVTVAEYMREALTNPGQGYYTR---RGGVGEDFITSPEISQIFGELI 109

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERL 122
            I+ I  W   G  +  +LVELGPG G +  DILRV  +L        +SI++VE S +L
Sbjct: 110 GIWYISEWMAMGKQNAFQLVELGPGMGTLTGDILRVFNQLASLLSKCDVSIHLVEVSPKL 169

Query: 123 TLIQK-------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
           + IQ                    K ++  G  I WY  + DVP G++F +A+EF D+LP
Sbjct: 170 SAIQAEMLTGGKVQSNPENKSAYMKGISKTGIPIYWYRDIQDVPQGYSFYLAHEFLDALP 229

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKS--NFLTCSDYFLGAIFENSPCRD 219
           I +F  TE G  E ++DID    D L F +      +  NF+   +       E  P   
Sbjct: 230 IHKFQRTEKGWHEVLVDIDPEVPDQLRFVLSPSRTPATENFIQPEETR--DHVEVCPEAG 287

Query: 220 REMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQ 279
             +Q ++ R+  DGG A++ DYG+  ++  DT +  + H     L  PG ADL++ VDF 
Sbjct: 288 VLIQRLACRIEKDGGAALIADYGHDGTKT-DTFRGFRNHKLHDVLKAPGTADLTADVDFS 346

Query: 280 RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTSA 336
            L  +A      + G   Q +FL+ +GI  R   L+   + +A  + LL S   L+    
Sbjct: 347 YLRKMAEGRTATL-GPIKQREFLKNMGIDLRLQVLLQHSRNSATHEQLLHSFDMLM---- 401

Query: 337 DKKSMGELFKIL-VVSHEKV 355
           + K MG+ F    ++ H +V
Sbjct: 402 NPKKMGDCFHFFALLPHHRV 421


>gi|260830669|ref|XP_002610283.1| hypothetical protein BRAFLDRAFT_126844 [Branchiostoma floridae]
 gi|229295647|gb|EEN66293.1| hypothetical protein BRAFLDRAFT_126844 [Branchiostoma floridae]
          Length = 387

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 121/382 (31%), Positives = 188/382 (49%), Gaps = 71/382 (18%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           E +L++ + + +K  G +TV  Y    + +P  GYY   + FG  GDF+T+PEISQ+FGE
Sbjct: 29  ETELLKHLRSQLKAAGPITVADYMREVLTNPTAGYYMHKDVFGTQGDFITSPEISQMFGE 88

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS-- 119
           +L ++ +  W   G P  +++VELGPGRG +  D+LRV  +  P    ++S+++VE S  
Sbjct: 89  LLGVWCVNEWMLGGSPRSMQVVELGPGRGTLAQDMLRVFQQF-PMMQDMVSLHLVEVSPK 147

Query: 120 ------ERLTLI----QKKQLASYGD------------KINWYTSLADVPLGFTFLVANE 157
                 ERLT +    ++K  AS GD             I+WY+ + DVP GF+  +A+E
Sbjct: 148 MAAMQEERLTGVIEDDKRKNAASGGDIVYKKRKTKAGVPISWYSDIHDVPRGFSCYIAHE 207

Query: 158 FFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPC 217
           F D+LP+ +F   E                     DH                  E  P 
Sbjct: 208 FLDALPVHKFQAGEK-------------------RDH-----------------LEVCPQ 231

Query: 218 RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
               +Q +++R+   GG A++ DYG+  ++  DTL+  + H     L  PG ADL++ VD
Sbjct: 232 AGVLVQHLANRIVEHGGAALLADYGHDGTKT-DTLRGFRNHQLHEVLQEPGSADLTADVD 290

Query: 278 FQRLSSI-AILYKLYINGLTTQGKFLEGLGIWQRAFSLMK---QTARKDILLDSVKRLVS 333
           F  L  + A   K   +G  TQ +FLE + I  R   L +   ++ RKD LL     L  
Sbjct: 291 FSYLRHMCAGKDKALTHGPITQREFLENMAIELRLQVLQRNADESQRKD-LLSGYDML-- 347

Query: 334 TSADKKSMGELFKILVVSHEKV 355
           T+ DK  MG+ FK   ++ ++ 
Sbjct: 348 TNPDK--MGDRFKFFSITRQRT 367


>gi|71082800|ref|YP_265519.1| cyclopropane-fatty-acyl-phospholipid synthase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71061913|gb|AAZ20916.1| possible cyclopropane-fatty-acyl-phospholipid synthase [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 347

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 113/346 (32%), Positives = 177/346 (51%), Gaps = 12/346 (3%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           IK N   T+D++    + +   GYY   NPFG  GDF+T+P IS +F EM+AI+++  W+
Sbjct: 3   IKNNQSFTLDKFIEESLYNKTSGYYMKKNPFGKKGDFITSPNISVLFSEMIAIWVVSFWQ 62

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
             G P    L+ELG G G MM  ++    K +  F +   I ++E S+ L   QK  +  
Sbjct: 63  NLGCPKKFNLIELGAGNGEMMKVLVNTFEKFQI-FKNSCHIKILERSKLLRKKQKININK 121

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
              +  W   L+++       +ANEFFD+LPIKQF+  E    ER +    +    F++ 
Sbjct: 122 KNIQ--WLNDLSELDNSPCIFLANEFFDALPIKQFIKKERKWFERHVRFFNNKFEYFDVP 179

Query: 193 -DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDT 251
            D E   N +           E SP     ++ I +++  + G  ++IDY Y   ++ +T
Sbjct: 180 FDMEKFVNKIKFKITKQQNFIEYSPQSTEYLEIIFNKIKRNNGGILIIDYAYTDKKMKNT 239

Query: 252 LQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRA 311
           LQAV  H Y   L   G +D++ ++ F  L+ I        +  TTQG+FL  LGI +RA
Sbjct: 240 LQAVSKHKYCDVLKGFGNSDITYNLSFSLLNRIVKELSSLTSMNTTQGEFLTKLGILERA 299

Query: 312 FSLMKQ---TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
             L K+   + + DI    +KRL+    DK  MGELFK+++++  K
Sbjct: 300 EILSKKMLFSEKADIYF-RIKRLI----DKNQMGELFKVMLITTHK 340


>gi|268573202|ref|XP_002641578.1| Hypothetical protein CBG09880 [Caenorhabditis briggsae]
          Length = 382

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 109/342 (31%), Positives = 169/342 (49%), Gaps = 34/342 (9%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP----FGAVGDFVTAPEISQI 58
           N L + +++ I+ +G +TV +Y    V+ P  GYY   +     FG  GDF+T+PE++Q+
Sbjct: 33  NHLKKFLIDKIRTSGPITVAEYMKTSVSAPVVGYYGQFSRDQKVFGEKGDFITSPELTQL 92

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-------- 110
           FGEM+ +++       G     +LVELGPGR  +M D+L  + K   +  SV        
Sbjct: 93  FGEMIGVWVFHELANTGHKGSWQLVELGPGRAQLMNDVLNALAKFNDNDVSVHLVEMSDA 152

Query: 111 --------LSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSL 162
                   L IY  E ++    ++K +  + G  I WY S+ D+P GFT  +ANEF D+L
Sbjct: 153 LIDEQENFLCIYNSENTKGTPHVRKNKTRT-GVNIYWYKSIDDIPDGFTVFIANEFLDAL 211

Query: 163 PIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAI--------FEN 214
           P+ QF  T    +E  +++ +   L F       K   L        AI        +E 
Sbjct: 212 PVHQFKKTGDLWKEVYVNLTKEGDLRFMTS----KGENLHTKGLIPAAIRNENSRLTWEC 267

Query: 215 SPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSS 274
           SP     +  I DR+   GG ++++DYG+  SR   + +A K H  V PL NPG  DL++
Sbjct: 268 SPESGTVVNQIVDRITTFGGFSLLVDYGHDGSRNTHSFRAYKNHEQVDPLSNPGVVDLTA 327

Query: 275 HVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
            VDF  L+++ +  +  + G   Q  FL  LGI  R   L++
Sbjct: 328 DVDFGYLTTL-VEDRALVYGPIEQRVFLTQLGIEHRLRRLLQ 368


>gi|301093177|ref|XP_002997437.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262110693|gb|EEY68745.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 419

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 124/210 (59%), Gaps = 23/210 (10%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           EN L+  + ++I+  G +TV ++ +  ++ P+ GYY   + FG+ GDF TAPEISQ+FGE
Sbjct: 88  ENSLVHVLRSMIEVKGPLTVAEFMSRSLSHPDHGYYMKKDVFGSQGDFTTAPEISQMFGE 147

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++A++ +  W+Q G PS +++VE+GPGRG +M D LR   K  P F+  + I+MV+ S  
Sbjct: 148 LIAVWCVATWQQMGMPSHIKIVEMGPGRGSLMSDFLRA-AKSFPPFYDAIEIHMVDISPA 206

Query: 122 LTLIQKK-----------------QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPI 164
           +  IQ++                 +L   G  + W+   A+VP G + ++A E FD+LP+
Sbjct: 207 MQKIQQETLKCEPVEDKTAPENTMRLPDNGPTVRWHADFANVPHGPSLMIAQELFDALPV 266

Query: 165 KQFVMTEHGIRERMIDIDQHDSLVFNIGDH 194
            QF  T+ G RER++DID  D      GDH
Sbjct: 267 HQFEYTDRGWRERLVDIDFEDG-----GDH 291


>gi|170579548|ref|XP_001894878.1| hypothetical protein [Brugia malayi]
 gi|158598369|gb|EDP36276.1| conserved hypothetical protein [Brugia malayi]
          Length = 427

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 123/388 (31%), Positives = 196/388 (50%), Gaps = 48/388 (12%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP--FGAVGDFVTAPEISQIFG 60
           ++L+  I   I  NG M+V +Y  L  + P  GYYS      FG  GDF+TAPE++Q+FG
Sbjct: 39  DQLLHFIKQKINLNGPMSVAEYMRLTASSPIGGYYSRHGSKIFGEKGDFITAPELTQMFG 98

Query: 61  EMLAIFLICAWE--QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           E++ I+  C +E    G     +LVE GPG G +M DI R + +LK    +  SI++VET
Sbjct: 99  ELIGIW--CYYELINTGHSEEWQLVENGPGTGQLMSDITRTLRRLK---VTKGSIHLVET 153

Query: 119 SERLTLIQKKQLASY------------------GDKINWYTSLADVPLGFTFLVANEFFD 160
           S+ L   Q+  L  +                  G  I WY ++ D+P  F+  ++NEF D
Sbjct: 154 SDALLDQQESLLCEHPSQFIDGKSYVRCNVTKNGFPIYWYRNVDDIPAQFSIFISNEFLD 213

Query: 161 SLPIKQFVMTEHG-IRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRD 219
           +LP+ QF   + G   E  +++++ D L F +     KS  L         I E+   ++
Sbjct: 214 ALPVNQFKRDDEGKWHEVYVNLNKDDKLCFMLS----KSENLHTFGLLPKKIREDLSIKE 269

Query: 220 REM--------QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
            E+          ++D +   GG  +++DYG+  +R   +L+A KGH  V PL NPG+ D
Sbjct: 270 WEISIDAGTYVNQVTDSITKFGGFVLIVDYGHNGTRKDLSLRAYKGHQIVHPLENPGEHD 329

Query: 272 LSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGI---WQRAFSLMKQTARKDILLDSV 328
           +++ V+F  L S+ +  +  + G   Q +F   +GI    QR  +  K    K  LL S 
Sbjct: 330 ITADVNFGYLKSL-VEDRTLVFGPIEQREFFAQMGIGLRLQRLLTCCKTEEDKQNLLKSC 388

Query: 329 KRLVSTSADKKSMGELFKILVVSHEKVE 356
           + L+S    +K MGE FK++ +  + +E
Sbjct: 389 EILLS----EKGMGERFKVMSIFPKTLE 412


>gi|326915451|ref|XP_003204031.1| PREDICTED: protein midA homolog, mitochondrial-like, partial
           [Meleagris gallopavo]
          Length = 389

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 122/372 (32%), Positives = 187/372 (50%), Gaps = 40/372 (10%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVG-DFVTAPEISQIFGEMLAIFLICAW 71
           ++  G +TV +Y    + +P  GYY+     G VG DF+T+PEISQIFGE++ I+ +  W
Sbjct: 2   LRATGPVTVAEYMREALTNPGQGYYTRR---GGVGEDFITSPEISQIFGELIGIWYVSEW 58

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLTLIQK--- 127
              G  +  +LVELGPG G +  DILRV  +L        +SI++VE S +L+ IQ    
Sbjct: 59  MAMGKQNAFQLVELGPGTGTLTDDILRVFNQLASLLSKCDVSIHLVEVSPKLSAIQAEVL 118

Query: 128 ----------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTE 171
                           K ++  G  I WY  + DVP G++F +A+EF D+LPI +F  TE
Sbjct: 119 TGGKVQSNPENRSAYMKGISKSGIPIYWYRDIQDVPQGYSFYLAHEFLDALPIHKFQRTE 178

Query: 172 HGIRERMIDIDQH--DSLVFNIGDHEIKS--NFLTCSDYFLGAIFENSPCRDREMQSISD 227
            G  E ++DID    D L F +      +  NF+   +       E  P     +Q ++ 
Sbjct: 179 KGWHEVLVDIDPEVPDQLRFVLSPSRTPATENFIQPEE--TRDHVEVCPEAGILIQRLAC 236

Query: 228 RLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAIL 287
           R+  DGG A++ DYG+  ++  DT +  + H     L  PG ADL++ VDF  L  +A  
Sbjct: 237 RIEKDGGAALIADYGHDGTKT-DTFRGFRNHKLHDVLKAPGTADLTADVDFSYLRKMAEG 295

Query: 288 YKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTSADKKSMGEL 344
               + G   Q +FL+ +GI  R   L+   + +A  + LL S   L+    + K MG+ 
Sbjct: 296 RTATL-GPIKQREFLKNMGIDLRLQVLLQNSRNSATHEQLLHSFDMLM----NPKKMGDC 350

Query: 345 FKIL-VVSHEKV 355
           F    ++ H +V
Sbjct: 351 FHFFALLPHHRV 362


>gi|68487619|ref|XP_712358.1| hypothetical protein CaO19.6152 [Candida albicans SC5314]
 gi|46433739|gb|EAK93170.1| conserved hypothetical protein [Candida albicans SC5314]
          Length = 527

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 115/402 (28%), Positives = 180/402 (44%), Gaps = 66/402 (16%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQIFGEMLAIFLICAW 71
           IK  G + +  Y   C+  PEFGYY+T +P     GDF+T+PEIS +FGEM+ I+    W
Sbjct: 117 IKLTGPIPLSTYMRQCLTHPEFGYYTTRDPLNLRTGDFITSPEISSVFGEMIGIWYFSIW 176

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV------LSIYMVETSERLTLI 125
           +Q  +P  +R +E GPG+G ++ DI++   K              + I ++E S  L   
Sbjct: 177 QQQKYPESIRFIEFGPGKGTLIHDIMKTFNKFVEKLLPSDQKRPKIEIALIEASHVLRKE 236

Query: 126 QKKQL------------------ASYGDKINWYTSLADVPLG----FTFLVANEFFDSLP 163
           Q K L                    +G+ I W  +  D+  G      F+VA+EFFD+LP
Sbjct: 237 QWKLLCNPEDPMETTGEGYNRSATKWGNDIIWLDTEKDIQQGDKNVANFIVAHEFFDALP 296

Query: 164 IKQFVMTEHGIRERMID-----------------------IDQHDSL----VFNIGDHEI 196
           IK F+  E G RE +++                        +  DSL       I   E 
Sbjct: 297 IKSFIREEKGWRELVVEHTPSVNNTQPKLEESASARGANKFETDDSLDTEFHLTISPKET 356

Query: 197 KSNFLT-----CSDYFLGAIFENSPCRDREMQSISDRL--ACDGGTAIVIDYGYLQSRVG 249
            S+ +        D  +G   EN P  +  +  ++  L  + D G  +VIDYG       
Sbjct: 357 PSSMIPQISKRYRDLPVGTRIENCPDAELYIMKMAKLLSDSNDKGAILVIDYGTENEIPE 416

Query: 250 DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI-LYKLYINGLTTQGKFLEGLGIW 308
           ++L+ +  H +VSP  NPG+ DLS  VDFQ L  +   +  +Y  G   QG +L  +GI 
Sbjct: 417 NSLRGIYQHKFVSPFWNPGEVDLSIDVDFQALKQLTEGIVDIY--GPLKQGDWLHNIGIG 474

Query: 309 QRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            R   ++K+  +   + D +        D + MG ++K + +
Sbjct: 475 YRIDQVLKKNEQDPEVQDKIYGAYRRLTDGEQMGSIYKFMAL 516


>gi|302675134|ref|XP_003027251.1| hypothetical protein SCHCODRAFT_113587 [Schizophyllum commune H4-8]
 gi|300100937|gb|EFI92348.1| hypothetical protein SCHCODRAFT_113587 [Schizophyllum commune H4-8]
          Length = 431

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 191/378 (50%), Gaps = 71/378 (18%)

Query: 25  FALCVADPEFGYY-STCNP-FGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRL 82
            +LC+  P  GYY S+ NP FG  GDF+T+PEISQ+FGE++ I+ +  +  H  P+ +RL
Sbjct: 1   MSLCLGHPVHGYYTSSANPVFGKAGDFITSPEISQVFGELIGIWYLTRFSAHPKPA-LRL 59

Query: 83  VELGPGRGIMMLDILRVICKL--KPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWY 140
           VELGPGRG +M DILRV  +L  K      +S+++VETS+ +  +QK +L+++G  ++WY
Sbjct: 60  VELGPGRGTLMEDILRVFRQLLSKLPVPPEISVHLVETSQPMRKLQKSKLSAFGHDVHWY 119

Query: 141 TSLADVPLG-----FTFLVANEFFDSLPIKQF-VMTEHGIRERMIDIDQHDSLVFNIGDH 194
            S+ DVP       FT ++A+EFFD+LPI  +  M E    E+++   +  S     G  
Sbjct: 120 DSIDDVPQDVDGKTFTMVLAHEFFDALPIDIYQKMDEENFLEKLVTSTEDAS-----GTE 174

Query: 195 EIKS--NFLTCSDYFLGAIFENSPCRDR-----EMQSISDRLAC---------------- 231
            +++  + +T     L    +      +      + +++ RLA                 
Sbjct: 175 RLRAVPSTMTPKAALLNTAVQTYSAPKKTGFADPLDALARRLAALPAGASAEICWPAWDI 234

Query: 232 ---------DGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQ--R 280
                     GG  +VIDYG  +   GD+ +A K H  VSP   PGQ DL+++VDF+  R
Sbjct: 235 AASISKLLRGGGAGLVIDYGG-ERMFGDSFRAFKQHKIVSPYETPGQCDLTANVDFKFLR 293

Query: 281 LSSIAILYK-----------LYINGLTTQGKFLEGLGIWQRAFSLMKQTAR--------- 320
            +  ++ +K           +  + L TQ  FL+G+G+  R   L+    R         
Sbjct: 294 HAFESVNHKSDSDNDRPSPPIRTHMLLTQAAFLQGMGVDVRLQKLLDAARREGGEAGKEK 353

Query: 321 KDILLDSVKRLVSTSADK 338
           +  L   V+RL+ T  ++
Sbjct: 354 EKRLRQGVERLIGTGVER 371


>gi|328858640|gb|EGG07752.1| hypothetical protein MELLADRAFT_85499 [Melampsora larici-populina
           98AG31]
          Length = 367

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 183/360 (50%), Gaps = 52/360 (14%)

Query: 27  LCVADPEFGYYST--------CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPS 78
           LC+     GYYS          +PFG +GDF+T+PEISQIFGE++ ++ +  W   G P 
Sbjct: 3   LCLNHTSLGYYSKPESNRTNLSDPFGKLGDFITSPEISQIFGELIGVWFLSRWIDFGSPD 62

Query: 79  CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA---SYGD 135
            +R++ELGPGRG ++ DILR    +K     +  I++VE S  L  IQ+++L+   S G+
Sbjct: 63  SIRIIELGPGRGTLISDILRTFKSIKSCNPKIKEIHLVENSPFLRKIQEEKLSKDLSNGN 122

Query: 136 -KINWYTSLADVPLG---FTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNI 191
            K+ WY  + ++      ++ ++A+EFFD+LPI  F  T+ G RE ++DID  +     I
Sbjct: 123 TKLYWYDRIEEIQESSDHWSMIIAHEFFDALPIHVFQKTDKGFREILVDIDDKNKTTEPI 182

Query: 192 GDHEIKS----NFLTCS----------------DYFLGAIFENSPCRDREMQSISDRLAC 231
           G   IKS     F+  S                 + +G+  E SP        +S  L  
Sbjct: 183 G--LIKSIKPIRFVLASKPTIGSQTLIQEKDYEKFSVGSKIEISPLSLSVAFHLSKLLKL 240

Query: 232 DGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY-KL 290
             G+ +++DYG      GD+L+    H  V PL  PG  DL+++V+F +L  I   + K 
Sbjct: 241 GNGSGLIVDYGD-DHHFGDSLRGFYKHRVVDPLHKPGLTDLTANVNFSKLKEIMNPFCKS 299

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           Y  G  +Q +FL  +GI  R   L K T +      SV RL+S     + MG  +K L +
Sbjct: 300 Y--GPISQREFLLKMGIEVRKQKL-KNTDQ------SVDRLISP----RGMGTQYKFLGI 346


>gi|324512121|gb|ADY45030.1| Protein midA [Ascaris suum]
          Length = 414

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 194/378 (51%), Gaps = 40/378 (10%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYS------TCNPFGAVGDFVTAPEISQI 58
           L+R +   I+  G M V  Y    V+    GYYS       C+ FG  GDF+TAPE+SQ+
Sbjct: 24  LLRFLKRKIRLRGPMPVADYMRTVVSSSSVGYYSQFSRNENCDIFGEKGDFITAPELSQM 83

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGEM+ ++        G     +LVE GPG G +M DI+ V+ + + D    +SI+++ET
Sbjct: 84  FGEMIGVWCYYELANTGHKGHWQLVESGPGTGQLMKDIVGVMERFEED---KMSIHLIET 140

Query: 119 SERLTLIQKKQLASY------------------GDKINWYTSLADVPLGFTFLVANEFFD 160
           S+ L L Q+K L S                   G  I WY SL++VP  F+  +ANEF D
Sbjct: 141 SDPLILEQEKTLCSRPSQFIENNAHVRYNTTKGGIPIYWYRSLSEVPEKFSVFIANEFLD 200

Query: 161 SLPIKQFVMTEHG-IRERMIDIDQHDSLVFNIGDHE-------IKSNFLTCSDYFLGAIF 212
           +LP+ QF   E G   E  + ++ ++ L F +   E       +  +    +D      +
Sbjct: 201 ALPVHQFKKDETGNWHEIYVAMNDNEDLCFMLSRMETLFTVGLMPESIRNETDR---TEW 257

Query: 213 ENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADL 272
           E SP     +  +++R+   GG  ++IDYG+  SR   +L+A + H  V+PL NPG+ D+
Sbjct: 258 EVSPDAGTYVNEVAERVIQFGGFGLMIDYGHDGSRKDLSLRAYRRHQLVNPLENPGEHDI 317

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLV 332
           ++ V+F  L S+ I  +  I G   Q +FL  +GI  R   L+++ ++++  ++ +K   
Sbjct: 318 TADVNFGYLKSL-IEDRALIFGPIDQREFLAQMGIGVRLRRLVEKCSKREDQVNLIKSY- 375

Query: 333 STSADKKSMGELFKILVV 350
           +    ++ MG  FK++ V
Sbjct: 376 NMLMSEEGMGTRFKVMSV 393


>gi|328351542|emb|CCA37941.1| Protein midA homolog, mitochondrial [Pichia pastoris CBS 7435]
          Length = 399

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 117/394 (29%), Positives = 178/394 (45%), Gaps = 67/394 (17%)

Query: 28  CVADPEFGYYSTCNPFGAVG---DFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVE 84
           C+  PEFGYY+T +P   +    DFVT+PEISQ FGEM+ I+    W   G P  VR +E
Sbjct: 4   CLVHPEFGYYTTRDPLSPISETSDFVTSPEISQTFGEMIGIYHYTTWLLQGKPKEVRFIE 63

Query: 85  LGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS------------ 132
            GPG+G ++ D +R   +L      +  + +VE S  L   Q+K+L              
Sbjct: 64  FGPGKGTLIFDCIRTFERLSKGTV-LYEVILVEASPILREEQRKKLCGDTSLNVLEDGTW 122

Query: 133 -----YGDKINWYTSLADV-PLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHD- 185
                 G + +W  +  D+   G  +++A+EFFD+LP++Q+  T+ G RE M+D  + + 
Sbjct: 123 EAETLAGKRCHWVETELDIKKTGTNYIIAHEFFDALPVQQYEKTKDGWREYMVDFSEKNV 182

Query: 186 ------------------------SLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRD 219
                                   +L FN   H + S   T   Y       +E  P   
Sbjct: 183 IRAKTDPLALPNRTTITSKELENPALRFNF--HSVLSPHETPGSYIPKNNPRYEALPVGS 240

Query: 220 R-----EMQSISDRLA------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPG 268
           R     E  + S  +A      C  G  ++IDYG   +   +T++ +K H  VSP  +PG
Sbjct: 241 RIEICPEAHTYSKHIAALINSGCGAGGCLIIDYGPADTVPINTIRGIKNHKIVSPFDDPG 300

Query: 269 QADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILL 325
             DLS+ VDF +L  I       ++G   QG +L  LG+  R   L+   K    K  ++
Sbjct: 301 NVDLSADVDFGQLKQIFENQSCQVHGPVAQGDWLHELGLGFRTDQLVHIAKSENDKQKII 360

Query: 326 DSVKRLVSTSADKKSMGELFKILVVSHEKVELMP 359
            + KRLV  S     MG ++K L V     ++ P
Sbjct: 361 KAYKRLVGKS--HGDMGSIYKFLAVLPNGSQIQP 392


>gi|114576980|ref|XP_001167082.1| PREDICTED: hypothetical protein isoform 1 [Pan troglodytes]
          Length = 362

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/341 (33%), Positives = 172/341 (50%), Gaps = 34/341 (9%)

Query: 43  FGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICK 102
            G  GDF+T+PEISQIFGE+L I+ I  W   G  +  +LVELGPGRG ++ DILRV  +
Sbjct: 2   LGEKGDFITSPEISQIFGELLGIWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQ 61

Query: 103 LKPDFFSV-LSIYMVETSERLTLIQK--------------------KQLASYGDKINWYT 141
           L     +  +S+++VE S++L+ IQ                     K +   G  I+WY 
Sbjct: 62  LGSVLKNCDISVHLVEVSQKLSEIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPISWYR 121

Query: 142 SLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSN 199
            L DVP G++F +A+EFFD LP+ +F  T  G RE  +DID    D L F +      + 
Sbjct: 122 DLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAE 181

Query: 200 FLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHT 259
                D     + E  P     ++ +S R+A  GG A+V DYG+  ++  DT +    H 
Sbjct: 182 AFIQHDETRDHV-EVCPDAGVIIEELSQRIALTGGAALVADYGHDGTKT-DTFRGFCDHK 239

Query: 260 YVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA 319
               L+ PG ADL++ VDF  L  +A   K+   G   Q  FL+ +GI  R   L+ ++ 
Sbjct: 240 LHDVLIAPGTADLTADVDFSYLRRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSN 298

Query: 320 RKDI---LLDSVKRLVSTSADKKSMGELFKIL-VVSHEKVE 356
              +   LL     L+    + K MGE F    ++ H++++
Sbjct: 299 EPSVRQQLLQGYDMLM----NPKKMGERFNFFALLPHQRLQ 335


>gi|241959024|ref|XP_002422231.1| conserved hypothetical protein [Candida dubliniensis CD36]
 gi|223645576|emb|CAX40235.1| conserved hypothetical protein [Candida dubliniensis CD36]
          Length = 527

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 181/407 (44%), Gaps = 76/407 (18%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQIFGEMLAIFLICAW 71
           IK  G + +  Y   C+  PEFGYY+T NP     GDF+T+PEIS +FGEM+ I+    W
Sbjct: 117 IKLTGPIPLSTYMRQCLTHPEFGYYTTRNPLSLRTGDFITSPEISSVFGEMIGIWYFSIW 176

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV------LSIYMVETSERLTLI 125
           +Q  +P  +R +E GPG+G ++ DI++   K              + I ++E S  L   
Sbjct: 177 QQQKYPKSIRFIEFGPGKGTLIHDIMKTFNKFVEKLLPSDQKRPKIEIALIEASRVLRKE 236

Query: 126 Q------------------KKQLASYGDKINWYTSLADVPLG----FTFLVANEFFDSLP 163
           Q                   + ++ +G+ I W  +  D+  G      F+VA+EFFD+LP
Sbjct: 237 QWKLLCNPQDPMDTTEEGYNRSISKWGNDIIWLDTEKDIKQGDKNVANFIVAHEFFDALP 296

Query: 164 IKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSD-----------YFLGAIF 212
           IK F+  E G RE ++   +H   V N      +S   T +D           + L    
Sbjct: 297 IKSFIREEKGWRELVV---EHTPSVNNTQPKLEESKSSTRADKVETDNSLDTEFHLTISP 353

Query: 213 ENSP----------------------CRDREM------QSISDRLACDGGTAIVIDYGYL 244
           + +P                      C D E+      + +SD  + D G  +VIDYG  
Sbjct: 354 KETPSSMIPQISKRYRDLPVGTRIEICPDAELYIMKMAKLLSD--SNDKGAILVIDYGTE 411

Query: 245 QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI-LYKLYINGLTTQGKFLE 303
                ++L+ +  H +VSP  +PG+ DLS  VDFQ L  +   +   Y  G   QG +L 
Sbjct: 412 NEIPENSLRGIYQHKFVSPFWSPGEVDLSIDVDFQALKQLTEGIVNAY--GPVKQGDWLH 469

Query: 304 GLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            +GI  R   L+K+  +   + D +        D + MG ++K + +
Sbjct: 470 NIGIGYRIDQLLKKNQQDPNVQDKIYGAYRRLTDSEQMGSIYKFMAL 516


>gi|307111042|gb|EFN59277.1| hypothetical protein CHLNCDRAFT_8390 [Chlorella variabilis]
          Length = 400

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 111/350 (31%), Positives = 170/350 (48%), Gaps = 38/350 (10%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           E  L+R +  LI+ + G +++ ++ +  + +P+ GYYS  + FGA GDFVT+PEI Q+ G
Sbjct: 31  ETPLVRHLKALIQFRGGPLSLAEFMSEALTNPQHGYYSQRDVFGATGDFVTSPEICQMMG 90

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ I+ + AW+Q G P+ + LVELGPGRG +M D+LR     +  F   L + MVE S 
Sbjct: 91  EMVGIWCVAAWQQLGCPATLHLVELGPGRGTLMADLLRGTAAFQ-QFSQALRVSMVEVSP 149

Query: 121 RLTLIQKKQLASYGD-------------------KINWYTSLADVPL--GFTFLVANEFF 159
            L  +         +                    ++W+ SL +V    G +  +A+EF 
Sbjct: 150 HLRGMHGDDPGPDTNSSSSSGSGGVSGVSGWSGVPVSWHRSLEEVAAEGGPSLYIAHEFL 209

Query: 160 DSLPIKQFVMTEHGIRERMIDIDQHDS-----LVFNIGDHEIKSNFLTCSDYFLGAIFEN 214
           D+LP+ QF  TE G  ER++D    DS     +V + G        L      L     +
Sbjct: 210 DALPVHQFQKTERGWCERLVDCASPDSPLHLRMVLSPGPTPAARVLLPRRLRQLPQAEAS 269

Query: 215 S-------PCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNP 267
                   P      + ++ R+A  GG A++IDYG   +    +LQA++ H +V  L  P
Sbjct: 270 EAAALEVCPQAMALAEGLARRVAQHGGAALIIDYGQ-DAPYEASLQAIRQHQFVGLLEGP 328

Query: 268 GQADLSSHVDFQRLSSIAILYKLYIN--GLTTQGKFLEGLGIWQRAFSLM 315
           G AD+S+ VD+  L +         +  G   Q  FL GLGI  R   L+
Sbjct: 329 GGADISNRVDYSALRATVEESGAAADCLGPIPQALFLLGLGIEARLEQLL 378


>gi|238880132|gb|EEQ43770.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 527

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 184/407 (45%), Gaps = 76/407 (18%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQIFGEMLAIFLICAW 71
           IK  G + +  Y   C+  PEFGYY+T +P     GDF+T+PEIS +FGEM+ I+    W
Sbjct: 117 IKLTGPIPLSTYMRQCLTHPEFGYYTTRDPLNLRTGDFITSPEISSVFGEMIGIWYFSIW 176

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV------LSIYMVETSERLTLI 125
           +Q  +P  +R +E GPG+G ++ DI++   K              + I ++E S  L   
Sbjct: 177 QQQKYPESIRFIEFGPGKGTLIHDIMKTFNKFVEKLLPSDQKRPKIEIALIEASHVLRKE 236

Query: 126 QKKQL------------------ASYGDKINWYTSLADVPLG----FTFLVANEFFDSLP 163
           Q K L                    +G+ I W  +  D+  G      F+VA+EFFD+LP
Sbjct: 237 QWKLLCNPEDPMETTGEGYNRSATKWGNDIIWLDTEKDIQQGDKNVANFIVAHEFFDALP 296

Query: 164 IKQFVMTEHGIRERMIDIDQHDSLVFNI-----------GDHEIKSNFLTCSDYFLGAIF 212
           IK F+  E G RE ++   +H   V N            G ++ +++    +++ L    
Sbjct: 297 IKSFIREEKGWRELVV---EHTPSVNNTQPKLEESASARGANKFETDDSLDTEFHLTISP 353

Query: 213 ENSP----------------------CRDREM------QSISDRLACDGGTAIVIDYGYL 244
           + +P                      C D E+      + +SD  + D G  +VIDYG  
Sbjct: 354 KETPSSMIPQISKRYRDLPVGTRIEICPDAELYIMKMAKLLSD--SNDKGAILVIDYGTE 411

Query: 245 QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI-LYKLYINGLTTQGKFLE 303
                ++L+ +  H +VSP  NPG+ DLS  VDFQ L  +   +  +Y  G   QG +L 
Sbjct: 412 NEIPENSLRGIYQHKFVSPFWNPGEVDLSIDVDFQALKQLTEGIVDIY--GPLKQGDWLH 469

Query: 304 GLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            +GI  R   L+K+  +   + D +        D + MG ++K + +
Sbjct: 470 NIGIGYRIDQLLKKNQQDPEVQDKIYGAYRRLTDGEQMGSIYKFMAL 516


>gi|294085763|ref|YP_003552523.1| hypothetical protein SAR116_2196 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665338|gb|ADE40439.1| protein of unknown function DUF185 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 389

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 113/365 (30%), Positives = 181/365 (49%), Gaps = 30/365 (8%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
           + +   +V  I  +G +++ +Y  + ++  + GYY + +PFG  GDF+TAPEIS +FGEM
Sbjct: 12  DDMTASLVAQIVADGPLSLARYIEIALSTADAGYYQSSDPFGHKGDFITAPEISGLFGEM 71

Query: 63  LAIFLICAWEQHGFPSCVR-------LVELGPGRGIMMLDILRVICKLKPDFFSVLSIYM 115
             +FL   +E    P           ++E GPGRG +M D+  V  +L P+  +  ++++
Sbjct: 72  CGLFLAHMFELGKAPEETESGRKKPVIIECGPGRGTLMADMRHVWGQLMPE-LAACTVHL 130

Query: 116 VETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIR 175
           +ETS  L  +Q++ L      I+W+  L+ +P    + +ANEFFD+LP+   +  +   R
Sbjct: 131 IETSPYLRTLQEQALPDA--VIHWHDDLSALPAAPLYGIANEFFDALPVAHAICRKGIWR 188

Query: 176 ERMIDIDQHDSLVFNIG--------DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISD 227
            R++      +L F  G        D    S+     D   G + E     +  MQ ++ 
Sbjct: 189 HRLVTATP--ALGFGEGAPLTTAELDRWHLSHKAASPD---GTVAEFCVMGEDIMQVLAA 243

Query: 228 RLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAIL 287
            +A  GG  ++IDYG   +  GDT+QAV  H  V     PGQAD+S  VDF  L++ A  
Sbjct: 244 HIARFGGAILIIDYGKTDN-FGDTVQAVAAHKPVDLFYQPGQADISHWVDFGALAACASE 302

Query: 288 YKLYINGLTTQGKFLEGLGIWQRAFSLMKQT--ARKDILLDSVKRLVSTSADKKSMGELF 345
               + G   QG FL  +G+  RA    K      +  LL +  RLVS +     MG  F
Sbjct: 303 AGARLIGPVEQGSFLTQIGLKARAEQAAKHADPEMRRALLAAYDRLVSPA----QMGSAF 358

Query: 346 KILVV 350
           K+ ++
Sbjct: 359 KVALL 363


>gi|68487546|ref|XP_712394.1| hypothetical protein CaO19.13571 [Candida albicans SC5314]
 gi|46433778|gb|EAK93208.1| conserved hypothetical protein [Candida albicans SC5314]
          Length = 527

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/407 (27%), Positives = 184/407 (45%), Gaps = 76/407 (18%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQIFGEMLAIFLICAW 71
           IK  G + +  Y   C+  PEFGYY+T +P     GDF+T+PEIS +FGEM+ I+    W
Sbjct: 117 IKLTGPIPLSTYMRQCLTHPEFGYYTTRDPLNLRTGDFITSPEISSVFGEMIGIWYFSIW 176

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV------LSIYMVETSERLTLI 125
           +Q  +P  +R +E GPG+G ++ DI++   K              + I ++E S  L   
Sbjct: 177 QQQKYPESIRFIEFGPGKGTLIHDIMKTFNKFVEKLLPSDQKRPKIEIALIEASHVLRKE 236

Query: 126 QKKQL------------------ASYGDKINWYTSLADVPLG----FTFLVANEFFDSLP 163
           Q K L                    + + I W+ +  D+  G      F+VA+EFFD+LP
Sbjct: 237 QWKLLCNPEDPMETTGEGYNRSATKWNNDIIWFDTEKDIQQGDKNVANFIVAHEFFDALP 296

Query: 164 IKQFVMTEHGIRERMIDIDQHDSLVFNI-----------GDHEIKSNFLTCSDYFLGAIF 212
           IK F+  E G RE ++   +H   V N            G ++ +++    +++ L    
Sbjct: 297 IKSFIREEKGWRELVV---EHTPSVNNTQPKLEESTSARGANKFETDDSLDTEFHLTIAP 353

Query: 213 ENSP----------------------CRDREM------QSISDRLACDGGTAIVIDYGYL 244
           + +P                      C D E+      + +SD  + D G  +VIDYG  
Sbjct: 354 KETPSSMIPQISKRYRDLPVGTRIEICPDAELYIMKMAKLLSD--SNDKGAILVIDYGTE 411

Query: 245 QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI-LYKLYINGLTTQGKFLE 303
                ++L+ +  H +VSP  NPG+ DLS  VDFQ L  +   +  +Y  G   QG +L 
Sbjct: 412 NEIPENSLRGIYQHKFVSPFWNPGEVDLSIDVDFQALKQLTEGIVDIY--GPLKQGDWLH 469

Query: 304 GLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            +GI  R   ++K+  +   + D +        D + MG ++K + +
Sbjct: 470 NIGIGYRIDQVLKKNEQDPEVQDKIYGAYRRLTDGEQMGSIYKFMAL 516


>gi|254702246|ref|ZP_05164074.1| hypothetical protein Bsuib55_15501 [Brucella suis bv. 5 str. 513]
          Length = 191

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 109/186 (58%), Gaps = 4/186 (2%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQHDS 186
           +++ D 
Sbjct: 186 LNEQDE 191


>gi|221091699|ref|XP_002170346.1| PREDICTED: similar to CG17726 CG17726-PA, partial [Hydra
           magnipapillata]
          Length = 312

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/302 (34%), Positives = 155/302 (51%), Gaps = 42/302 (13%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           G MTV  Y    + +P++GYY   + FGA GDF T+PEISQ+FGE++ I+ +  W Q G 
Sbjct: 3   GPMTVANYMKEALTNPKWGYYMKNDVFGAKGDFTTSPEISQMFGELIGIWFVAQWIQIGK 62

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL------ 130
           P  V+LVELGPGRG +M DILRV+ K  P+  S   +  VE SE++  +QK+ L      
Sbjct: 63  PCGVQLVELGPGRGTLMADILRVM-KQFPETLSNFEVNFVEVSEKMISLQKQNLDISHEK 121

Query: 131 -----ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTE-------HGIR--- 175
                   G K++W+T + DVP G TF +A+EFFD+LP+  F + +         IR   
Sbjct: 122 KDFYITPSGTKVSWFTHVQDVPKGLTFYLAHEFFDALPVHLFKLLDLVLSPGLTNIRNVN 181

Query: 176 -------ERMIDIDQHDSLVFNIGDHEIKSNFLTC-SDYFLGAIFENSPCRDRE------ 221
                  + M+D  +    +      E +   +T      +   F NS     E      
Sbjct: 182 PFAQIPPDTMMDFGKFRLFIIGYCQSENELQLVTAPGPSPVAKTFLNSETNADECEVCPE 241

Query: 222 ----MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLV-NPGQADLSSHV 276
               M  IS+ ++  GG A++IDYG   S+   +L+  K H  V  +  NPG  D++++V
Sbjct: 242 AAVVMSYISENISMYGGCAMIIDYGESDSQRF-SLRGYKNHVLVDNIFKNPGSCDITANV 300

Query: 277 DF 278
           DF
Sbjct: 301 DF 302


>gi|50550583|ref|XP_502764.1| YALI0D12859p [Yarrowia lipolytica]
 gi|49648632|emb|CAG80952.1| YALI0D12859p [Yarrowia lipolytica]
          Length = 495

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 121/405 (29%), Positives = 185/405 (45%), Gaps = 69/405 (17%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           I++ G M+V  +   C+ +P  GYY   +P GA GDF T+PEISQ+FGE++ ++L   W 
Sbjct: 57  IEQQGPMSVATFMKHCLTNPSGGYYIDKDPLGAKGDFTTSPEISQMFGELVGLWLAAQWL 116

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFF--SVLSIYMVETSERLTLIQKKQL 130
            +G     R++E GPGRG +M D LR +   K      ++  + +VE S  L   Q+K+L
Sbjct: 117 YYGQKQPFRVIEYGPGRGTLMDDSLRALVSAKSTGAKEALKEVLLVEASPVLRDAQRKKL 176

Query: 131 ------------------ASYGDKINWYT--------SLADVPLGFTFLVANEFFDSLPI 164
                               YG  I WY         + ++ PL   ++VA+EFFD+LPI
Sbjct: 177 CGAESQFKTEEDGSITCVTKYGVPIRWYEDSKMLDKLASSNDPL-HNYIVAHEFFDALPI 235

Query: 165 KQFVMTEHGIRERMIDI----DQHDSLVFNIGDHEIKS-----------NFLTCSDYFLG 209
            QF  T+ G RE M++        +S +   G   IKS           + +T   + + 
Sbjct: 236 YQFEKTDKGWRELMVNYGVENKTKESSILLPGQTHIKSSDLDKDKKKTFHLVTAPTWTVA 295

Query: 210 A-IFENSPCRDREMQSISD---------------RLACDGGTAIVIDYGYLQSRVGDTLQ 253
           + +   S  R R++   S                RL   GG A ++DY        +TL+
Sbjct: 296 SKVIPQSHKRYRDLPEWSKIEVCPDAWDVANQMGRLVAKGGAAFIVDYAVKPGVPVNTLR 355

Query: 254 AVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYIN----GLTTQGKFLEGLGIWQ 309
            ++ H   SP   PG+ DLS+ VDF  +  IA   K   N    G   Q  +L+ +GI  
Sbjct: 356 GIRDHKICSPFEEPGKVDLSADVDFTAI-GIASRSKNKENVSAFGPINQATWLKNMGIEM 414

Query: 310 RAFSLM--KQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
           R   LM  K+   K  +    KRLV    +   MG+++K   ++H
Sbjct: 415 RTEKLMEGKEEYIKKRIESQYKRLVDIGIN--GMGKIYKAFFLTH 457


>gi|256016559|emb|CAR63575.1| hypothetical protein [Angiostrongylus cantonensis]
          Length = 445

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 182/378 (48%), Gaps = 46/378 (12%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP----FGAVGDFVTAPEISQIFG 60
           L R I++ I+  G +TV +Y    V+ P  GYY   +     FG  GDFVTAPE++Q+FG
Sbjct: 41  LKRFIIDKIRATGPITVAEYMKTVVSAPRIGYYGGFSESRKIFGKEGDFVTAPELTQLFG 100

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV----LSIYMV 116
           E++ ++        G      LVE GPG G +M DILRV+   +    SV     S  ++
Sbjct: 101 ELVGVWCYYELANTGHHGPWLLVECGPGTGQLMSDILRVMVNFQEKNVSVHLVECSDALI 160

Query: 117 ETSERLTLIQ-------------------KKQLASYGDKINWYTSLADVPLGFTFLVANE 157
           E  ERL   +                   KK ++  G  I WY ++ D+P  F+  V+NE
Sbjct: 161 EQQERLLCGRCGFLPSSESQKSDDSASYVKKSVSKSGVPIYWYKTIDDIPDQFSVFVSNE 220

Query: 158 FFDSLPIKQFVMTEHGI-RERMIDIDQHDSLVF------NIGDHEIKSNFLTCSDYFLGA 210
           F DSLP+ QF    +G   E  ++ID+ + L F      N+    +    +   D  +  
Sbjct: 221 FLDSLPVHQFSRDSNGTWNEVYVNIDKANELCFMRSRGENLHTRGLIPVNIRYDDQRIH- 279

Query: 211 IFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQA 270
            +E SP     +   ++R+ C+GG  I+IDYG+  SR   + +  K H  V PL  PG  
Sbjct: 280 -WECSPEAGTFINQTTNRIICNGGFGIIIDYGHDGSRNDLSFRGYKKHEQVHPLSQPGAI 338

Query: 271 DLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK---QTARKDILLDS 327
           DL++ V+F  L S+ +  +  + G  TQ +FL  +GI  R   L+K   +  +++ L+ S
Sbjct: 339 DLTADVNFGYLKSL-VADRAAVYGPNTQREFLGQMGIELRLRKLLKSCNEREKQESLIKS 397

Query: 328 VKRLVSTSADKKSMGELF 345
              L+        MGE F
Sbjct: 398 YNFLMG------DMGERF 409


>gi|261752817|ref|ZP_05996526.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 5 str. 513]
 gi|261742570|gb|EEY30496.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis
           bv. 5 str. 513]
          Length = 189

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 77/184 (41%), Positives = 108/184 (58%), Gaps = 4/184 (2%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           L  ++  LI   G ++V  Y A C+ D E GYY+T  PFG  GDF+TAPE+SQ+FGE++ 
Sbjct: 6   LKERLKRLIATTGPISVADYMAACLGDREAGYYTTREPFGREGDFITAPEVSQMFGELIG 65

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ +  W+    P+   L E+GPGRG +M D+LR I +L P       I MVETS RL  
Sbjct: 66  IWCLSEWDALARPANFVLCEIGPGRGTLMSDMLRTIGRLAPQMLGGARIAMVETSPRLAE 125

Query: 125 IQKKQLASYGDKINWYTSLADVPL----GFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
            QK++LA     + W+   AD+P     G   LV NE FD++P +QFV  +    ERMI 
Sbjct: 126 KQKQKLAGTKAHVEWFERFADIPADTVHGPLILVTNELFDAIPFRQFVKADGRFVERMIA 185

Query: 181 IDQH 184
           +++ 
Sbjct: 186 LNEQ 189


>gi|154337892|ref|XP_001565172.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134062219|emb|CAM36607.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 416

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 182/373 (48%), Gaps = 33/373 (8%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPF--GAVGDFVTAPEISQIF 59
           +  L  ++VN I   G   + Q+   C+  P++GYY+       G   DF+TA EI   F
Sbjct: 25  KTALCNELVNKITAQGYYPMSQFIKDCLTHPQYGYYAAKKHVIGGEKADFITAAEIP-FF 83

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G++LA +++ AW++ G P  + LVE+GPGRG +M  +L+ I    P     L I+++E  
Sbjct: 84  GDVLAAWVMDAWQKMGTPRVLHLVEMGPGRGTLMKTMLKQIQYSNPHLVHFLQIHLIEVG 143

Query: 120 ERLTLIQKKQLASYGD---KINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHGI 174
                 QK+ LA++     KI W+  L  +P     T  +ANE+FD+LP+ QF  TE G 
Sbjct: 144 AARREEQKRALAAFQTAQGKIKWWMDLESLPFSLEPTVFIANEYFDALPVAQFRYTERGW 203

Query: 175 RERMIDID------QHDSLVFNIGDHEIKSNFLTCSDYFL----GAIFENSPCRDREMQS 224
            E  +++D       H  LV         S +L   D       G   E +    + M++
Sbjct: 204 VETCVEVDTDPGTEAHFRLVHAPSGS--MSAYLIPDDVRTKGKSGDCVEVNTVGMQTMET 261

Query: 225 ISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
           +  ++  C     ++IDYG     +  TL+ ++GH +V PL++PG+ DLS  V F++L  
Sbjct: 262 LMKKMMDCQKAACLLIDYGK-DDHMHSTLRGIRGHRFVDPLLSPGEVDLSCWVSFRQLRW 320

Query: 284 IAILYKLYINGLT-----TQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVSTSA 336
           +    ++    L      TQ  FL   GI  R   ++K    K  +  L + +RL+    
Sbjct: 321 VLERLEVARRHLKWFPVMTQHDFLLENGIDVRLAHVIKDEETKTAMKVLQNYRRLM---- 376

Query: 337 DKKSMGELFKILV 349
           DK+ MGE +K+  
Sbjct: 377 DKEEMGESYKVFA 389


>gi|308804846|ref|XP_003079735.1| ATP synthase beta subunit/transcription termination factor rho-like
           (ISS) [Ostreococcus tauri]
 gi|116058192|emb|CAL53381.1| ATP synthase beta subunit/transcription termination factor rho-like
           (ISS) [Ostreococcus tauri]
          Length = 457

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 116/411 (28%), Positives = 181/411 (44%), Gaps = 87/411 (21%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHG 75
            G + V +Y   C+ +PE GYY   + FG  GDFVT+PEISQ+FGE+L ++     E  G
Sbjct: 26  GGSIPVSEYVRECLTNPEHGYYMRGDVFGRDGDFVTSPEISQVFGEVLGVWAALQHEALG 85

Query: 76  FPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL----- 130
            P  +R+VE GPGRG +M D+LR   K +  F S +S++++E S  L  +Q + L     
Sbjct: 86  SPGTLRVVEFGPGRGTLMADLLRGTSKFE-KFRSAVSVHLIEVSPALREVQARTLRCVDV 144

Query: 131 ----------------------ASYGD-------------------------KINWYTSL 143
                                 A  G+                         K+ W+  L
Sbjct: 145 ETTSAAADDGGARVRVPKNALEAEEGEVDKRSAADGPSGEAHTRGTSEISGAKVFWHDGL 204

Query: 144 ADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH--------------DSLVF 189
             VP G T ++ +EFFD+LP++QF  T+ G  E+++ ID                  L  
Sbjct: 205 ESVPNGPTLVICHEFFDALPVRQFQRTDRGWCEKLVTIDAELASTAETVEETTPRRELAM 264

Query: 190 NIGDHEIKSNFLTCSDYFLG---------AIFENSPCRDREMQSISDRLACDGGTAIVID 240
            +      ++ +       G          + E SP        ++DR+  + G  + ID
Sbjct: 265 VLSPGPTPASHMLVPRRLKGLPKEQVDSLRLLELSPPSMTLWDKLADRIEKNSGAVLAID 324

Query: 241 YGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
           YG  +  +G+TL+A+K H +V  L +PG+ADLS++VDF  L    I+ +    G+T  G 
Sbjct: 325 YGE-EGPLGNTLEAIKDHKFVHVLDSPGEADLSAYVDFGALRQ--IVEEKPQRGVTCYGP 381

Query: 301 FLEGLGIW-----QRAFSLMKQTARKD---ILLDSVKRLVSTSADKKSMGE 343
             +   +       R   L++  A +D    L+   +RLV   A     GE
Sbjct: 382 VTQQQLLLSLGLVARLEQLVENAASEDQANALVKGCERLVGDGAGNAETGE 432


>gi|72392599|ref|XP_847100.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|62175613|gb|AAX69746.1| hypothetical protein, conserved [Trypanosoma brucei]
 gi|70803130|gb|AAZ13034.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain
           927/4 GUTat10.1]
          Length = 428

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 112/382 (29%), Positives = 189/382 (49%), Gaps = 47/382 (12%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGA-VGDFVTAPEISQI 58
           ++  L  ++++ +   G   + Q+   C+  P+ GYYST  N  G+   DF+TA EI   
Sbjct: 41  LKTPLCVELISKMSSQGYFPMSQFVKECLTHPQHGYYSTKKNVIGSEKADFITAAEIP-F 99

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           F ++++ +++  W++ G P  + LVELGPGRG +M +IL+ I    P     L I++VE 
Sbjct: 100 FADIVSAWIMDVWQKMGTPRVLHLVELGPGRGTLMKNILKQIKYSNPHLLHFLQIHLVEV 159

Query: 119 SERLTLIQKKQLASY---GDKINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHG 173
               T  Q+  L+ +     KI W+  L  +PL    T  +ANE+FD+LP+ QF  TE G
Sbjct: 160 GAARTDEQRSALSEFQTAQKKIKWWMGLESIPLTLEPTVYIANEYFDALPVAQFRYTERG 219

Query: 174 IRERMIDIDQHDSLVFNIGDHEIK-----------SNFLTCSDYF----LGAIFENSPCR 218
             E  +++D+  +       HE             S +L  +D      +G   E +   
Sbjct: 220 WVETCLEVDEDPA-------HEAHFRMVHAPSGSFSAYLIPNDVRANGKIGDCIEINAVG 272

Query: 219 DREMQSISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
            + M+ I  ++  C     +++DYG     +  TL+ ++GH +V PL++PG+ DLSS V 
Sbjct: 273 MQTMELIMKKMVECQKSACLIVDYGK-DEHMHSTLRGIRGHRFVDPLLSPGEVDLSSWVS 331

Query: 278 F-------QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSV 328
           F       +RL +     K +   + +Q +FL+  GI  R   ++K    K  +  L + 
Sbjct: 332 FKQLRWSMERLETARRHLKWF--PVISQSEFLQWGGIDVRLAHVIKDEETKSAMKILQNY 389

Query: 329 KRLVSTSADKKSMGELFKILVV 350
           +RL+    DK  MGE +K+  +
Sbjct: 390 RRLM----DKNEMGESYKVFAL 407


>gi|261330287|emb|CBH13271.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 428

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 112/382 (29%), Positives = 189/382 (49%), Gaps = 47/382 (12%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGA-VGDFVTAPEISQI 58
           ++  L  ++++ +   G   + Q+   C+  P+ GYYST  N  G+   DF+TA EI   
Sbjct: 41  LKTPLCVELISKMSSQGYFPMSQFVKECLTHPQHGYYSTKKNVIGSEKADFITAAEIP-F 99

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           F ++++ +++  W++ G P  + LVELGPGRG +M +IL+ I    P     L I++VE 
Sbjct: 100 FADIVSAWIMDVWQKMGTPRVLHLVELGPGRGTLMKNILKQIKYSNPHLLHFLQIHLVEV 159

Query: 119 SERLTLIQKKQLASY---GDKINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHG 173
               T  Q+  L+ +     KI W+  L  +PL    T  +ANE+FD+LP+ QF  TE G
Sbjct: 160 GAARTDEQRSALSEFQTAQKKIKWWMGLESIPLTLEPTVYIANEYFDALPVAQFRYTERG 219

Query: 174 IRERMIDIDQHDSLVFNIGDHEIK-----------SNFLTCSDYF----LGAIFENSPCR 218
             E  +++D+  +       HE             S +L  +D      +G   E +   
Sbjct: 220 WVETCLEVDEDPA-------HEAHFRMVHAPSGSFSAYLIPNDVRANGKIGDCIEINAVG 272

Query: 219 DREMQSISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
            + M+ I  ++  C     +++DYG     +  TL+ ++GH +V PL++PG+ DLSS V 
Sbjct: 273 MQTMELIMKKMVECQKSACLIVDYGK-DEHMHSTLRGIRGHRFVDPLLSPGEVDLSSWVS 331

Query: 278 F-------QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSV 328
           F       +RL +     K +   + +Q +FL+  GI  R   ++K    K  +  L + 
Sbjct: 332 FKQLRWSMERLETARRHLKWF--PVISQSEFLQWGGIDVRLAHVIKDEETKSAMKILQNY 389

Query: 329 KRLVSTSADKKSMGELFKILVV 350
           +RL+    DK  MGE +K+  +
Sbjct: 390 RRLM----DKNEMGESYKVFAL 407


>gi|299470317|emb|CBN78367.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 494

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 121/211 (57%), Gaps = 34/211 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEML 63
           L +++  +I  NG MTV +Y    +  P++GYY    +  G  GDF+TAPEISQ FGEM+
Sbjct: 18  LAKELEQMIVLNGPMTVPEYMIYALQHPKYGYYMRQEDKIGRGGDFITAPEISQTFGEMI 77

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
            I+ + +W++ G P   RLVELGPG+G +M+DILR +    PDF   LS++MVETS+ L 
Sbjct: 78  GIWCVASWKEMGSPEEFRLVELGPGKGTLMVDILRTVSSF-PDFRKALSLHMVETSDDLR 136

Query: 124 LIQKKQL-------ASY------------------------GDKINWYTSLADVPLG-FT 151
            +Q K L       ASY                        G ++ W+T++  VP G  +
Sbjct: 137 ALQVKALGATFAPTASYSASRGGGGGGGAKEVGGSPMLLPGGGEVVWHTNIEQVPKGQPS 196

Query: 152 FLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
             +A EF D+LP+ QF  TE+G RER++D++
Sbjct: 197 LFIAQEFLDALPVHQFQYTENGWRERLVDVN 227



 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 83/143 (58%), Gaps = 10/143 (6%)

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +++R+A D G A+ +DYG   + +GD+L+  KGH  V  L +PG+AD+++ V+F  L
Sbjct: 344 VKGVAERIAQDRGGALFVDYGEAHA-LGDSLRCFKGHEEVPVLSDPGEADMTADVNFGLL 402

Query: 282 SS-IAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARK-DILLDSVKRLVSTSA 336
              +A +     +G   QG+FL  +GI  R  +L +Q   TA + D +L+   RLV    
Sbjct: 403 RRVVAGVEGARPHGPVGQGQFLREMGIGARLTALAEQPHVTAEQADAMLEGYVRLV---- 458

Query: 337 DKKSMGELFKILVVSHEKVELMP 359
           D   MG  +K+L +S E+ E+ P
Sbjct: 459 DPAQMGVRYKVLGISEERQEMPP 481


>gi|322499230|emb|CBZ34302.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 447

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 115/375 (30%), Positives = 186/375 (49%), Gaps = 37/375 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGA-VGDFVTAPEISQIF 59
           +  L  ++VN I   G   + Q+   C+  P++GYY+   N  G+   DF+TA EI   F
Sbjct: 56  KTALCNELVNKITAQGYYPMSQFVKDCLTHPQYGYYAAKKNVIGSEKADFITAAEIP-FF 114

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G++LA +++ AW++ G P  + LVE+GPGRG +M  +L+ I    P     L I++VE  
Sbjct: 115 GDVLAAWVMDAWQKMGTPRVLHLVEMGPGRGTLMRTMLKQIQYSNPHLLHFLQIHLVEVG 174

Query: 120 ERLTLIQKKQLASYGD---KINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHGI 174
                 QK+ L  +     KI W+  L  +P     T  +ANE+FD+LP+ QF  TE G 
Sbjct: 175 AARREEQKRALTEFQTAQGKIKWWMDLESLPFSLEPTVFIANEYFDALPVAQFRYTERGW 234

Query: 175 RERMIDID------QHDSLVF----NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS 224
            E  +++D       H  LV     ++  + I  +  T      G   E +    + M++
Sbjct: 235 VETCVEVDTDPGTEAHFRLVHAPSGSMSAYLIPDDIRTKGK--TGDCVEVNTVGMQTMET 292

Query: 225 ISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
           +  ++  C     ++IDYG     +  TL+ ++GH +V PL++PG+ DLS  V F++L  
Sbjct: 293 LMKKMIDCQKAACLLIDYGK-DDHMHSTLRGIRGHRFVDPLLSPGEVDLSCWVSFRQLR- 350

Query: 284 IAILYKLYIN-------GLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVST 334
              L +L +         + TQ +FL   GI  R   ++K    K  L  L + +RL+  
Sbjct: 351 -WALERLEVARRHLKWFPVMTQHEFLLENGIDIRLAHVIKDEETKTALKVLQNYRRLM-- 407

Query: 335 SADKKSMGELFKILV 349
             DK+ MGE +K+  
Sbjct: 408 --DKEEMGESYKVFA 420


>gi|146087293|ref|XP_001465782.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134069882|emb|CAM68210.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 447

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/375 (30%), Positives = 185/375 (49%), Gaps = 37/375 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGA-VGDFVTAPEISQIF 59
           +  L  ++VN I   G   + Q+   C+  P++GYY+   N  G+   DF+TA EI   F
Sbjct: 56  KTALCNELVNKITAQGYYPMSQFVKDCLTHPQYGYYAAKKNVIGSEKADFITAAEIP-FF 114

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G++LA +++ AW++ G P  + LVE+GPGRG +M  +L+ I    P     L I++VE  
Sbjct: 115 GDVLAAWVMDAWQKMGTPRVLHLVEMGPGRGTLMRTMLKQIQYSNPHLLHFLQIHLVEVG 174

Query: 120 ERLTLIQKKQLASYGD---KINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHGI 174
                 QK+ L  +     KI W+  L  +P     T  +ANE+FD+LP+ QF  TE G 
Sbjct: 175 AARREEQKRALTEFQTAQGKIKWWMDLESLPFSLEPTVFIANEYFDALPVAQFRYTERGW 234

Query: 175 RERMIDID------QHDSLVF----NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS 224
            E  +++D       H  LV     ++  + I  +  T      G   E +    + M++
Sbjct: 235 VETCVEVDTDPGTEAHFRLVHAPSGSMSAYLIPDDIRTKGK--TGDCVEVNTVGMQTMET 292

Query: 225 ISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
           +  ++  C     ++IDYG     +  TL+ ++GH +V PL++PG+ DLS  V F++L  
Sbjct: 293 LMKKMIDCQKAACLLIDYGK-DDHMHSTLRGIRGHRFVDPLLSPGEVDLSCWVSFRQLR- 350

Query: 284 IAILYKLYIN-------GLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVST 334
              L +L +         + TQ  FL   GI  R   ++K    K  L  L + +RL+  
Sbjct: 351 -WALERLEVARRHLKWFPVMTQHDFLLENGIDIRLAHVIKDEETKTALKVLQNYRRLM-- 407

Query: 335 SADKKSMGELFKILV 349
             DK+ MGE +K+  
Sbjct: 408 --DKEEMGESYKVFA 420


>gi|323455216|gb|EGB11085.1| hypothetical protein AURANDRAFT_11471 [Aureococcus anophagefferens]
          Length = 386

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 177/391 (45%), Gaps = 66/391 (16%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNP---FGAVGDFVTAPEISQIFGEMLAIFLIC 69
           I   G ++V +Y   C+  P  GYY+       FGA GDFVTAPE+SQ+FGE++ ++ + 
Sbjct: 9   ILARGPLSVYEYMRQCLLHPRHGYYARSGAERNFGAGGDFVTAPELSQLFGELVGVWFVS 68

Query: 70  AWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLS-IYMVETSERLTLIQKK 128
            W + G P  VRLVE+GPGRG ++ D+LR      P F    S + +VE S  L L Q++
Sbjct: 69  EWVRLGEPEKVRLVEVGPGRGTLLGDVLRATAAW-PKFRRAASDVRLVEPSASLRLAQRR 127

Query: 129 QLAS------------------------YGDKINWYTSLAD-----VPLGFTFLVANEFF 159
            L +                        +G +  W+ SL +     VP   T LV  E  
Sbjct: 128 TLGARPATHAQKPDAETPVTWALDGFGDFGTRATWHESLDEIDDDGVP---TLLVGQEVL 184

Query: 160 DSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRD 219
           D+ P  QFV T++G RE+++D+       F      +  +    S     A   +   +D
Sbjct: 185 DAFPAYQFVKTDNGWREKLVDLADAGPDRFRF---VLAPSPTPASRALAAADAPSLATKD 241

Query: 220 REMQSISDRLACDGGTAIV----------------IDYGYLQSRVGDTLQAVKGHTYVSP 263
            E +++       G  A V                +DYGY + + GDTL+  + H  VSP
Sbjct: 242 GEAETLE---VAPGALAFVDAVAAKVAKAGGAALFVDYGYARGQRGDTLRGFRRHAQVSP 298

Query: 264 LVNPGQADLSSHVDFQRLSS-IAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKD 322
           L  PG  DL+   DF       A +      G   QG++L+ +GI  R  +L+      D
Sbjct: 299 LREPGLVDLTVDADFGACGDRAAAVDGAAAFGAVDQGEWLQRMGIVPRLEALLNL---DD 355

Query: 323 ILLDSVKRLVSTSA---DKKSMGELFKILVV 350
           I    V+ L+S      D + MGE +K+L V
Sbjct: 356 ITESQVEDLISACERLLDPEQMGERYKVLAV 386


>gi|261192102|ref|XP_002622458.1| DUF185 domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
 gi|239589333|gb|EEQ71976.1| DUF185 domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
          Length = 512

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 133/450 (29%), Positives = 193/450 (42%), Gaps = 101/450 (22%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-------CNPFGAVGDFVTAPEI 55
             L + +   I   G +++  Y   C+  P+ GYY++          FG  GDFVT+PEI
Sbjct: 49  TPLAKSLGEAISVTGPVSIAAYMRQCLTSPDGGYYTSRGQEAEDTELFGTKGDFVTSPEI 108

Query: 56  SQIFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY 114
           SQIFGE+L I+ +  W   G  S  V+++E GPG+G +M D+LR     K    ++ ++Y
Sbjct: 109 SQIFGELLGIWTVAEWMGQGRKSGGVQIIEFGPGKGTLMGDMLRCFRNFKSFASTIEAVY 168

Query: 115 MVETSERLTLIQKKQL----------ASYGDK-------INWYTS---LADVPLGFTFLV 154
           +VE S  L  +Q+K L          A Y  K       I W      L D P    F+ 
Sbjct: 169 LVEASPVLREVQRKLLCGDAPMEEVEAGYKSKSIHLGVPIVWAEHISFLPDEPDKTPFIF 228

Query: 155 ANEFFDSLPIKQFVMTEHGIRERMID------------------IDQHDSLVF--NIGDH 194
           A+EFFD+LPI  F   E   + + I+                    Q   LV   N    
Sbjct: 229 AHEFFDALPIHAFQSVEVPSQPQTINSPTGPITLHQSSAPSSSTTTQWRELVVSPNPETP 288

Query: 195 EIKSN-----------FLTCSDYFL--------------GAIFENSPCRDREMQSISDRL 229
           E+KS+             T S   L              G+  E SP     +Q I+ R+
Sbjct: 289 EVKSSKEPEFRLSLAKASTPSSLILPEMSPRYKALKSTPGSTIEISPESQTCVQDIAKRI 348

Query: 230 -----------ACDG-------GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
                      A D        G A+++DYG   +   ++L+ ++ H  VSP   PGQ D
Sbjct: 349 GGAFTSPSSPAATDAKKNKVPSGAALILDYGTTSTIPINSLRGIRKHQLVSPFAAPGQVD 408

Query: 272 LSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT------ARKDI 323
           +S+ VDF  L+  AI     + + G T QG FLE LGI +RA  L+K+        ++  
Sbjct: 409 VSADVDFTALAEAAIDASPGVEVYGPTEQGAFLEALGISERAAQLLKKVEGEGDEEKRKR 468

Query: 324 LLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           +    KRLV        MG L+K L +  E
Sbjct: 469 IESGWKRLVERGGG--GMGRLYKALAIVPE 496


>gi|239615053|gb|EEQ92040.1| DUF185 domain-containing protein [Ajellomyces dermatitidis ER-3]
          Length = 512

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 133/450 (29%), Positives = 193/450 (42%), Gaps = 101/450 (22%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-------CNPFGAVGDFVTAPEI 55
             L + +   I   G +++  Y   C+  P+ GYY++          FG  GDFVT+PEI
Sbjct: 49  TPLAKSLGEAISVTGPVSIAAYMRQCLTSPDGGYYTSRGQEAEDTELFGTKGDFVTSPEI 108

Query: 56  SQIFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY 114
           SQIFGE+L I+ +  W   G  S  V+++E GPG+G +M D+LR     K    ++ ++Y
Sbjct: 109 SQIFGELLGIWTVAEWMGQGRKSGGVQIIEFGPGKGTLMGDMLRCFRNFKSFASTIEAVY 168

Query: 115 MVETSERLTLIQKKQL----------ASYGDK-------INWYTS---LADVPLGFTFLV 154
           +VE S  L  +Q+K L          A Y  K       I W      L D P    F+ 
Sbjct: 169 LVEASPVLREVQRKLLCGDAPMEEVEAGYKSKSIHLGVPIVWAEHISFLPDEPDKTPFIF 228

Query: 155 ANEFFDSLPIKQFVMTEHGIRERMID------------------IDQHDSLVF--NIGDH 194
           A+EFFD+LPI  F   E   + + I+                    Q   LV   N    
Sbjct: 229 AHEFFDALPIHAFQSVEVPSQPQTINSPTGPITLHQSSAPSSSTTTQWRELVVSPNPETP 288

Query: 195 EIKSN-----------FLTCSDYFL--------------GAIFENSPCRDREMQSISDRL 229
           E+KS+             T S   L              G+  E SP     +Q I+ R+
Sbjct: 289 EVKSSKEPEFRLSLAKASTPSSLILPEMSPRYKALKSTPGSTIEISPESQTCVQDIAKRI 348

Query: 230 -----------ACDG-------GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
                      A D        G A+++DYG   +   ++L+ ++ H  VSP   PGQ D
Sbjct: 349 GGAFTSPSSPAATDAKKNKVPSGAALILDYGTTSTIPINSLRGIRKHQLVSPFAAPGQVD 408

Query: 272 LSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT------ARKDI 323
           +S+ VDF  L+  AI     + + G T QG FLE LGI +RA  L+K+        ++  
Sbjct: 409 VSADVDFTALAEAAIDASPGVEVYGPTEQGAFLEALGISERAAQLLKKVEGEGDEEKRKR 468

Query: 324 LLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           +    KRLV        MG L+K L +  E
Sbjct: 469 IESGWKRLVERGGG--GMGRLYKALAIVPE 496


>gi|157869746|ref|XP_001683424.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68126489|emb|CAJ04517.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 447

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 185/373 (49%), Gaps = 33/373 (8%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGA-VGDFVTAPEISQIF 59
           +  L  ++VN I   G   + Q+   C+  P++GYY+   N  G+   DF+TA EI   F
Sbjct: 56  KTALCNELVNKITAQGYYPMSQFVKDCLTHPQYGYYAAKKNVIGSEKADFITAAEIP-FF 114

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G++LA +++ AW++ G P  + LVE+GPGRG +M  +L+ I    P     L I++VE  
Sbjct: 115 GDVLAAWVMDAWQKMGTPRVLHLVEMGPGRGTLMRTMLKQIQYSNPHLLHFLQIHLVEVG 174

Query: 120 ERLTLIQKKQLASYGD---KINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHGI 174
                 QK+ LA +     KI W+ +L  +P     T  +ANE+FD+LP+ QF  TE G 
Sbjct: 175 AARREEQKRALAEFQTAQGKIKWWMNLESLPFSLEPTVFMANEYFDALPVAQFRYTERGW 234

Query: 175 RERMIDID------QHDSLVF----NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS 224
            E  +++D       H  LV     ++  + I  +  T      G   E +    + +++
Sbjct: 235 VETCVEVDTDPGTEAHFRLVHAPSGSMSAYLIPDDIRTKGK--TGDCVEVNTVGMQTIET 292

Query: 225 ISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
           +  ++  C     ++IDYG     +  TL+ ++GH +V PL++PG+ DLS  V F++L  
Sbjct: 293 LMKKMMDCQKAACLLIDYGK-DDHMHSTLRGIRGHRFVDPLLSPGEVDLSCWVSFRQLRW 351

Query: 284 IAILYKLYINGLT-----TQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVSTSA 336
                ++    L      TQ  FL   GI  R   ++K    K  +  L + +RL+    
Sbjct: 352 ALERLEVARQHLKWFPVMTQHDFLLENGIDIRLAHVIKDEETKTAMKVLQNYRRLM---- 407

Query: 337 DKKSMGELFKILV 349
           DK+ MGE +K+  
Sbjct: 408 DKEEMGESYKVFA 420


>gi|322491965|emb|CBZ27238.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 470

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/375 (30%), Positives = 186/375 (49%), Gaps = 37/375 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGA-VGDFVTAPEISQIF 59
           +  L  ++VN I   G   + Q+   C+  P++GYY+   N  G+   DF+TA EI   F
Sbjct: 79  KTALCNELVNKITAQGYYPMSQFVKDCLTHPQYGYYAAKKNVIGSEKADFITAAEIP-FF 137

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G++LA +++ AW++ G P  + LVE+GPGRG +M  +L+ I    P     L I++VE  
Sbjct: 138 GDVLAAWVMDAWQKMGTPRVLHLVEMGPGRGTLMRTMLKQIQYSNPHLLHFLQIHLVEVG 197

Query: 120 ERLTLIQKKQLASYGD---KINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHGI 174
                 QK+ LA +     KI W+  L  +P     T  +ANE+FD+LP+ QF  TE G 
Sbjct: 198 AARREEQKRALAEFQTAQGKIKWWMDLESLPFSLEPTVFIANEYFDALPVAQFRYTERGW 257

Query: 175 RERMIDID------QHDSLVF----NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS 224
            E  +++D       H  LV     ++  + I  +  T      G   E +    + M++
Sbjct: 258 VETCVEVDTDPGTEAHFRLVHAPSGSMSAYLIPDDIRTKGKK--GDCVEVNTVGMQTMET 315

Query: 225 ISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
           +  ++  C     ++IDYG     +  TL+ ++GH +V PL++PG+ DLS  V F++L  
Sbjct: 316 LMKKMIDCQKAACLLIDYGK-DDHMHSTLRGIRGHRFVDPLLSPGEVDLSCWVSFRQLR- 373

Query: 284 IAILYKLYIN-------GLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVST 334
              L +L +         + TQ  FL   GI  R   ++K    K  +  L + +RL+  
Sbjct: 374 -WALERLEVARRHLKWFPVMTQHDFLLENGIDIRLAHVIKDEETKAAMKVLQNYRRLM-- 430

Query: 335 SADKKSMGELFKILV 349
             DK+ MG+ +K+  
Sbjct: 431 --DKEEMGDSYKVFA 443


>gi|134083408|emb|CAK46886.1| unnamed protein product [Aspergillus niger]
          Length = 512

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 134/454 (29%), Positives = 202/454 (44%), Gaps = 111/454 (24%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-----FGAVGDFVTAPEISQIF 59
           L + + N IK  G + +  +    + +PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 49  LAQTLANAIKVTGPVPIAAFMRQVLTNPEGGYYTTRPEGHGAVFGKKGDFVTSPEISQVF 108

Query: 60  GEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ I+ I  W   G   S V+L+E+GPG+G +M D+LR     K    S+ +IY+VE 
Sbjct: 109 GELVGIWTIAEWMAQGRKRSGVQLMEVGPGKGTLMDDMLRTFRNFKMFSSSMEAIYLVEA 168

Query: 119 SERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVAN 156
           S  L  +QKK L   GD +   T +         DVP+ +               F+ A+
Sbjct: 169 SATLREVQKKLLC--GDAVMEATDIGHKSTCKYFDVPIVWVEDIRLLPHEEEKTPFIFAH 226

Query: 157 EFFDSLPIKQF---------------VMTEHGI---------------RERMIDIDQHDS 186
           EFFD+LPI  F               +MT  G                RE M+ ++   +
Sbjct: 227 EFFDALPIHAFESIPPSPENQPEQKEIMTPTGPAKLHQPLKPANTPQWREIMVTLNP-KA 285

Query: 187 LVFNI-GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSI-------------------- 225
           +  NI G+ E K      S      I E SP R R ++S                     
Sbjct: 286 VEENIEGEPEFKLTLAKASTPSSLVIPEISP-RYRALKSQPGSTIEVSPESRIYAADFAR 344

Query: 226 -------SDRLACDG--------------GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPL 264
                    R A  G              G A+++DYG L +   ++L+ ++ H  V PL
Sbjct: 345 RIGGASEPPRTATKGAAASAPAPAKRVSSGAALIMDYGTLNTIPINSLRGIQEHKNVPPL 404

Query: 265 VNPGQADLSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQT---A 319
            +PGQ D+S+ VDF  L+  AI     + ++G   QG FL+ +GI +R   L+K+     
Sbjct: 405 SSPGQVDVSADVDFTALAEAAIEASEGVEVHGPVEQGDFLQAMGIEERMQQLLKKVEDEE 464

Query: 320 RKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           ++  L    KRLV       SMG+++K++ +  E
Sbjct: 465 KRKTLETGWKRLVEKGGG--SMGKIYKVMAIVPE 496


>gi|309361569|emb|CAP29424.2| hypothetical protein CBG_09880 [Caenorhabditis briggsae AF16]
          Length = 390

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 154/317 (48%), Gaps = 34/317 (10%)

Query: 28  CVADPEFGYYSTCNP----FGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLV 83
            V+ P  GYY   +     FG  GDF+T+PE++Q+FGEM+ +++       G     +LV
Sbjct: 4   SVSAPVVGYYGQFSRDQKVFGEKGDFITSPELTQLFGEMIGVWVFHELANTGHKGSWQLV 63

Query: 84  ELGPGRGIMMLDILRVICKLKPDFFSV----------------LSIYMVETSERLTLIQK 127
           ELGPGR  +M D+L  + K   +  SV                L IY  E ++    ++K
Sbjct: 64  ELGPGRAQLMNDVLNALAKFNDNDVSVHLVEMSDALIDEQENFLCIYNSENTKGTPHVRK 123

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
            +  + G  I WY S+ D+P GFT  +ANEF D+LP+ QF  T    +E  +++ +   L
Sbjct: 124 NKTRT-GVNIYWYKSIDDIPDGFTVFIANEFLDALPVHQFKKTGDLWKEVYVNLTKEGDL 182

Query: 188 VFNIGDHEIKSNFLTCSDYFLGAI--------FENSPCRDREMQSISDRLACDGGTAIVI 239
            F       K   L        AI        +E SP     +  I DR+   GG ++++
Sbjct: 183 RFMTS----KGENLHTKGLIPAAIRNENSRLTWECSPESGTVVNQIVDRITTFGGFSLLV 238

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG+  SR   + +A K H  V PL NPG  DL++ VDF  L+++ +  +  + G   Q 
Sbjct: 239 DYGHDGSRNTHSFRAYKNHEQVDPLSNPGVVDLTADVDFGYLTTL-VEDRALVYGPIEQR 297

Query: 300 KFLEGLGIWQRAFSLMK 316
            FL  LGI  R   L++
Sbjct: 298 VFLTQLGIEHRLRRLLQ 314


>gi|296421134|ref|XP_002840121.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636333|emb|CAZ84312.1| unnamed protein product [Tuber melanosporum]
          Length = 490

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 121/418 (28%), Positives = 187/418 (44%), Gaps = 74/418 (17%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST------CNPFGAVGDFVTAPEISQI 58
           L R +   I+  G +T+  Y   C+     GYY+T       + FG  GDF+T+PEISQ+
Sbjct: 54  LARYLAEAIEATGPITLAAYMRQCLVSDLGGYYTTERGVGTGDQFGRKGDFITSPEISQV 113

Query: 59  FGEMLAIFLICAW-EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           FGE++ I+++  W  Q      ++++ELGPGRG +M D+ RV+   K    SV +IY+VE
Sbjct: 114 FGELIGIWVVSEWMRQRRQGEKIQIIELGPGRGTLMSDLWRVVLIFKTMADSVEAIYLVE 173

Query: 118 TSERLTLIQK-------------------KQLASYGDKINWYTSLADVPLG---FTFLVA 155
            S  L   QK                   +  AS    I WY   + +P       +++A
Sbjct: 174 ASSSLREAQKVLLCGPKTKMRQIENGFACQSKASPKTDIIWYEDFSFIPRDKDRTPYIIA 233

Query: 156 NEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFN---IGDHEIKSNFLTCS-------- 204
           +EFFD+LPI  F  T++G RE +++             + + E +SN    S        
Sbjct: 234 HEFFDALPIHAFTNTDNGWREMLVNTSPGKGQFITKDGVSELETRSNTPEFSLALANAPT 293

Query: 205 ----------------DYFLGAIFENSPCRDREMQSISDRLACDG-GTAIVIDYGYLQSR 247
                           +    A  E SP     M+ IS R+   G G A+++DYG   + 
Sbjct: 294 PHSILLPPLSQRYKDLEKLKNATIEISPESLGLMEKISQRIGEAGAGAALIMDYGTSDTV 353

Query: 248 VGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGL 305
             ++L+ +  H   SP   PG+ D+S+ VDF  L+  AI    K+ ++G   Q  FL  L
Sbjct: 354 PANSLRGILKHEICSPFSRPGEVDVSADVDFTALAEKAINSSKKVEVHGPVKQRAFLGML 413

Query: 306 GIWQRAFSLMKQ-------------TARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           GI +R   L+++               ++  L     RLV   A    MG ++K L V
Sbjct: 414 GIKERTEFLIRELKEEPSYGWDDGNEEKEKALRLGHDRLVGEHAG--GMGAIYKALAV 469


>gi|312383401|gb|EFR28503.1| hypothetical protein AND_03479 [Anopheles darlingi]
          Length = 483

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 122/380 (32%), Positives = 182/380 (47%), Gaps = 59/380 (15%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAIFLICAW 71
           I+  G +TV  Y    + +P  GYYST +   G+ GDFVTAPEI QIFGE          
Sbjct: 93  IRATGPITVASYMKEVLLNPSAGYYSTKDTVLGSGGDFVTAPEIGQIFGEKF-------- 144

Query: 72  EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL- 130
               +   ++L+ELGPGRG +M D+LRV C+        + +++VE S +L   Q ++L 
Sbjct: 145 ---NYDGHIQLIELGPGRGTLMQDVLRV-CEQFGFTKDRVGVHLVEMSAQLQHTQAERLC 200

Query: 131 ------------------ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVM--- 169
                              + G ++ WY+ +A+VP GF  ++ANEFFD+LP   F     
Sbjct: 201 NGRVERGIPSDCYVQRGTTASGIEVRWYSDVAEVPKGFAVVIANEFFDALPAHVFCKETT 260

Query: 170 --TEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENS----PCRDR--- 220
             +  G   + + ID + +     G   I+SN  T      G  F         R+R   
Sbjct: 261 EGSAGGASWKEVLIDINPAAANGPGFRFIQSNKATPYSVVFGKRFNEMDRLLQGRNRVEV 320

Query: 221 --EM----QSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSS 274
             EM    Q+++ R +  GG  ++IDYG+   ++ DT ++ K H    PLV+PG ADL+ 
Sbjct: 321 SFEMEQIAQNLAQRFSEHGGFGLIIDYGHEGDKM-DTFRSFKDHKLHDPLVSPGVADLTV 379

Query: 275 HVDFQRLSS-IAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA---RKDILLDSVKR 330
            VDF  L   +    K    G  +QG FL+ +    R  +L+K T    R+ IL+     
Sbjct: 380 DVDFGFLKHFLQQDDKAIALGPVSQGAFLKAMQGAARLENLLKATTDEDRRKILVSGYDE 439

Query: 331 LVSTSADKKSMGELFKILVV 350
           L + +     MGE FK+L V
Sbjct: 440 LTNPT----KMGERFKMLSV 455


>gi|226288654|gb|EEH44166.1| DUF185 domain-containing protein [Paracoccidioides brasiliensis
           Pb18]
          Length = 509

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 126/447 (28%), Positives = 187/447 (41%), Gaps = 98/447 (21%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-------CNPFGAVGDFVTAPEI 55
             L + I   I   G +++  Y   C+  P+ GYY++          FGA GDFVT+PEI
Sbjct: 49  TPLAKTIAEAISVTGPISIAAYMRQCLTSPDGGYYTSRGQEAEGTEVFGAKGDFVTSPEI 108

Query: 56  SQIFGEMLAIFLICAWEQHG-FPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY 114
           SQIFGE+L I+ +  W   G     V+++ELGPG+G +M D+LR I   K    ++ ++Y
Sbjct: 109 SQIFGELLGIWTVAEWMGQGRRKGGVQIIELGPGKGTLMADMLRSIRNFKTFASAIEAVY 168

Query: 115 MVETSERLTLIQKKQLAS-----------------YGDKINWYTS---LADVPLGFTFLV 154
           +VE S  L  +Q K L                    G  + W      L D P    F+ 
Sbjct: 169 LVEASTVLREVQHKLLCGDAPTEEIEVGYKSTSVHLGVPVIWTEHIKLLPDEPDKTPFIF 228

Query: 155 ANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGD--------------------H 194
           A+EFFD+LPI  F   E   R + I+     + + N                        
Sbjct: 229 AHEFFDALPIHAFQSIETPPRSQTINTPTGPATLHNPPATSSSPATQWRELVVSPNPEIP 288

Query: 195 EIKSN-----------FLTCSDYFL--------------GAIFENSPCRDREMQSISDRL 229
           E+KS              T S   L              G+  E SP      Q I+ R+
Sbjct: 289 ELKSGNEPEFHLSLAKSPTPSSLVLPEMSPRYKAMKSTPGSTIEISPEGQTCAQDIARRI 348

Query: 230 A---------------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSS 274
                              G A+++DYG   +   ++L+ ++ H  VSP   PGQ D+S+
Sbjct: 349 GGSFSSSSSEQSNKKRVPSGAALILDYGTTSTIPINSLRGIRKHQLVSPFAVPGQVDISA 408

Query: 275 HVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT------ARKDILLD 326
           +VDF  L+  AI     + + G   Q +FLE LGI +RA  L+ +        ++  +  
Sbjct: 409 NVDFTALAEAAIDASPGVEVYGPVEQCQFLEALGISKRASQLLTKVEGEGGEEKRKRIES 468

Query: 327 SVKRLVSTSADKKSMGELFKILVVSHE 353
             KRLV        MG+L+K L +  E
Sbjct: 469 GWKRLVERGGG--GMGKLYKALAIVPE 493


>gi|322827230|gb|EFZ31501.1| hypothetical protein TCSYLVIO_2189 [Trypanosoma cruzi]
          Length = 427

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 111/377 (29%), Positives = 180/377 (47%), Gaps = 37/377 (9%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPF--GAVGDFVTAPEISQI 58
           ++  L  ++++ +   G   + Q+   C+  P+ GYY+           DF+TA EI   
Sbjct: 41  LKTPLCIELISKMSSQGYFPMSQFVKECLTHPQHGYYTAKKHVIGSEKADFITAAEIP-F 99

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           F ++++ +++ AW++ G P    L+ELGPGRG +M +IL+      P     L I++VE 
Sbjct: 100 FADVISAWIMDAWQKMGTPKAFHLIELGPGRGTLMKNILKQTKYSNPHLLHFLQIHLVEV 159

Query: 119 SERLTLIQKKQLASYGD---KINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHG 173
                  QK  LA +     KI W+  L  +P     T  VANE+FD+LP+ QF  TE G
Sbjct: 160 GAARMEEQKSALAEFQTAQGKIKWWMDLESIPFSLEPTIFVANEYFDALPVAQFRYTERG 219

Query: 174 IRERMIDIDQ------HDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQ 223
             E  +++D+      H  +V         S +L  +D      LG   E +    + M+
Sbjct: 220 WVETCLEVDEDPANESHFRMVHAPSGS--FSAYLIPNDIRSRGKLGDCIEVNAVGMQTME 277

Query: 224 SISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF---- 278
            I  ++  C     ++IDYG     +  TL+ ++GH +V PL++PG+ DLSS V F    
Sbjct: 278 LIMKKMVDCQKAACLIIDYGK-DEHMHSTLRGIRGHRFVDPLLSPGEVDLSSWVSFKQLR 336

Query: 279 ---QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVS 333
              +RL +     K +   L TQ +FL+  GI  R   ++K    K  +  L + +RL+ 
Sbjct: 337 WALERLETARRHLKWF--PLMTQREFLQWGGIDVRLAHVIKDEETKTAMKILQNYRRLM- 393

Query: 334 TSADKKSMGELFKILVV 350
              D   MG  +K+ V 
Sbjct: 394 ---DVDEMGNSYKVFVA 407


>gi|71412490|ref|XP_808427.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70872631|gb|EAN86576.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 427

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 110/377 (29%), Positives = 180/377 (47%), Gaps = 37/377 (9%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPF--GAVGDFVTAPEISQI 58
           ++  L  ++++ +   G   + Q+   C+  P+ GYY+           DF+TA EI   
Sbjct: 41  LKTPLCIELISKMSSQGYFPMSQFVKECLTHPQHGYYTAKKHVIGSEKADFITAAEIP-F 99

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           F ++++ +++ AW++ G P    L+ELGPGRG +M +IL+      P     L I++VE 
Sbjct: 100 FADVISAWIMDAWQKMGTPRAFHLIELGPGRGTLMKNILKQTKYSNPHLLHFLQIHLVEV 159

Query: 119 SERLTLIQKKQLASYGD---KINWYTSLADVPLGF--TFLVANEFFDSLPIKQFVMTEHG 173
                  QK  LA +     KI W+  L  +P     T  +ANE+FD+LP+ QF  TE G
Sbjct: 160 GAARMEEQKSALAEFQTAQGKIKWWMDLESIPFSLEPTIFIANEYFDALPVAQFRYTERG 219

Query: 174 IRERMIDIDQ------HDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDREMQ 223
             E  +++D+      H  +V         S +L  +D      LG   E +    + M+
Sbjct: 220 WVETCLEVDEDPANESHFRMVHAPSGS--FSAYLIPNDIRSRGKLGDCIEVNAVGMQTME 277

Query: 224 SISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF---- 278
            I  ++  C     ++IDYG     +  TL+ ++GH +V PL++PG+ DLSS V F    
Sbjct: 278 LIMKKMVDCQKAACLIIDYGK-DEHMHSTLRGIRGHRFVDPLLSPGEVDLSSWVSFKQLR 336

Query: 279 ---QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVS 333
              +RL +     K +   L TQ +FL+  GI  R   ++K    K  +  L + +RL+ 
Sbjct: 337 WALERLETARRHLKWF--PLMTQREFLQWGGIDVRLAHVIKDEETKTAMKILQNYRRLM- 393

Query: 334 TSADKKSMGELFKILVV 350
              D   MG  +K+ V 
Sbjct: 394 ---DVDEMGNSYKVFVA 407


>gi|290984613|ref|XP_002675021.1| hypothetical protein NAEGRDRAFT_80425 [Naegleria gruberi]
 gi|284088615|gb|EFC42277.1| hypothetical protein NAEGRDRAFT_80425 [Naegleria gruberi]
          Length = 442

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 115/383 (30%), Positives = 186/383 (48%), Gaps = 40/383 (10%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC----------NPFGAVGDFVTAPE 54
           +++ + N IK  G ++V  +    + +P +GYY T           N  G  GDFVT+PE
Sbjct: 1   MVKHLKNKIKGAGPISVSTFIQETLLNPIYGYYYTAKKTSLDNSKQNVIGREGDFVTSPE 60

Query: 55  ISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKP----DFF-- 108
           IS +F EM+ ++ +  W + G P  + LVELGPG+G +M D+L  + + K     D F  
Sbjct: 61  ISSVFSEMIGLWCVDMWTKLGKPKQIELVELGPGKGTLMHDLLDSLVQSKNSPTIDAFRQ 120

Query: 109 SVLSIYMVETSERLTLIQKKQLASYGD--KINW------YTSL-ADVPLGFTFLVANEFF 159
           SV  + M E SE L  +QK +L S+ +  + NW      Y+   +++P+    ++A+EFF
Sbjct: 121 SVKKVTMCEASEALKEVQKDKLKSFTETHEFNWIDRFDKYSDFDSNMPV---LIIAHEFF 177

Query: 160 DSLPIKQFVMTEHGIRERMIDID------QHDSLVFNIGDHEIKSNF--LTCSDYFLGAI 211
           D+LP+  F  TE G  E ++DID       H   V + G   + + F  L      +G+I
Sbjct: 178 DALPVYHFEYTERGWMEVLVDIDDAKDSPHHFKFVLSPGP-TMATAFVNLVEGKKDVGSI 236

Query: 212 FENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYV-SPLVNPGQA 270
            E        ++ I + L    G +++IDYG     +G TLQ +  H +  +PL  PG+ 
Sbjct: 237 REVCAMGIGYVEKIGEILNNRKGGSLIIDYGN-DYPMGFTLQGIYQHRFTETPLEKPGEV 295

Query: 271 DLSSHVDFQRLSSIAILYK-LYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVK 329
           DLS+ VDF  L      +K + + G   Q  FL  +G+  R   L++        + S+ 
Sbjct: 296 DLSTFVDFSSLRKAVEKFKNVKVYGPQYQADFLHQMGMDARFAKLLQNPKLSPEQVTSMI 355

Query: 330 RLVSTSADKKSMGELFKILVVSH 352
                      MG  +K + ++H
Sbjct: 356 TAYERLTHPTEMGHHYKAMALAH 378


>gi|223992673|ref|XP_002286020.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220977335|gb|EED95661.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 431

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 114/425 (26%), Positives = 194/425 (45%), Gaps = 85/425 (20%)

Query: 8   KIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-----FGAVGDFVTAPEISQIFGEM 62
           +++  I   G +TV ++    + D  +GYY++         GA GDF+TAPE+SQ+FGE 
Sbjct: 4   ELIAYIGVRGPITVAEFMRRVLRDGRYGYYTSKGSRREQVIGAAGDFITAPEVSQLFGES 63

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L ++L+  ++  G P+ ++L+E+GPG+G ++ DI+R   K        + +++VE +  +
Sbjct: 64  LLVWLMTQYQSLGSPAKIQLIEIGPGKGTLICDIVRSGEKRHK---VCVGVHLVEVTNGM 120

Query: 123 TLIQKKQLASYGDKIN-------WYTSLADVPLG-------FTFLVANEFFDSLPIKQFV 168
              QK+ + +   + +       W+  L+ VP+         TF++  E  D+LPI  F 
Sbjct: 121 RSRQKESIRNLQKETSVNVISFEWHDVLSSVPIHDDSGDPIPTFVICQELVDALPIHSFQ 180

Query: 169 MTEHGI-RERMIDIDQHDSLVFNIGDHEIKSNFLTCSD----------YFLGAIFENSPC 217
             E  + RER++D+   D    +    ++       SD            +G+I E  P 
Sbjct: 181 KIEGNLWRERLVDVAIRDDSEASDAAKDVHLAVAPPSDDNHASTSLNSLPVGSIIEACPE 240

Query: 218 RDREMQSISDRLA-CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
               +Q I+DR+  C+GG A++IDYG   +  GDTL+    HT V PL  PG+ D+++ V
Sbjct: 241 GLILVQDIADRIQNCNGGAALIIDYGENGASGGDTLRGFWRHTQVHPLSRPGEVDVTADV 300

Query: 277 DFQRL-------------------------------------------SSIAILYKLYIN 293
           DF  L                                           S+  I  +    
Sbjct: 301 DFGALREAVNRRVTFEDSFERKRKENAYKRKGKTLEEDANENDKPDNKSTPPITRQYEAY 360

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQTARKD----ILLDSVKRLVSTSADKKSMGELFKILV 349
           G  TQG+FL  +GI +R    ++     D     L  +++RLV +      MGE +K+L 
Sbjct: 361 GPITQGQFLASMGIVERVERYIEDDDTTDEQAYELFSALERLVGSD----EMGERYKVLA 416

Query: 350 VSHEK 354
           ++  K
Sbjct: 417 IAAAK 421


>gi|317036685|ref|XP_001397854.2| hypothetical protein ANI_1_1788144 [Aspergillus niger CBS 513.88]
          Length = 767

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 133/455 (29%), Positives = 203/455 (44%), Gaps = 113/455 (24%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP------FGAVGDFVTAPEISQI 58
           L + + N IK  G + +  +    + +PE GYY+T  P      FG  GDFVT+PEISQ+
Sbjct: 304 LAQTLANAIKVTGPVPIAAFMRQVLTNPEGGYYTT-RPEGHGAVFGKKGDFVTSPEISQV 362

Query: 59  FGEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           FGE++ I+ I  W   G   S V+L+E+GPG+G +M D+LR     K    S+ +IY+VE
Sbjct: 363 FGELVGIWTIAEWMAQGRKRSGVQLMEVGPGKGTLMDDMLRTFRNFKMFSSSMEAIYLVE 422

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVA 155
            S  L  +QKK L   GD +   T +         DVP+ +               F+ A
Sbjct: 423 ASATLREVQKKLLC--GDAVMEATDIGHKSTCKYFDVPIVWVEDIRLLPHEEEKTPFIFA 480

Query: 156 NEFFDSL---------------PIKQFVMTEHGI---------------RERMIDIDQHD 185
           +EFFD+L               P ++ +MT  G                RE M+ ++   
Sbjct: 481 HEFFDALPIHAFESIPPSPENQPEQKEIMTPTGPAKLHQPLKPANTPQWREIMVTLNPK- 539

Query: 186 SLVFNI-GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSIS------------------ 226
           ++  NI G+ E K      S      I E SP R R ++S                    
Sbjct: 540 AVEENIEGEPEFKLTLAKASTPSSLVIPEISP-RYRALKSQPGSTIEVSPESRIYAADFA 598

Query: 227 ---------DRLACDG--------------GTAIVIDYGYLQSRVGDTLQAVKGHTYVSP 263
                     R A  G              G A+++DYG L +   ++L+ ++ H  V P
Sbjct: 599 RRIGGASEPPRTATKGAAASAPAPAKRVSSGAALIMDYGTLNTIPINSLRGIQEHKNVPP 658

Query: 264 LVNPGQADLSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQT--- 318
           L +PGQ D+S+ VDF  L+  AI     + ++G   QG FL+ +GI +R   L+K+    
Sbjct: 659 LSSPGQVDVSADVDFTALAEAAIEASEGVEVHGPVEQGDFLQAMGIEERMQQLLKKVEDE 718

Query: 319 ARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
            ++  L    KRLV       SMG+++K++ +  E
Sbjct: 719 EKRKTLETGWKRLVEKGGG--SMGKIYKVMAIVPE 751


>gi|327349837|gb|EGE78694.1| DUF185 domain-containing protein [Ajellomyces dermatitidis ATCC
           18188]
          Length = 510

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 123/408 (30%), Positives = 178/408 (43%), Gaps = 93/408 (22%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-------CNPFGAVGDFVTAPEI 55
             L + +   I   G +++  Y   C+  P+ GYY++          FG  GDFVT+PEI
Sbjct: 49  TPLAKSLGEAISVTGPVSIAAYMRQCLTSPDGGYYTSRGQEAEDTELFGTKGDFVTSPEI 108

Query: 56  SQIFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY 114
           SQIFGE+L I+ +  W   G  S  V+++E GPG+G +M D+LR     K    ++ ++Y
Sbjct: 109 SQIFGELLGIWTVAEWMGQGRKSGGVQIIEFGPGKGTLMGDMLRCFRNFKSFASTIEAVY 168

Query: 115 MVETSERLTLIQKKQL----------ASYGDK-------INWYTS---LADVPLGFTFLV 154
           +VE S  L  +Q+K L          A Y  K       I W      L D P    F+ 
Sbjct: 169 LVEASPVLREVQRKLLCGDAPMEEVEAGYKSKSIHLGVPIVWAEHISFLPDEPDKTPFIF 228

Query: 155 ANEFFDSLPIKQFVMTEHGIRERMID------------------IDQHDSLVF--NIGDH 194
           A+EFFD+LPI  F   E   + + I+                    Q   LV   N    
Sbjct: 229 AHEFFDALPIHAFQSVEVPSQPQTINSPTGPITLHQSSAPSSSTTTQWRELVVSPNPETP 288

Query: 195 EIKSN-----------FLTCSDYFL--------------GAIFENSPCRDREMQSISDRL 229
           E+KS+             T S   L              G+  E SP     +Q I+ R+
Sbjct: 289 EVKSSKEPEFRLSLAKASTPSSLILPEMSPRYKALKSTPGSTIEISPESQTCVQDIAKRI 348

Query: 230 -----------ACDG-------GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQAD 271
                      A D        G A+++DYG   +   ++L+ ++ H  VSP   PGQ D
Sbjct: 349 GGAFTSPSSPAATDAKKNKVPSGAALILDYGTTSTIPINSLRGIRKHQLVSPFAAPGQVD 408

Query: 272 LSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
           +S+ VDF  L+  AI     + + G T QG FLE LGI +RA  L+K+
Sbjct: 409 VSADVDFTALAEAAIDASPGVEVYGPTEQGAFLEALGISERAAQLLKK 456


>gi|293337173|ref|NP_001169078.1| hypothetical protein LOC100382919 [Zea mays]
 gi|223974807|gb|ACN31591.1| unknown [Zea mays]
          Length = 512

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 125/452 (27%), Positives = 197/452 (43%), Gaps = 107/452 (23%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L + + N IK  G + +  +    + +PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 49  LAQTLANAIKVTGPVPIAAFMRQVLTNPEGGYYTTRPEGHGEVFGKKGDFVTSPEISQVF 108

Query: 60  GEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ I+ I  W   G   S V+L+E+GPG+G +M D+LR     K    S+ +IY+VE 
Sbjct: 109 GELVGIWTIAEWMAQGRKRSGVQLMEVGPGKGTLMDDMLRTFRNFKMFSSSIEAIYLVEA 168

Query: 119 SERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVAN 156
           S  L  +QKK L   GD +   T +         DVP+ +               F+ A+
Sbjct: 169 SATLREVQKKLLC--GDAVMEETDIGHKSTCKYFDVPIVWVEDIRLLPHEEEKTPFIFAH 226

Query: 157 EFFDSL---------------PIKQFVMTEHGIRE-----RMIDIDQHDSLVFNIGDHEI 196
           EFFD+L               P ++ +MT  G  +     +  +  Q   L+  +    +
Sbjct: 227 EFFDALPIHAFESIPPSPENQPEQKEIMTPTGPAKLHQPLKPANTPQWRELLVTLNPKAV 286

Query: 197 KSNFLTCSDYFL---------------------------GAIFENSP---------CRDR 220
           + N     ++ L                           G+  E SP          R  
Sbjct: 287 EENIEGEPEFKLTLAKASTPSSLVIPEISPRYRALKSQPGSTIEVSPESRIYAADFARRI 346

Query: 221 EMQSISDRLACDG--------------GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVN 266
              S   R    G              G A+++DYG L +   ++L+ ++ H  V PL +
Sbjct: 347 GGASEPPRTVTKGAAASAPAPAKRTSSGAALIMDYGTLNTIPINSLRGIQEHKNVPPLSS 406

Query: 267 PGQADLSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQT---ARK 321
           PGQ D+S+ VDF  L+  AI     + ++G   QG FL+ +GI +R   L+K+     ++
Sbjct: 407 PGQVDVSADVDFTALAEAAIEASEGVEVHGPVEQGDFLQAMGIEERMQQLLKKVDDEEKR 466

Query: 322 DILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
             L    KRLV       SMG+++K++ +  E
Sbjct: 467 KTLETGWKRLVEKGGG--SMGKIYKVMAIVPE 496


>gi|238493427|ref|XP_002377950.1| DUF185 domain protein [Aspergillus flavus NRRL3357]
 gi|220696444|gb|EED52786.1| DUF185 domain protein [Aspergillus flavus NRRL3357]
          Length = 507

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 120/454 (26%), Positives = 192/454 (42%), Gaps = 109/454 (24%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-----FGAVGDFVTAPEISQIF 59
           L R + + IK  G + +  +    +  PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 42  LARTLADAIKVTGPIPIAAFMRQVLTSPEGGYYTTRPAGDGEVFGKKGDFVTSPEISQVF 101

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ I+ I  W   G  S  V+L+E+GPG+G +M D+LR     K    S+ +IY+VE 
Sbjct: 102 GELVGIWTIAEWMAQGRKSSGVQLMEVGPGKGTLMDDMLRTFRNFKSFTSSIEAIYLVEA 161

Query: 119 SERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVAN 156
           S  L  +QK++L   GD     T +         +VP+ +               F++A+
Sbjct: 162 SPTLREVQKQRLC--GDATMEETEIGHKSTCKYFNVPVIWVEDIRLLPHEEDKSPFIIAH 219

Query: 157 EFFDSLPIKQF-----------------VMTEHGIRE-----RMIDIDQHDSLVFNIGDH 194
           EFFD+LPI  F                 +MT  G  +     +  +  Q   L+  +   
Sbjct: 220 EFFDALPIHAFESVPPSPENQPPQSQDTIMTPTGPTKLHKPLKPANTPQWRELMVTLNPK 279

Query: 195 EIKSNFLTCSDYFL---------------------------GAIFENSP----------- 216
            I  N     ++ L                           G+  E SP           
Sbjct: 280 AIDENLPNEPEFKLTHAKASTPSSLVIPEISPRYRALKSQPGSTIEISPESRIYASDFAR 339

Query: 217 ------------CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPL 264
                        R+   Q  +       G A+++DYG + +   ++L+ ++ H  V PL
Sbjct: 340 RIGGASQPPRTKARNASTQPAAPAKRVPSGAALIMDYGTMDTIPVNSLRGIQHHRKVPPL 399

Query: 265 VNPGQADLSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--- 319
            +PGQ D+S+ VDF  L+  A+     + ++G   QG FL  +GI +R   L+K      
Sbjct: 400 SSPGQVDVSADVDFTALAEAALEGSEGVEVHGPVEQGDFLRTMGIAERMQQLLKHEKDEE 459

Query: 320 RKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           ++  L    +RLV        MG+++K + +  E
Sbjct: 460 KRKTLESGWQRLVEKGGG--GMGKIYKFMAIVPE 491


>gi|194694748|gb|ACF81458.1| unknown [Zea mays]
          Length = 249

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 121/203 (59%), Gaps = 19/203 (9%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           E++L++ I ++IK ++G +++ +Y    + +P+ G+Y   + FG  GDF+T+PE+SQ+FG
Sbjct: 49  ESELVKHIKSIIKFRSGPISIAEYMEEVLTNPQSGFYINRDVFGESGDFITSPEVSQMFG 108

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++ +C WEQ G P+ V L+ELGPGRG ++ D+LR   K   +F   LSI +VE S 
Sbjct: 109 EMIGVWAMCLWEQMGKPAKVNLIELGPGRGTLLADLLRGSAKFA-NFTKALSINLVECSP 167

Query: 121 RLTLIQKKQLASY---------------GDKINWYTSLADVPLGF-TFLVANEFFDSLPI 164
            L  IQ   L                  G  + W+ SL  VP G  T ++A+EF+D+LPI
Sbjct: 168 TLQKIQYNTLKCEDEHVGDGKRTVSKICGAPVCWHASLEQVPSGSPTIIIAHEFYDALPI 227

Query: 165 KQFVMTEHGIRERMIDIDQHDSL 187
            QF     G  E+M+DI + DSL
Sbjct: 228 HQFQKASRGWCEKMVDIAE-DSL 249


>gi|295662458|ref|XP_002791783.1| DUF185 domain-containing protein [Paracoccidioides brasiliensis
           Pb01]
 gi|226279909|gb|EEH35475.1| DUF185 domain-containing protein [Paracoccidioides brasiliensis
           Pb01]
          Length = 508

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 127/444 (28%), Positives = 187/444 (42%), Gaps = 97/444 (21%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-------CNPFGAVGDFVTAPEISQ 57
           L + I   I   G +++  Y   C+  P+ GYY++          FG  GDFVT+PEISQ
Sbjct: 51  LAKTIAEAISVTGPISIAAYMRQCLTSPDGGYYTSRGQEAEGTELFGPKGDFVTSPEISQ 110

Query: 58  IFGEMLAIFLICAWEQHGF-PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
           IFGE+L I+ +  W   G     V+++ELGPG+G +M D+LR I   K    ++ +IY+V
Sbjct: 111 IFGELLGIWTVAEWMGQGRKKGGVQIIELGPGKGTLMADMLRSIRNFKTFASAIEAIYLV 170

Query: 117 ETSERLTLIQKKQLAS-----------------YGDKINWYTS---LADVPLGFTFLVAN 156
           E S  L  +Q K L                    G  + W      L + P    F+ A+
Sbjct: 171 EASTVLREVQHKLLCGDAPTEEMEVGYKSTSVHLGVPVIWTEHIKLLTEEPDKTPFIFAH 230

Query: 157 EFFDSLPIKQFVMTEHGIRERMIDID------------------QHDSLVF--NIGDHEI 196
           EFFD+LPI  F   E     + I+                    Q   LV   N    E+
Sbjct: 231 EFFDALPIHAFQSIETPPPSQTINTPTGPATLHNPPATSSSPATQWRELVVSPNPETPEL 290

Query: 197 KSN-----------FLTCSDYFL--------------GAIFENSPCRDREMQSISDRLA- 230
           KS              T S   L              G+  E SP      Q I+ R+  
Sbjct: 291 KSGKEPEFHLSLAKSHTPSSLVLPEMSPRYKAMKSMPGSTIEISPEGQTCAQDIARRIGG 350

Query: 231 -------------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
                           G A+++DYG   +   ++L+ ++ H  VSP   PGQ D+S++VD
Sbjct: 351 SFYSSSEQSNKKRVPSGAALILDYGTTSTIPINSLRGIRKHQLVSPFAVPGQVDISANVD 410

Query: 278 FQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT------ARKDILLDSVK 329
           F  L+  AI     + + G   Q +FLE LGI +RA  L+++        ++  +    K
Sbjct: 411 FTALAEAAIDASPGVEVYGPVEQCQFLEALGISKRASQLLRKVEGEGGEEKRKRIESGWK 470

Query: 330 RLVSTSADKKSMGELFKILVVSHE 353
           RLV        MG+L+K L +  E
Sbjct: 471 RLVERGGG--GMGKLYKALAIVPE 492


>gi|317157165|ref|XP_001826262.2| hypothetical protein AOR_1_1144054 [Aspergillus oryzae RIB40]
          Length = 765

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 120/454 (26%), Positives = 191/454 (42%), Gaps = 109/454 (24%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-----FGAVGDFVTAPEISQIF 59
           L R + + IK  G + +  +    +  PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 300 LARTLADAIKVTGPIPIAAFMRQVLTSPEGGYYTTRPAGDGEVFGKKGDFVTSPEISQVF 359

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ I+ I  W   G  S  V+L+E+GPG+G +M D+LR     K    S+ +IY+VE 
Sbjct: 360 GELVGIWTIAEWMAQGRKSSGVQLMEVGPGKGTLMDDMLRTFRNFKSFTSSIEAIYLVEA 419

Query: 119 SERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVAN 156
           S  L  +QK++L   GD     T +         +VP+ +               F++A+
Sbjct: 420 SPTLREVQKQRLC--GDATMEETEIGHTSTCKYFNVPVIWVEDIRLLPHEEDKSPFIIAH 477

Query: 157 EFFDSLPIKQF-----------------VMTEHGIRE-----RMIDIDQHDSLVFNIGDH 194
           EFFD+LPI  F                 +MT  G  +     +  +  Q   L+  +   
Sbjct: 478 EFFDALPIHAFESVPPSPENQPPQSQDTIMTPTGPTKLHKPLKPANTPQWRELMVTLNPK 537

Query: 195 EIKSNFLTCSDYFL---------------------------GAIFENSP----------- 216
            I  N     ++ L                           G+  E SP           
Sbjct: 538 AIDENLPNEPEFKLTHAKASTPSSLVIPEISPRYRALKSQPGSTIEISPESRIYASDFAR 597

Query: 217 ------------CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPL 264
                        R+   Q  +       G A+++DYG + +   ++L+ ++ H  V PL
Sbjct: 598 RIGGASQPPRTKARNASTQPAAPAKRVPSGAALIMDYGTMDTIPVNSLRGIQHHRKVPPL 657

Query: 265 VNPGQADLSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--- 319
             PGQ D+S+ VDF  L+  A+     + ++G   QG FL  +GI +R   L+K      
Sbjct: 658 SAPGQVDVSADVDFTALAEAALEGSEGVEVHGPVEQGDFLRTMGIAERMQQLLKHEKDEE 717

Query: 320 RKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           ++  L    +RLV        MG+++K + +  E
Sbjct: 718 KRKTLESGWQRLVEKGGG--GMGKIYKFMAIVPE 749


>gi|154272489|ref|XP_001537097.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150409084|gb|EDN04540.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 505

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 126/459 (27%), Positives = 196/459 (42%), Gaps = 117/459 (25%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-------FGAVGDFVTAPEI 55
             L + I   I   G +++  Y   C+  P+ GYY++          FGA GDFVT+PEI
Sbjct: 40  TPLAKSIAEAINVTGPVSIAAYMRQCLTSPDGGYYTSRGQEDEDTALFGAKGDFVTSPEI 99

Query: 56  SQIFGEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY 114
           SQIFGE+L ++ +  W   G  S  V+++E GPG+G +M D+LR     K    ++ ++Y
Sbjct: 100 SQIFGELLGVWTVTEWMGQGRKSGGVQIIEFGPGKGTLMGDMLRSFRNFKNFASAIEAVY 159

Query: 115 MVETSERLTLIQKKQLASYGDKINWYTSLADVPLGF------------------------ 150
           +VETS  L  +Q+K L   GD     T L +V +G+                        
Sbjct: 160 LVETSPVLREVQRKLLC--GD-----TPLEEVEIGYKSTSIHLGVPVIWTEHIKLLPNES 212

Query: 151 ---TFLVANEFFDSL------------PIKQFVMTEHGI----------------RERMI 179
               F +A+EFFD+L            P +  + T  G                 RE ++
Sbjct: 213 DKTPFFLAHEFFDALPIHAFQSIQTPAPSQTTINTPTGPTTLHQPPISSSHTTEWRELVV 272

Query: 180 DIDQHDSLVFNIGDHEIK---SNFLTCSDYFL--------------GAIFENSPCRDREM 222
             +     V +  + E +   +   T S   L              G+  E SP     +
Sbjct: 273 SPNPETPEVKSGQEPEFRLSLAKASTPSSLVLPEMSSRYKALKSTPGSTIEISPESQACV 332

Query: 223 QSISDRLA--------------------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVS 262
           Q I+ R+                        G A+++DYG   +   ++L+ ++ H  VS
Sbjct: 333 QDIARRIGGGGGLVSAPSPGVTDPPKNKVPSGAALILDYGTTSTIPINSLRGIRKHRLVS 392

Query: 263 PLVNPGQADLSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT-- 318
           PLV PG+ D+S+ VDF  L+  AI     + + G   QG FLE LGI +RA  L+++T  
Sbjct: 393 PLVAPGEVDISADVDFTALAEAAIDASPGVEVYGPMEQGPFLEALGISERAAQLLRRTEG 452

Query: 319 ----ARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
                ++  +    KRLV        MG+L+K L +  E
Sbjct: 453 EGDEEKRKRIESGWKRLVERGGG--GMGKLYKALAIVPE 489


>gi|240276848|gb|EER40359.1| DUF185 domain-containing protein [Ajellomyces capsulatus H143]
          Length = 507

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 117/419 (27%), Positives = 187/419 (44%), Gaps = 96/419 (22%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNP-------FGAVGDFVTAPEISQIFGEMLAIFLI 68
            G +++  Y   C+  P+ GYY++          FGA GDFVT+PEISQIFGE+L ++ +
Sbjct: 88  TGPVSIATYIRQCLTSPDGGYYTSRGQEDEDTALFGAKGDFVTSPEISQIFGELLGVWTV 147

Query: 69  CAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
             W   G  S  V+++E GPG+G +M D+LR          ++ ++Y+VETS  L  +Q+
Sbjct: 148 TEWMGQGRKSGGVQIIEFGPGKGTLMGDMLRSFAS------AIEAVYLVETSPVLREVQR 201

Query: 128 KQLASYGDKINWYTSLADVPLGF---------------------------TFLVANEFFD 160
           K L   GD     T + +V +G+                            F+ A+EFFD
Sbjct: 202 KLLC--GD-----TPMEEVEVGYKSTSVHLGVPVIWTEHIKLLPNESDKTPFIFAHEFFD 254

Query: 161 SLPIKQF--------------------------VMTEHGI--RERMIDIDQHDSLVFNIG 192
           +LPI  F                          + + H    RE ++  +     V +  
Sbjct: 255 ALPILAFQSIQTPAPSQTTINTPTGPTTLHQPPISSPHTTEWRELVVSPNPETPEVKSGQ 314

Query: 193 DHEIKSNFLTCSDYFLGAIFENSPCR--------DREMQSISDRL--ACDGGTAIVIDYG 242
           + E + +    S      + E S  R              ++D L      G A+++DYG
Sbjct: 315 EPEFRLSLAKASTPSSLVLPEMSSRRIGGGGGLVSATSPGVTDTLKNKVPSGAALILDYG 374

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI--LYKLYINGLTTQGK 300
              +   ++L+ ++ H  VSPLV PG+ D+S+ VDF  L+  AI     + + G   QG 
Sbjct: 375 TTSTIPINSLRGIRNHRLVSPLVAPGEVDISADVDFTALAEAAIDASPGVEVYGPMEQGP 434

Query: 301 FLEGLGIWQRAFSLMKQ------TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           FLE LGI +RA  L+++        ++ ++    KRLV        MG+L+K L +  E
Sbjct: 435 FLEALGISERAAQLLRRMEGEGDEEKRKLIESGWKRLVERGGG--GMGKLYKALAIVPE 491


>gi|46122055|ref|XP_385581.1| hypothetical protein FG05405.1 [Gibberella zeae PH-1]
          Length = 465

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 115/425 (27%), Positives = 180/425 (42%), Gaps = 92/425 (21%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-----NPFGAVGDFVTAPEISQIF 59
           L +++   I   G + +  Y  +C+     GYY+       + FG  GDFVT+PEISQIF
Sbjct: 30  LAKQLFAAISTTGPVPLASYMRMCLTGDIGGYYTGAIGEGRDQFGTKGDFVTSPEISQIF 89

Query: 60  GEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ I+ I  W   G P   V+++E+GPGRG +M D+LR I +      S+ ++YMVE 
Sbjct: 90  GELIGIWFIAEWMSQGRPKQGVQIIEVGPGRGTLMDDMLRTIQRFPAMANSIDAVYMVEA 149

Query: 119 SERLTLIQKKQLAS------------------YGDKINWYTSLADVPL---GFTFLVANE 157
           S  L   QK+ L                     G +I W  ++  +P       F++A+E
Sbjct: 150 SRELRSAQKELLCGPDASSSESESGFHSASKYNGKQIVWTDNIKSIPYESDKMPFIIAHE 209

Query: 158 FFDSL-------------------------PIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
           FFD+L                         P+ Q        RE M+           +G
Sbjct: 210 FFDALPIHSFQSAPAPPPQPKPSSSTSAPQPLPQNTKPTMEWREMMVSPTLPGVTHAQLG 269

Query: 193 -----DHEIKSNF---LTCSDYFLGAIFENSPCRDREMQSISDR----------LACD-- 232
                 HE    F   L+ +          +  R R+++S+ +            A D  
Sbjct: 270 TPKSEQHEPPPEFQLTLSSTPTRHSRFLPETSTRYRKLKSMPNSNIEICPDASIFATDFA 329

Query: 233 --------------GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDF 278
                          G A+++DYG   +   ++L+ ++ H  VSP   PG  DLS+ VDF
Sbjct: 330 TRVGGSDEHPKPKPSGAALILDYGTSDTVPINSLRGIRHHRRVSPFSAPGLVDLSADVDF 389

Query: 279 QRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSV----KRLV 332
             ++ +A+L    + ++G  TQG FL  +GI +RA  L K    +   +D +    KRLV
Sbjct: 390 TAIAEVAMLASEGVEVHGPVTQGDFLGVMGIRERAEQLTKAPGVEKDTVDKIDGAWKRLV 449

Query: 333 STSAD 337
               D
Sbjct: 450 DKGPD 454


>gi|225681513|gb|EEH19797.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 439

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 121/422 (28%), Positives = 178/422 (42%), Gaps = 98/422 (23%)

Query: 28  CVADPEFGYYST-------CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHG-FPSC 79
           C+  P+ GYY++          FGA GDFVT+PEISQIFGE+L I+ +  W   G     
Sbjct: 4   CLTSPDGGYYTSRGQEAEGTEIFGAKGDFVTSPEISQIFGELLGIWTVAEWMGQGRRKGG 63

Query: 80  VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS------- 132
           V+++ELGPG+G +M D+LR I   K    ++ ++Y+VE S  L  +Q K L         
Sbjct: 64  VQIIELGPGKGTLMADMLRSIRNFKTFASAIEAVYLVEASTVLREVQHKLLCGDAPTEEM 123

Query: 133 ----------YGDKINWYTS---LADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
                      G  + W      L D P    F+ A+EFFD+LPI  F   E   R + I
Sbjct: 124 EVGYKSTSVHLGVPVIWTEHIKLLPDEPDKTPFIFAHEFFDALPIHAFQSIETPPRPQTI 183

Query: 180 DIDQHDSLVFNIGD--------------------HEIKSN-----------FLTCSDYFL 208
           +     + + N                        E+KS              T S   L
Sbjct: 184 NTPTGPATLHNPPATSSSPATQWRELVVSPNPEIPELKSGNEPEFHLSLAKSPTSSSLVL 243

Query: 209 --------------GAIFENSPCRDREMQSISDRLA---------------CDGGTAIVI 239
                         G+  E SP      Q I+ R+                   G A+++
Sbjct: 244 PEMSPRYKAMKSTPGSTIEISPEGQTCAQDIARRIGGSFSSSSSEQSNKKRVPSGAALIL 303

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI--LYKLYINGLTT 297
           DYG   +   ++L+ ++ H  VSP   PGQ D+S++VDF  L+  AI     + + G   
Sbjct: 304 DYGTTSTIPINSLRGIRKHQLVSPFAVPGQVDISANVDFTALAEAAIDASPGVEVYGPVE 363

Query: 298 QGKFLEGLGIWQRAFSLMKQT------ARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           Q +FLE LGI +RA  L+ +        ++  +    KRLV        MG+L+K L + 
Sbjct: 364 QCQFLEALGISKRASQLLTKVEGEGGEEKRKRIESGWKRLVERGGG--GMGKLYKALAIV 421

Query: 352 HE 353
            E
Sbjct: 422 PE 423


>gi|297667837|ref|XP_002812171.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 2
           [Pongo abelii]
          Length = 414

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 175/379 (46%), Gaps = 61/379 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P                            ++L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMKEVLTNP---------------------------AKLLG 75

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 76  IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 135

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  ++WY  L DVP G++F +A+EFFD LP
Sbjct: 136 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPVSWYRDLQDVPKGYSFYLAHEFFDVLP 195

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 196 VHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 254

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S+R+A  GG A+V DYG+  +R  DT +   GH     L+ PG ADL++ VDF  L
Sbjct: 255 IEELSERIALTGGAALVADYGHDGTRT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSYL 313

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 314 RRMA-QGKVASVGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 368

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 369 KKMGERFNFFALLPHQRLQ 387


>gi|325095113|gb|EGC48423.1| DUF185 domain-containing protein [Ajellomyces capsulatus H88]
          Length = 498

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 123/459 (26%), Positives = 195/459 (42%), Gaps = 123/459 (26%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-------FGAVGDFVTAPEI 55
             L + I   I   G +++  Y   C+  P+ GYY++          FGA GDFVT+PEI
Sbjct: 39  TPLAKSIAEAINVTGPVSIATYIRQCLTSPDGGYYTSRGQEDEDTALFGAKGDFVTSPEI 98

Query: 56  SQIFGEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY 114
           SQIFGE+L ++ +  W   G  S  V+++E GPG+G +M D+LR          ++ ++Y
Sbjct: 99  SQIFGELLGVWTVTEWMGQGRKSGGVQIIEFGPGKGTLMGDMLRSFAS------AIEAVY 152

Query: 115 MVETSERLTLIQKKQLASYGDKINWYTSLADVPLGF------------------------ 150
           +VETS  L  +Q+K L   GD     T + +V +G+                        
Sbjct: 153 LVETSPVLREVQRKLLC--GD-----TPMEEVEVGYKSTSVHLGVPVIWTEHIKLLPNES 205

Query: 151 ---TFLVANEFFDSL------------PIKQFVMTEHGI----------------RERMI 179
               F+ A+EFFD+L            P +  + T  G                 RE ++
Sbjct: 206 DKTPFIFAHEFFDALPIHAFQSIQTPAPSQTTINTPTGPTTLHQPPISSPHTTEWRELVV 265

Query: 180 DIDQHDSLVFNIGDHEIK---SNFLTCSDYFL--------------GAIFENSPCRDREM 222
             +     V +  + E +   +   T S   L              G+  E SP     +
Sbjct: 266 SPNPETPEVKSGQEPEFRLSLAKASTPSSLVLPEMSSRYKALKSTPGSTIEISPESQACV 325

Query: 223 QSISDRLA--------------------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVS 262
           Q I+ R+                        G A+++DYG   +   ++L+ ++ H  VS
Sbjct: 326 QDIARRIGGGGGLVSATSPGVTDTLKNKVPSGAALILDYGTTSTIPINSLRGIRNHRLVS 385

Query: 263 PLVNPGQADLSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ--- 317
           PLV PG+ D+S+ VDF  L+  AI     + + G   QG FLE LGI +RA  L+++   
Sbjct: 386 PLVAPGEVDISADVDFTALAEAAIDASPGVEVYGPMEQGPFLEALGISERAAQLLRRMEG 445

Query: 318 ---TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
                ++ ++    KRLV        MG+L+K L +  E
Sbjct: 446 EGDEEKRKLIESGWKRLVERGGG--GMGKLYKALAIVPE 482


>gi|225554781|gb|EEH03076.1| DUF185 domain-containing protein [Ajellomyces capsulatus G186AR]
          Length = 543

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 125/460 (27%), Positives = 195/460 (42%), Gaps = 118/460 (25%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-------FGAVGDFVTAPEI 55
             L + I   I   G +++  Y   C+  P+ GYY++          FGA GDFVT+PEI
Sbjct: 49  TPLAKSIAEAINVTGPVSIAAYMRQCLTLPDGGYYTSRGQEDEDTALFGAKGDFVTSPEI 108

Query: 56  SQIFGEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY 114
           SQIFGE+L ++ +  W   G  S  V+++E GPG+G +M D+LR     K    ++ ++Y
Sbjct: 109 SQIFGELLGVWTVTEWMGQGRKSGGVQVIEFGPGKGTLMGDMLRSFRNFKSFASAIEAVY 168

Query: 115 MVETSERLTLIQKKQLASYGDKINWYTSLADVPLGF------------------------ 150
           +VETS  L  +Q+K L   GD     T + +V +G+                        
Sbjct: 169 LVETSPVLREVQRKLLC--GD-----TPMEEVEVGYKSTSIHLGVPVIWTEHIKLLPNES 221

Query: 151 ---TFLVANEFFDSL------------PIKQFVMTEHGI----------------RERMI 179
               F+ A+EFFD+L            P +  + T  G                 RE ++
Sbjct: 222 DKTPFIFAHEFFDALPIHAFQSIQTPAPSQTTINTPTGPTTLHQPPISSPHTTEWRELVV 281

Query: 180 DIDQHDSLVFNIGDHEIK---SNFLTCSDYFL--------------GAIFENSPCRDREM 222
             +     V +  + E +   +   T S   L              G+  E SP     +
Sbjct: 282 SPNPETPEVKSGQEPEFRLSLAKASTPSSLVLPEMSSRYKALKSTPGSTIEISPESQACV 341

Query: 223 QSISDRLA---------------------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYV 261
           Q I+ R+                         G A+++DYG   +   ++L+ ++ H  V
Sbjct: 342 QDIARRIGGGGGGLVSAPSPGVTDTLKNKVPSGAALILDYGTTSTIPINSLRGIRKHRLV 401

Query: 262 SPLVNPGQADLSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQ-- 317
           SPLV PG+ D+S+ VDF  L+  AI     + + G   QG FLE LGI +RA  L+++  
Sbjct: 402 SPLVAPGEVDISADVDFTALAEAAIDASPGVEVYGPMEQGPFLEALGISERAAQLLRRME 461

Query: 318 ----TARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
                 ++  +    KRLV        MG+L+K L V  E
Sbjct: 462 GEGDEEKRKRIESGWKRLVERGGG--GMGKLYKALAVVPE 499


>gi|121715340|ref|XP_001275279.1| DUF185 domain protein [Aspergillus clavatus NRRL 1]
 gi|119403436|gb|EAW13853.1| DUF185 domain protein [Aspergillus clavatus NRRL 1]
          Length = 501

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 128/450 (28%), Positives = 197/450 (43%), Gaps = 105/450 (23%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L + + N IK  G + +  +    +  PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 40  LAKTLANAIKITGPIPISAFMRQVLTSPEGGYYTTRPEGGGEVFGKKGDFVTSPEISQVF 99

Query: 60  GEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++A++ I  W   G   S V+L+E+GPG+G +M D+LR     K    S+ +IY+VE 
Sbjct: 100 GELVAVWTITEWMAQGRKRSGVQLIEVGPGKGTLMDDMLRTFQNFKSFSSSIEAIYLVEA 159

Query: 119 SERLTLIQKKQLASYGDKINWYTSLA--------DVPL-------------GFT-FLVAN 156
           S  L  +QK++L   GD     T +         +VP+             G T F+ A+
Sbjct: 160 SPTLREVQKQRLC--GDAPMEETDIGHRSTSKYFNVPVIWVEDIRLLPHEEGTTPFIFAH 217

Query: 157 EFFDSLPIKQF---------------VMTEHGI---------------RERMIDIDQHDS 186
           EFFD+LPI  F               +MT  G                RE M+ ++    
Sbjct: 218 EFFDALPIHAFESVPPAPESQTEQSEIMTPTGPAKLHQPMKPANTPQWREIMVTLNPEAV 277

Query: 187 LVFNIGDHEIK---SNFLTCSDYFLGAIFE------NSPCRDREMQSISDRLACD----- 232
                G+ E K   +   T S   +  I E      + P    E+   S   A D     
Sbjct: 278 EENKEGEPEFKLTLAKASTPSSLVIPEISERYRKLKSQPGSTIEISPESRVYASDFARRI 337

Query: 233 GGT------------------------AIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPG 268
           GG+                        A+++DYG + +   ++L+ ++ H  V  L +PG
Sbjct: 338 GGSSQPPRTVNRQDAGPVQPKRVPSGAALIMDYGTMSTIPVNSLRGIQNHRNVPALSSPG 397

Query: 269 QADLSSHVDFQRLSSIAI--LYKLYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDI 323
           Q D+S+ VDF  L+  AI     + ++G   QG FL+ +GI +R   L+   K   ++  
Sbjct: 398 QVDVSADVDFIALAEAAIDASEGVEVHGPVEQGDFLQVMGIAERMQQLLKGIKDEEKRKT 457

Query: 324 LLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           L    KRLV        MG+++K + +  E
Sbjct: 458 LESGWKRLVERGGG--GMGKIYKFMAIIPE 485


>gi|119480871|ref|XP_001260464.1| hypothetical protein NFIA_085200 [Neosartorya fischeri NRRL 181]
 gi|119408618|gb|EAW18567.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
          Length = 503

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 129/451 (28%), Positives = 202/451 (44%), Gaps = 107/451 (23%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L + + N IK  G + +  +    +  PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 42  LAKTLANAIKVTGPIPIAAFMRQVLTSPEGGYYTTRPEGGGEVFGKKGDFVTSPEISQVF 101

Query: 60  GEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ I+ I  W   G   S V+L+E+GPG+G +M D+LR     K    S+ +IY+VE 
Sbjct: 102 GELVGIWTITEWMAQGLKRSGVQLIEVGPGKGTLMDDMLRTFRNFKSFASSLEAIYLVEA 161

Query: 119 SERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVAN 156
           S  L  +QK++L   GD     T +         +VP+ +               F+ A+
Sbjct: 162 SPTLREVQKQRLC--GDAAMEETDIGHKSISKYFNVPVIWVEDIRLLPHEEDKTPFIFAH 219

Query: 157 EFFDSLPIKQF---------------VMTEHGI---------------RERMIDIDQHDS 186
           EFFD+LPI  F               +MT  G                RE M+ ++   +
Sbjct: 220 EFFDALPIHAFESIPPAPENQSEQKEIMTPTGPAKLHQPMKPANTPQWREIMVTLNP-KA 278

Query: 187 LVFNI-GDHEIK---SNFLTCSDYFLGAIFE------NSPCRDREMQSISDRLACD---- 232
           +  NI G+ E K   +   T S   +  I E      ++P    E+   S   A D    
Sbjct: 279 VEENIEGEPEFKLTLAKASTPSSLVIPEISERYRKLKSTPGSTIEVSPESRIYASDFARR 338

Query: 233 -GGTA------------------------IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNP 267
            GG++                        +++DYG + +   ++L+ ++ H  V  L +P
Sbjct: 339 IGGSSQPPRTVGSRNAPAAQPKKVPSGAALIMDYGTMSTIPINSLRGIQHHRTVPALSSP 398

Query: 268 GQADLSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMK--QTARKDI 323
           GQ D+S+ VDF  L+  AI     + ++G   QG FL+ +GI +R   L+K  Q   K  
Sbjct: 399 GQVDVSADVDFMALAEAAIEASEGVEVHGPVEQGDFLQVMGIAERMQQLLKGVQDEEKRK 458

Query: 324 LLDS-VKRLVSTSADKKSMGELFKILVVSHE 353
            L+S  KRL+        MG+++K + +  E
Sbjct: 459 TLESGWKRLIERGGG--GMGKIYKFMAIIPE 487


>gi|260950353|ref|XP_002619473.1| hypothetical protein CLUG_00632 [Clavispora lusitaniae ATCC 42720]
 gi|238847045|gb|EEQ36509.1| hypothetical protein CLUG_00632 [Clavispora lusitaniae ATCC 42720]
          Length = 524

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 107/196 (54%), Gaps = 28/196 (14%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           IK  G +++  Y   C+  P+FGYY+T +P  A GDF+T+PEIS +FGEM+ ++L   W+
Sbjct: 90  IKTTGPVSLSAYMRQCLTHPDFGYYTTRDPLAAGGDFITSPEISSVFGEMIGMWLFSVWQ 149

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLTLIQKKQ-- 129
             G P  +++VE GPGRG ++ D + V  +    F  V +SI ++E S  L   Q K   
Sbjct: 150 AQGSPQKIQVVEFGPGRGTLIHDAMAVFNR----FAKVSVSIVLIEASPVLRKEQAKLLC 205

Query: 130 ---------------------LASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFV 168
                                L+ +G ++ W  +  DVP   +++VA+EFFD+LPIK FV
Sbjct: 206 PGVEQFEKVPTPENPAGFDSCLSKWGHRVMWVDTEKDVPSEVSYVVAHEFFDALPIKSFV 265

Query: 169 MTEHGIRERMIDIDQH 184
             E G RE ++D   H
Sbjct: 266 RKEEGWRELLVDSADH 281



 Score = 73.6 bits (179), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 69/122 (56%), Gaps = 6/122 (4%)

Query: 232 DGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLY 291
           + G A++IDYG       ++L+ +  H +VSP  +PG  DLS  VDF+ L  +A  + + 
Sbjct: 392 NAGAALIIDYGLANDIPSNSLRGIYKHKFVSPFFSPGNVDLSVDVDFENLRLLAAPH-VD 450

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           + G T QG FL  LGI  R   L+++    A K+ L +S  RL  T  D+ SMG+++K L
Sbjct: 451 VFGPTEQGDFLHELGIGVRFDQLIQRANSMANKESLYESYVRL--TGKDENSMGKIYKFL 508

Query: 349 VV 350
            +
Sbjct: 509 AL 510


>gi|297265813|ref|XP_002799256.1| PREDICTED: protein midA homolog, mitochondrial-like [Macaca
           mulatta]
          Length = 415

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 172/379 (45%), Gaps = 61/379 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P                            ++L 
Sbjct: 44  MLRHLMYKIKSTGPITVAEYMKEVLTNP---------------------------AKLLG 76

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 77  IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 136

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  + DVP G++F +A+EFFD LP
Sbjct: 137 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPISWYRHVHDVPKGYSFYLAHEFFDVLP 196

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  IDID    D L F +      +      D     + E  P     
Sbjct: 197 VHKFQKTPQGWREVFIDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 255

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++     +   GH     L+ PG ADL++ VDF  L
Sbjct: 256 IEELSQRIALTGGAALVADYGHDGTKT-XMFKGFCGHKLHDVLIAPGTADLTADVDFSYL 314

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 315 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 369

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ HE++E
Sbjct: 370 KKMGERFNFFALLPHERLE 388


>gi|332813010|ref|XP_003309028.1| PREDICTED: protein midA homolog, mitochondrial-like [Pan
           troglodytes]
          Length = 414

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 173/379 (45%), Gaps = 61/379 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P                            ++L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNP---------------------------AKLLG 75

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 76  IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 135

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 136 EIQALTLTEEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLP 195

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 196 VHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 254

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DT +    H     L+ PG ADL++ VDF  L
Sbjct: 255 IEELSQRIALTGGAALVADYGHDGTKT-DTFRGFCDHKLHDVLIAPGTADLTADVDFSYL 313

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 314 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 368

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 369 KKMGERFNFFALLPHQRLQ 387


>gi|115395892|ref|XP_001213585.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114193154|gb|EAU34854.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 809

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 125/460 (27%), Positives = 194/460 (42%), Gaps = 117/460 (25%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP------FGAVGDFVTAPEISQI 58
           L + + N IK  G + +  +    +  P+ GYY+T  P      FG  GDFVT+PEISQ+
Sbjct: 340 LAKTLANAIKVTGPIPIAAFMRQVLTSPDGGYYTT-RPKGDGEVFGKKGDFVTSPEISQV 398

Query: 59  FGEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           FGE++ I+ I  W   G   S V+L+E+GPG+G +M D+LR     K    S+  IY+VE
Sbjct: 399 FGELVGIWTIAEWMAQGRKRSGVQLMEVGPGKGTLMDDMLRTFRNFKTFTSSIEGIYLVE 458

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVA 155
            S  L  +QK+ L   G+     T +         DVP+ +               F+ A
Sbjct: 459 ASPTLREVQKQLLC--GEAAMEETDIGHRSVCKYFDVPVVWVEDIRLLPHEQDKTPFIFA 516

Query: 156 NEFFDSLPIKQF--------------VMTEHG----------------------IRERMI 179
           +EFFD+LPI  F              +MT  G                      +  + +
Sbjct: 517 HEFFDALPIHAFESVPPSPENHPPDEIMTPTGPTKLHTPPKPTNTPQWRELMVTLNPKAV 576

Query: 180 DIDQHDSLVFNIGD-----------HEIKSNFLTCSDYFLGAIFENSP------------ 216
           D +Q D   F +              EI + +        GA  E SP            
Sbjct: 577 DENQPDEPEFTLTRAKASTPSSLVIPEISARYRALKSQ-PGATIEVSPESRIYASDFARR 635

Query: 217 ----------CRDREMQSISDRLACDGGTA--------IVIDYGYLQSRVGDTLQAVKGH 258
                        R+  S +D        A        +++DYG + +   ++L+ ++ H
Sbjct: 636 IGGASQPPRTATRRDQLSSADATTGPAAAAKSVPSGAALIMDYGTMSTIPINSLRGIQNH 695

Query: 259 TYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMK 316
             V PL  PGQ D+S+ VDF  L+  AI     + ++G   QG FL+ +GI +R   L++
Sbjct: 696 RNVPPLSAPGQVDVSADVDFVALAEAAIEASEGVEVHGPVEQGDFLQAMGITERMQQLLR 755

Query: 317 --QTARKDILLDSV-KRLVSTSADKKSMGELFKILVVSHE 353
             Q   K   L+S  +RLV        MG+++K++ +  E
Sbjct: 756 GVQDEEKRKTLESGWQRLVEKGGG--GMGKIYKVMAIIPE 793


>gi|117926895|ref|YP_867512.1| hypothetical protein Mmc1_3621 [Magnetococcus sp. MC-1]
 gi|117610651|gb|ABK46106.1| protein of unknown function DUF185 [Magnetococcus sp. MC-1]
          Length = 393

 Score =  136 bits (342), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 107/374 (28%), Positives = 177/374 (47%), Gaps = 35/374 (9%)

Query: 3   NKLIRKIVNLIKKNGQ-MTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFG 60
             L  +++   K++G  ++  ++  + +  P +GYY    +  G  GDF TAPE++ +FG
Sbjct: 10  EALQSELIEWAKEHGGILSFRKFMEMALYHPSYGYYMRKWSRLGVEGDFTTAPEMTSLFG 69

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+L + ++  W++ G P+   ++E+G G G +  D+LR   K  PDF+  LS+ ++E S 
Sbjct: 70  ELLTLQMMEVWQRMGSPAFFAVMEVGAGSGKLAGDVLRTAKKF-PDFYDALSLIILEKSP 128

Query: 121 RLTLIQKKQLASYG---DKINWYTSLADVPLGFTF---LVANEFFDSLPIKQFVMTEHGI 174
               +Q + L   G    K+ W   L        F   +  NE  D+ P+     TE G+
Sbjct: 129 DFRRVQAEFLQKKGVDIHKVRWVYDLDAWEGEGAFQGVVYGNEVLDAFPVHWVEQTEQGL 188

Query: 175 RERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYF-LGAIFENSPCRDR---EMQSISDRLA 230
           +E +   D       +  +  ++       DYF +  I   +  R     + Q    R++
Sbjct: 189 KEVVAQWDGR-----SWCEQLVEPESALQGDYFKVRGIELETGWRTEFSLDAQQWLGRIS 243

Query: 231 C--DGGTAIVIDYGYLQSRV------GDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRL 281
              + G  ++IDYGY+            TL A + H  +  P + PG  DL++HVDF  +
Sbjct: 244 ANMEQGAVLMIDYGYVAQDYYQGGLPHGTLMAHQRHQRIKEPWLWPGDMDLTAHVDFSAM 303

Query: 282 SSIAI-LYKLYINGLTTQGKFLEGLGIWQR---AFSLMKQTARKDILLDSVKRLVSTSAD 337
             ++   + L + G TTQG FL G+GI QR   A  L +   R  +L  +V RL+   A 
Sbjct: 304 QQVSCGQHGLDLLGFTTQGWFLLGMGILQRLEQAIKLDEDRERVALLRQTVSRLIMPDA- 362

Query: 338 KKSMGELFKILVVS 351
              MGE FK+L V 
Sbjct: 363 ---MGERFKVLAVG 373


>gi|296224078|ref|XP_002757897.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 2
           [Callithrix jacchus]
          Length = 422

 Score =  135 bits (340), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 115/385 (29%), Positives = 176/385 (45%), Gaps = 66/385 (17%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P                            ++L 
Sbjct: 44  MLRHLMYKIKSTGPITVAEYMKEVLTNP---------------------------AKLLG 76

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 77  IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFSQLGSVLKNCDISVHLVEVSQKLS 136

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            +Q                     K +   G  ++WY  L DVP G +F +A+EFFD LP
Sbjct: 137 EVQALTLTEEKVPLERNAESPVYMKGVTKSGIPVSWYRDLHDVPKGHSFYLAHEFFDVLP 196

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +F  T  G RE  IDID    D L F +      +      D     I E  P     
Sbjct: 197 VHKFQKTPQGWREVFIDIDPQVSDKLRFVLAPCATPAEVFIQHDETRDHI-EVCPDAGVI 255

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DT +   GH     L+ PG ADL++ VDF  L
Sbjct: 256 IEELSRRIALTGGAALVADYGHDGTKT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSFL 314

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLD-----SVKRLVSTSA 336
             +A   K+   G  TQ  FL+ +GI  R   L  +     +LLD     SVK+ +    
Sbjct: 315 RRMA-QGKVASLGPITQHTFLKNMGIDVR---LKVRIFFFPVLLDKSNEQSVKQQLLQGY 370

Query: 337 D----KKSMGELFKIL-VVSHEKVE 356
           D     K MGE F    ++ H++++
Sbjct: 371 DMLMNPKKMGERFNFFALLPHQRLQ 395


>gi|58584709|ref|YP_198282.1| SAM-dependent methyltransferase [Wolbachia endosymbiont strain TRS
           of Brugia malayi]
 gi|58419025|gb|AAW71040.1| Predicted SAM-dependent methyltransferase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 388

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 95/136 (69%), Gaps = 3/136 (2%)

Query: 33  EFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIM 92
           E+GYY    P G  GDF+TAPEISQ+FGE++A++++  W++ G PS   LVELGPGRG +
Sbjct: 9   EYGYYMNKLPLGNGGDFITAPEISQLFGEIIAVWVMHTWKKLGKPSKFSLVELGPGRGTL 68

Query: 93  MLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTF 152
           + DI+RV  K    FFS ++I++VE S  L  IQK++L   G +I+W+ ++  +P   T 
Sbjct: 69  IHDIIRVTKKYG-SFFSSMAIHLVEISPTLQKIQKEKLK--GLEISWHENIDSLPEQPTI 125

Query: 153 LVANEFFDSLPIKQFV 168
            +ANEFFD+LPI QFV
Sbjct: 126 FLANEFFDALPIDQFV 141



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 96/184 (52%), Gaps = 21/184 (11%)

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCS-----DYFLGAIFENSPCRDREMQSISDRLAC 231
           R ID  Q     F++   +++ N++  S     + F GA+ E        ++ + D++  
Sbjct: 217 RKIDRKQAHYSTFSM---KLQKNWIPVSSNGMTEGFDGAVVEVCSAGIEVLKKLEDKIMN 273

Query: 232 DGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLY 291
           +GG A++IDYGY+      TLQ+V+ H Y + L N G +D+++ V+FQ L         Y
Sbjct: 274 NGGAALIIDYGYVYPSHKSTLQSVRQHKYANFLENVGNSDITALVNFQALRDSL----RY 329

Query: 292 IN-GLTTQGKFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADKKSMGELFKIL 348
           ++  ++TQ +FL   GI +R  +LM+  +  +K+ +     RL       ++MG LFK +
Sbjct: 330 VDCEISTQREFLYLFGIKERTQALMENASDEQKNRIFSEFLRLT------ENMGTLFKAI 383

Query: 349 VVSH 352
           ++ H
Sbjct: 384 LIHH 387


>gi|255644540|gb|ACU22773.1| unknown [Glycine max]
          Length = 246

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 110/185 (59%), Gaps = 20/185 (10%)

Query: 2   ENKLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           +++L++ +  +IK + G +++ +Y +  + +P+ GYY   + FGA GDF+T+PE+SQ+FG
Sbjct: 63  DSELVKHLKGIIKFRGGPISLGEYMSEVLTNPKAGYYINRDVFGAEGDFITSPEVSQMFG 122

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           EM+ ++++C WEQ G P  V LVELGPGRG +M D+LR   K K +F   L +++VE S 
Sbjct: 123 EMVGVWVMCLWEQMGQPQGVNLVELGPGRGTLMADLLRGASKFK-NFIESLHVHLVECSP 181

Query: 121 RLTLIQKKQLAS------------------YGDKINWYTSLADVPLGFTFLVANEFFDSL 162
            L  +Q + L                    +G  ++W+ +L         ++A+EFFD+L
Sbjct: 182 ALQKLQHQNLKCTDEENASQDTDTRTARSLFGTPVSWHATLEQFLQIANIIIAHEFFDAL 241

Query: 163 PIKQF 167
           P+ QF
Sbjct: 242 PVHQF 246


>gi|194378712|dbj|BAG63521.1| unnamed protein product [Homo sapiens]
          Length = 414

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 108/379 (28%), Positives = 172/379 (45%), Gaps = 61/379 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P                            ++L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNP---------------------------AKLLG 75

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 76  IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 135

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLP 163
            IQ                     K +   G  I+WY  L DVP G++F +A+EFFD LP
Sbjct: 136 EIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLP 195

Query: 164 IKQFVMTEHGIRERMIDIDQH--DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
           + +   T  G RE  +DID    D L F +      +      D     + E  P     
Sbjct: 196 VHKIQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHV-EVCPDAGVI 254

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +S R+A  GG A+V DYG+  ++  DT +    H     L+ PG ADL++ VDF  L
Sbjct: 255 IEELSQRIALTGGAALVADYGHDGTKT-DTFRGFCDHKLHDVLIAPGTADLTADVDFSYL 313

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADK 338
             +A   K+   G   Q  FL+ +GI  R   L+ ++    +   LL     L+    + 
Sbjct: 314 RRMA-QGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NP 368

Query: 339 KSMGELFKIL-VVSHEKVE 356
           K MGE F    ++ H++++
Sbjct: 369 KKMGERFNFFALLPHQRLQ 387


>gi|255950224|ref|XP_002565879.1| Pc22g19770 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592896|emb|CAP99265.1| Pc22g19770 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 507

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 122/453 (26%), Positives = 198/453 (43%), Gaps = 106/453 (23%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP----FGAVGDFVTAPEISQIFG 60
           L + + N++K  G + +  +    +  P+ GYY+T       FG  GDFVT+PEISQ+FG
Sbjct: 41  LAKTLANVMKVTGPVPIAAFMRQVLTSPDGGYYTTRGEGGGVFGKHGDFVTSPEISQVFG 100

Query: 61  EMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV--- 116
           E++ I+ I  W   G   S V+L+E+GPG+G +M D+LR     K    SV +IY+V   
Sbjct: 101 ELIGIWTIAEWMAQGRARSGVQLMEVGPGKGTLMDDMLRTFRNFKSFSSSVEAIYLVEAS 160

Query: 117 ----ETSERL----------TLIQKKQLASYGD-KINWYTSLADVPL--GFT-FLVANEF 158
               E  +RL          T I  + +  Y D  I W   +  +P   G T F+ A+EF
Sbjct: 161 GTLREVQKRLLCGEEAVMEETDIGHRSVCKYFDVPIVWVEDIRLLPHEEGKTPFIFAHEF 220

Query: 159 F--------DSLP---------IKQFVMTEHGIRE-----RMIDIDQHDSLVFNIGDHEI 196
           F        +S+P           + +MT  G  E     +  +  Q   L+  +    +
Sbjct: 221 FDALPIHAFESVPPSPENEQANAPRTIMTPTGPAELHNPPKPANTPQWRELMVTLNPKAV 280

Query: 197 KSNFLTCSDYFLGAIFENSPC---------RDREMQS------------------ISDRL 229
           + N     ++ L     ++P          R R ++S                   + R+
Sbjct: 281 EENIKGEPEFQLTKAKASTPSSLVIPEISQRYRALKSRPGSTIEISPESRIYAADFARRI 340

Query: 230 ACD------------------------GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLV 265
             D                         G A+++DYG L +   ++L+ +K H  V+PL 
Sbjct: 341 GGDSASALAAKKSSASSPPPSSEKKTPSGAALIMDYGTLSTIPINSLRGIKSHEKVAPLS 400

Query: 266 NPGQADLSSHVDFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMKQTA---R 320
            PG+ D+S+ VDF  L+  AI     + ++G   QG FL  +GI +R   L+++      
Sbjct: 401 EPGRVDVSADVDFTSLAEAAIEGSDGVEVHGPVEQGDFLGAMGIEERMRQLLRKVPDEEH 460

Query: 321 KDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           K  L  + KRLV    D  SMG+++K++ +  E
Sbjct: 461 KKTLETAWKRLVEK--DGGSMGQIYKVMAIVPE 491


>gi|71020305|ref|XP_760383.1| hypothetical protein UM04236.1 [Ustilago maydis 521]
 gi|46100052|gb|EAK85285.1| hypothetical protein UM04236.1 [Ustilago maydis 521]
          Length = 1159

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 113/212 (53%), Gaps = 35/212 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-------FGAVGDFVTAPEISQIFGE 61
           +++ I+ +G M V  Y   C+ DP  GYYS+ N         G+ GDF+T+PEISQ+FGE
Sbjct: 688 LLDSIRASGPMPVSTYMRTCLLDPMQGYYSSANSPSTSREVLGSRGDFITSPEISQVFGE 747

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++AIF +  W+  G PS  R+VELGPG+G ++ D+LR     KP   ++  I++VETSE 
Sbjct: 748 LVAIFYLARWQSVGAPSATRIVELGPGKGTLLADMLRTFATFKPFMATLKRIHLVETSEG 807

Query: 122 LTLIQ----KKQLASYGDK--------------INWYTSLADVPL---GFTFLVANEFFD 160
           L  +Q    K+ L   G +              + W+  +  VP+     T L A+EFFD
Sbjct: 808 LMELQLNAIKEALGVVGKRVVSAEEDAGADGVVVEWFPGIDMVPVIPEELTILTAHEFFD 867

Query: 161 SLPIKQFVMTEHGI----RERMIDIDQHDSLV 188
           +LP   F   E G+    RE ++ I    S+ 
Sbjct: 868 ALPTHIF---EKGVDGKFREVLVGIKPTSSIT 896



 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 67/139 (48%), Gaps = 9/139 (6%)

Query: 218  RDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVD 277
            R  E Q +S   A +GG  ++IDYG  ++  G +L+A K H  V    +PG  DL+ +VD
Sbjct: 1002 RRLETQRLSH--ATEGGIGLIIDYGDDKA-YGSSLRAFKNHALVRVFDSPGTVDLTVNVD 1058

Query: 278  FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKD--ILLDSVKRLVSTS 335
            F  L S          G   Q  FL G+G+  R  +L+K     D   + D+  RL+   
Sbjct: 1059 FLHLKSAIHTTDARYLGPIDQADFLVGMGLQMRTEALVKGRDAHDENRIKDAANRLI--- 1115

Query: 336  ADKKSMGELFKILVVSHEK 354
             D+  MG  +K L ++  +
Sbjct: 1116 -DESGMGIQYKALAITARR 1133


>gi|83775006|dbj|BAE65129.1| unnamed protein product [Aspergillus oryzae]
          Length = 535

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 121/482 (25%), Positives = 195/482 (40%), Gaps = 137/482 (28%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-----FGAVGDFVTAPEISQIF 59
           L R + + IK  G + +  +    +  PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 42  LARTLADAIKVTGPIPIAAFMRQVLTSPEGGYYTTRPAGDGEVFGKKGDFVTSPEISQVF 101

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRV--------ICKLKPDFFSV 110
           GE++ I+ I  W   G  S  V+L+E+GPG+G +M D+LRV          + +  F ++
Sbjct: 102 GELVGIWTIAEWMAQGRKSSGVQLMEVGPGKGTLMDDMLRVSLPHLLFSPARRREVFDTI 161

Query: 111 LS--------------------IYMVETSERLTLIQKKQLASYGDKINWYTSLA------ 144
           L+                    IY+VE S  L  +QK++L   GD     T +       
Sbjct: 162 LTTGVISQTFRNFKSFTSSIEAIYLVEASPTLREVQKQRLC--GDATMEETEIGHTSTCK 219

Query: 145 --DVPLGF--------------TFLVANEFFDSLPIKQF-----------------VMTE 171
             +VP+ +               F++A+EFFD+LPI  F                 +MT 
Sbjct: 220 YFNVPVIWVEDIRLLPHEEDKSPFIIAHEFFDALPIHAFESVPPSPENQPPQSQDTIMTP 279

Query: 172 HGIRE-----RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFL------------------ 208
            G  +     +  +  Q   L+  +    I  N     ++ L                  
Sbjct: 280 TGPTKLHKPLKPANTPQWRELMVTLNPKAIDENLPNEPEFKLTHAKASTPSSLVIPEISP 339

Query: 209 ---------GAIFENSP-----------------------CRDREMQSISDRLACDGGTA 236
                    G+  E SP                        R+   Q  +       G A
Sbjct: 340 RYRALKSQPGSTIEISPESRIYASDFARRIGGASQPPRTKARNASTQPAAPAKRVPSGAA 399

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI--LYKLYING 294
           +++DYG + +   ++L+ ++ H  V PL  PGQ D+S+ VDF  L+  A+     + ++G
Sbjct: 400 LIMDYGTMDTIPVNSLRGIQHHRKVPPLSAPGQVDVSADVDFTALAEAALEGSEGVEVHG 459

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQTA---RKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
              QG FL  +GI +R   L+K      ++  L    +RLV        MG+++K + + 
Sbjct: 460 PVEQGDFLRTMGIAERMQQLLKHEKDEEKRKTLESGWQRLVEKGGG--GMGKIYKFMAIV 517

Query: 352 HE 353
            E
Sbjct: 518 PE 519


>gi|225631051|ref|ZP_03787792.1| hypothetical protein WUni_002380 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225591250|gb|EEH12391.1| hypothetical protein WUni_002380 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 163

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 101/155 (65%), Gaps = 3/155 (1%)

Query: 14  KKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQ 73
           K  G +++  +    +   ++GYY++  P G  GDF TAPEISQ+FGE++A++++  WE+
Sbjct: 11  KSQGSISISDFMNAVLYHEKYGYYTSKLPLGKDGDFTTAPEISQLFGEVIAVWIMHTWEK 70

Query: 74  HGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY 133
            G PS   LVELGPG+G ++ DI+RV  K+   FF+ + I++VE S  L  IQK++L S 
Sbjct: 71  LGKPSKFSLVELGPGKGTLIHDIIRV-TKIYSSFFNSMLIHLVEISPTLRKIQKEKLKSL 129

Query: 134 GDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFV 168
              +NW+ ++  +P   T  +A EFFD+LPI QFV
Sbjct: 130 --DVNWHKNIDYLPEQPTIFLAYEFFDALPIDQFV 162


>gi|297667839|ref|XP_002812172.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 3
           [Pongo abelii]
          Length = 370

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 108/361 (29%), Positives = 166/361 (45%), Gaps = 69/361 (19%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLIYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE + +  
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEKTPQ-- 160

Query: 124 LIQKKQLASYGDKINWYTSLAD----VPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
                          W     D    V     F++A     + P + F+           
Sbjct: 161 --------------GWREVFVDIDPQVSDKLRFVLAP---SATPAEAFI----------- 192

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
              QHD         E + +   C D   G I E           +S+R+A  GG A+V 
Sbjct: 193 ---QHD---------ETRDHVEVCPD--AGVIIEE----------LSERIALTGGAALVA 228

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG+  +R  DT +   GH     L+ PG ADL++ VDF  L  +A   K+   G   Q 
Sbjct: 229 DYGHDGTRT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSYLRRMA-QGKVASVGPIKQH 286

Query: 300 KFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADKKSMGELFKIL-VVSHEKV 355
            FL+ +GI  R   L+ ++    +   LL     L+    + K MGE F    ++ H+++
Sbjct: 287 TFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NPKKMGERFNFFALLPHQRL 342

Query: 356 E 356
           +
Sbjct: 343 Q 343


>gi|94969782|ref|YP_591830.1| hypothetical protein Acid345_2755 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551832|gb|ABF41756.1| protein of unknown function DUF185 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 370

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 110/360 (30%), Positives = 173/360 (48%), Gaps = 28/360 (7%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGAVGDFVTAPEISQIFGEMLAIFL 67
           I+++I+++G +   +Y  LC+  PE GYYS     FG  GDF T+ ++  +FG +L    
Sbjct: 7   IIDIIRRDGPIPFSRYMELCLYHPELGYYSRPREKFGKAGDFYTSSDVHAVFGRLLCRQF 66

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              W   G P  + LVELGPGRG+   D+L    K  P+F   L  ++VE+S  L    +
Sbjct: 67  EEMWRLLGSPGQMDLVELGPGRGLFGQDVLDWAGKKFPEFAKALRYWLVESSPSLRARLR 126

Query: 128 KQLASYGD-KINWYTSL--ADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
           ++ A  GD +++ Y  L  A    G + ++  NEFFD++P++  +++  G  E  I  D+
Sbjct: 127 ERFA--GDSRVSVYEGLEAAASNCGDSLVMFGNEFFDAIPVE--LLSRAG--ELYIAEDK 180

Query: 184 H---DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
               D  V    DH       +      G + E +      M+ I+   A   G A+ ID
Sbjct: 181 GHFIDRWVQPPHDHVQYLRDYSVPPESRGRV-EVAMQSQEWMEKIAHAFAERRGFALFID 239

Query: 241 YGY-----LQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           YGY     L  R  DTL   + H    +P   PG+ D+++HV+F  L  +A    +   G
Sbjct: 240 YGYTREQQLAGRHLDTLMTFREHQASANPYEAPGEQDITTHVNFTALQGVAEKNGMTSLG 299

Query: 295 LTTQGKFLEGLGI---WQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           L TQ +FL G+G    +  AF        +  +   +K L+S     + MGE F  LV++
Sbjct: 300 LVTQSQFLLGVGQQTEFADAFESCVLPQERAKVAMQLKHLISP----EEMGERFHALVLA 355


>gi|302661209|ref|XP_003022274.1| hypothetical protein TRV_03596 [Trichophyton verrucosum HKI 0517]
 gi|291186213|gb|EFE41656.1| hypothetical protein TRV_03596 [Trichophyton verrucosum HKI 0517]
          Length = 457

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 123/442 (27%), Positives = 181/442 (40%), Gaps = 120/442 (27%)

Query: 28  CVADPEFGYYST-----CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSC-VR 81
           C+   E GYY++      + FG  GDFVT+PEISQ+FGE+L I+++  W   G  S  V+
Sbjct: 4   CLTSDEGGYYTSRGTPGSDVFGKEGDFVTSPEISQMFGELLGIWIVTEWLSQGRRSSGVQ 63

Query: 82  LVELGPGRGIMMLDILRV---------ICKLKPDFF-----------SVLSIYMVETSER 121
           L+E GPG+G +M DILRV         I +L  D +           SV  +YM+E S  
Sbjct: 64  LMEFGPGKGTLMADILRVSLSLLNEHGILQLMGDTYQSVRNFKGFASSVEGVYMIEASPT 123

Query: 122 LTLIQKKQLAS-----------------YGDKINWYTSLADVPL---GFTFLVANEFFD- 160
           L  IQKK L                    G  + W   +  +P       F++A+EFFD 
Sbjct: 124 LREIQKKALCGDAPMEECDIGYKSTSIHLGVPVYWTEHIRILPQTEDKAPFIIAHEFFDA 183

Query: 161 -----------------------------SLPI-----KQFVMTEHGIRERMIDIDQHDS 186
                                        SLP+     ++ V+  +   ER  D D  DS
Sbjct: 184 LPIHAFQAVHSPPPETINTPTGPAELRQPSLPLNGTQWRELVVATNPEAEREPDGD--DS 241

Query: 187 LVFNIGDHEIK-----------------SNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
            V N    E +                 S+         G+  E SP      Q I+  +
Sbjct: 242 SVKNDKKLEFRLALAKSPTPASLVMPEMSSRYKALKSTRGSTIEISPESHTYAQEIARLI 301

Query: 230 A-------------CDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHV 276
                            G A+++DYG   +   ++L+ +K H  VSP   PG+ DLS+ V
Sbjct: 302 GGPNPTDKNPSPTRTPAGAALILDYGPSSTIPVNSLRGIKNHQVVSPFATPGEVDLSADV 361

Query: 277 DFQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRL 331
           DF  L+  A+     + + G   QG FL  LGI +RA  L+   K   ++  +  S +RL
Sbjct: 362 DFTGLAESALDASPGVEVYGPNEQGSFLRSLGIAERAAQLLRNVKDEEKRKQIESSWQRL 421

Query: 332 VSTSADKKSMGELFKILVVSHE 353
           V        MG ++K + +  E
Sbjct: 422 VERGGG--GMGRIYKAMAIVPE 441


>gi|159484015|ref|XP_001700056.1| hypothetical protein CHLREDRAFT_141994 [Chlamydomonas reinhardtii]
 gi|158281998|gb|EDP07752.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 375

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 100/173 (57%), Gaps = 20/173 (11%)

Query: 28  CVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGP 87
           C+  P+ G+Y + + FGA GDFVT+PEISQ+FGEM+ I+ +  W   G P  + LVELGP
Sbjct: 4   CLTSPQGGFYMSRDVFGAAGDFVTSPEISQLFGEMVGIWCVHTWMALGRPPRLALVELGP 63

Query: 88  GRGIMMLDILR---------VICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK-- 136
           GRG ++ D+LR         V    KP F S L +++VE S  L  +Q + L    D   
Sbjct: 64  GRGTLLADLLRGTAGEGGGGVCVSFKP-FASTLELHLVEMSPALRAVQWRALGCAPDPAA 122

Query: 137 ---INWYTSLADVP--LGFTFLVANEFFDSLPIKQFVMTEHGIR---ERMIDI 181
              ++W+ +L  VP   G    +A+EFFD+LP+ QFV    G R   E+++D+
Sbjct: 123 QKCVHWHATLDAVPDGPGPALYIAHEFFDALPVHQFVRDPEGRRGWLEKLVDV 175


>gi|78224276|ref|YP_386023.1| hypothetical protein Gmet_3084 [Geobacter metallireducens GS-15]
 gi|78195531|gb|ABB33298.1| protein of unknown function DUF185 [Geobacter metallireducens
           GS-15]
          Length = 385

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 177/365 (48%), Gaps = 22/365 (6%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFG 60
           +N+L   I+N I++ G++    + A+C+ +P  GYY S     GA GDF T+  +  +FG
Sbjct: 6   DNRLRGIILNRIREQGRIPFADFMAMCLYEPGLGYYTSPGRKVGAEGDFYTSINVHSVFG 65

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
            ++A  +   WE+ G P+   +VE G G G +  D++  I +L P  +  + + ++E   
Sbjct: 66  RLIAREICRMWEEMGRPASFDIVEAGAGHGRLATDVIDAIQELNPTLYDGIRLTLIEAEP 125

Query: 121 RLTLIQKKQLASYGDKINWYTS--LADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRER 177
            L  +Q + LA +  K++W T   LA+  L FT  L +NE  DS P     M   G+RE 
Sbjct: 126 SLAAVQGELLAPHLPKVSWSTPADLAEGRLRFTGCLYSNELIDSFPPHLVEMGPEGLREV 185

Query: 178 MI--DIDQHDSLVFNIGDHEIKSNFLTCSDYF-LGAIFENSPCRDREMQSISDRLACDGG 234
            +  + DQ   ++      E+++        F +G   E +    R ++S++   A + G
Sbjct: 186 FVAAEGDQFSEILDLPSTPELEAYLSRLGITFAVGQRAEINLNAVRWLESVAT--ALERG 243

Query: 235 TAIVIDYGYLQS------RVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRLSSIAIL 287
             + IDYGYL        R+  TL     HT   +P +  G  D+++HVDF  L++    
Sbjct: 244 FVLTIDYGYLAPELYGPMRLNGTLLCYYRHTIEENPYIRIGLQDMTTHVDFTTLAARGEE 303

Query: 288 YKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKD--ILLDSVKRLVSTSADKKSMGEL 344
             L       Q +FL   G+ +   +L    T+ K+   +  ++K+L+     +  MG+ 
Sbjct: 304 LGLRKVWYGEQYRFLVATGMMEELMALEAAATSEKEQIAIRLALKKLI---LPEGGMGDT 360

Query: 345 FKILV 349
           FK+LV
Sbjct: 361 FKVLV 365


>gi|297265815|ref|XP_002799257.1| PREDICTED: protein midA homolog, mitochondrial-like [Macaca
           mulatta]
          Length = 371

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 163/361 (45%), Gaps = 69/361 (19%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 44  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGKQGDFITSPEISQIFGELLG 103

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE + +  
Sbjct: 104 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEKTPQ-- 161

Query: 124 LIQKKQLASYGDKINWYTSLAD----VPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
                          W     D    V     F++A     + P + F+           
Sbjct: 162 --------------GWREVFIDIDPQVSDKLRFVLAP---SATPAEAFI----------- 193

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
              QHD         E + +   C D   G I E           +S R+A  GG A+V 
Sbjct: 194 ---QHD---------ETRDHVEVCPD--AGVIIEE----------LSQRIALTGGAALVA 229

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG+  ++     +   GH     L+ PG ADL++ VDF  L  +A   K+   G   Q 
Sbjct: 230 DYGHDGTKT-XMFKGFCGHKLHDVLIAPGTADLTADVDFSYLRRMA-QGKVASLGPIKQH 287

Query: 300 KFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADKKSMGELFKIL-VVSHEKV 355
            FL+ +GI  R   L+ ++    +   LL     L+    + K MGE F    ++ HE++
Sbjct: 288 TFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NPKKMGERFNFFALLPHERL 343

Query: 356 E 356
           E
Sbjct: 344 E 344


>gi|114576972|ref|XP_001167175.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 4 [Pan
           troglodytes]
          Length = 370

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 164/361 (45%), Gaps = 69/361 (19%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE + +  
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEKTPQ-- 160

Query: 124 LIQKKQLASYGDKINWYTSLAD----VPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
                          W     D    V     F++A     + P + F+           
Sbjct: 161 --------------GWREVFVDIDPQVSDKLRFVLAPS---ATPAEAFI----------- 192

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
              QHD         E + +   C D   G I E           +S R+A  GG A+V 
Sbjct: 193 ---QHD---------ETRDHVEVCPD--AGVIIEE----------LSQRIALTGGAALVA 228

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG+  ++  DT +    H     L+ PG ADL++ VDF  L  +A   K+   G   Q 
Sbjct: 229 DYGHDGTKT-DTFRGFCDHKLHDVLIAPGTADLTADVDFSYLRRMA-QGKVASLGPIKQH 286

Query: 300 KFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADKKSMGELFKIL-VVSHEKV 355
            FL+ +GI  R   L+ ++    +   LL     L+    + K MGE F    ++ H+++
Sbjct: 287 TFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NPKKMGERFNFFALLPHQRL 342

Query: 356 E 356
           +
Sbjct: 343 Q 343


>gi|194386570|dbj|BAG61095.1| unnamed protein product [Homo sapiens]
          Length = 370

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 164/361 (45%), Gaps = 69/361 (19%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE + +  
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEKTPQ-- 160

Query: 124 LIQKKQLASYGDKINWYTSLAD----VPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
                          W     D    V     F++A     + P + F+           
Sbjct: 161 --------------GWREVFVDIDPQVSDKLRFVLAPS---ATPAEAFI----------- 192

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
              QHD         E + +   C D   G I E           +S R+A  GG A+V 
Sbjct: 193 ---QHD---------ETRDHVEVCPD--AGVIIEE----------LSQRIALTGGAALVA 228

Query: 240 DYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQG 299
           DYG+  ++  DT +    H     L+ PG ADL++ VDF  L  +A   K+   G   Q 
Sbjct: 229 DYGHDGTKT-DTFRGFCDHKLHDVLIAPGTADLTADVDFSYLRRMA-QGKVASLGPIKQH 286

Query: 300 KFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADKKSMGELFKIL-VVSHEKV 355
            FL+ +GI  R   L+ ++    +   LL     L+    + K MGE F    ++ H+++
Sbjct: 287 TFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLM----NPKKMGERFNFFALLPHQRL 342

Query: 356 E 356
           +
Sbjct: 343 Q 343


>gi|296224080|ref|XP_002757898.1| PREDICTED: protein midA homolog, mitochondrial-like isoform 3
           [Callithrix jacchus]
          Length = 378

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 112/364 (30%), Positives = 161/364 (44%), Gaps = 68/364 (18%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 44  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVHRDMLGEKGDFITSPEISQIFGELLG 103

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTL 124
           I+ I  W   G  +  +LVELGPGRG ++ DILRV        FS L   +      + L
Sbjct: 104 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRV--------FSQLGSVLKNCDISVHL 155

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
           ++K                                          T  G RE  IDID  
Sbjct: 156 VEK------------------------------------------TPQGWREVFIDIDPQ 173

Query: 185 --DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
             D L F +      +      D     I E  P     ++ +S R+A  GG A+V DYG
Sbjct: 174 VSDKLRFVLAPCATPAEVFIQHDETRDHI-EVCPDAGVIIEELSRRIALTGGAALVADYG 232

Query: 243 YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFL 302
           +  ++  DT +   GH     L+ PG ADL++ VDF  L  +A   K+   G  TQ  FL
Sbjct: 233 HDGTKT-DTFRGFCGHKLHDVLIAPGTADLTADVDFSFLRRMA-QGKVASLGPITQHTFL 290

Query: 303 EGLGIWQRAFSLMKQTARKDILLD-----SVKRLVSTSAD----KKSMGELFKIL-VVSH 352
           + +GI  R   L  +     +LLD     SVK+ +    D     K MGE F    ++ H
Sbjct: 291 KNMGIDVR---LKVRIFFFPVLLDKSNEQSVKQQLLQGYDMLMNPKKMGERFNFFALLPH 347

Query: 353 EKVE 356
           ++++
Sbjct: 348 QRLQ 351


>gi|300313681|ref|YP_003777773.1| hypothetical protein Hsero_4398 [Herbaspirillum seropedicae SmR1]
 gi|300076466|gb|ADJ65865.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 394

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 167/364 (45%), Gaps = 46/364 (12%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAIFLIC 69
            +    G ++  +Y  L +  P+ GYYS  +   G  GDF TAPEIS ++G  LA   + 
Sbjct: 34  EIAAAGGWISFQRYMELALYAPQVGYYSGGSAKLGKEGDFTTAPEISPLYGATLAS--LA 91

Query: 70  AWEQHGFPSCVR-LVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
           A      PS    L+E G G G +  DIL    +L+         ++VE S +L   Q++
Sbjct: 92  AEVIAASPSVDNVLLEFGAGTGKLAHDIL---TELQARAALPQRYFIVEISAQLRARQQQ 148

Query: 129 QLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
            LA++   + W  +L   P  F+  +V NE  D++P++  V  E G +ER + +D    L
Sbjct: 149 TLAAFAPLVQWLDAL---PATFSGVVVGNEVLDAMPVRLAVKAEQGWQERGVALDAEGRL 205

Query: 188 VF-----------NIGD-HEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC-DGG 234
            F            I D HE+   +LT          E +P     M ++   LA   G 
Sbjct: 206 RFEDRSVDDLPLAQIPDAHELPPGYLT----------EVAPVAIGFMHTLGRMLASGPGA 255

Query: 235 TAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAIL 287
            AI+ DYG      YL  R   TL    + H +  P   PG  D+++HVDF  ++  A+ 
Sbjct: 256 LAILPDYGFPAAEYYLHDRDQGTLMCHYRHHAHTDPFYWPGLQDITAHVDFTAMAVAAVE 315

Query: 288 YKLYINGLTTQGKFLEGLGIWQRAFSLMKQ-TARKDILLDSVKRLVSTSADKKSMGELFK 346
               +   T+QG FL   GI +       + +AR   L + +++L+S +     MGELFK
Sbjct: 316 EGAEVLAYTSQGAFLLNAGIGELLLRTSPEDSARYLPLANGMQKLISPA----EMGELFK 371

Query: 347 ILVV 350
           +L +
Sbjct: 372 VLAI 375


>gi|313234207|emb|CBY10275.1| unnamed protein product [Oikopleura dioica]
          Length = 271

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 135/271 (49%), Gaps = 18/271 (6%)

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVI----CKLKPDFFSVLSI 113
           +FGE++  +++  W   G P     +ELGPGRG +  D L  I     K+  D  +++++
Sbjct: 1   MFGELIGAWILQEWTIAGKPKSFEYLELGPGRGTLAKDALNAIQTLLNKVDDDKKTMINV 60

Query: 114 YMVETSERLTLIQKKQLASYGDKIN--WYTSLADVPLG--FTFLVANEFFDSLPIKQFVM 169
             VE S  L+  Q + LAS G  I+  WY S   +P     +F + NEFFD+LPI QF  
Sbjct: 61  KFVEVSPVLSKKQAETLASNGSNISAEWYRSFETLPESEDISFSICNEFFDALPIHQFDF 120

Query: 170 TEHG--IRERMIDIDQHDS----LVFNIGDHEIKSNFLTC--SDYFLGAI-FENSPCRDR 220
            E+    RE ++D D  D      V   GD       L    +D   G    E SP    
Sbjct: 121 NENTRQWREVIVDTDPVDKEKLRFVTAPGDTPAAKALLPMFDNDDLEGKRRVEVSPSSLI 180

Query: 221 EMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQR 280
             Q + +R+   GG++++IDYG+ + +  DTL+  K H  V  L NPG  D+++ V+F  
Sbjct: 181 HCQWLCERIMKQGGSSLIIDYGH-EGQKEDTLRGFKNHKLVEILDNPGDIDITADVNFSH 239

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRA 311
           L S+A    +  +   TQ  FL+ +GI  R+
Sbjct: 240 LRSVAEAIGVDASESITQDAFLKNMGIETRS 270


>gi|164658345|ref|XP_001730298.1| hypothetical protein MGL_2680 [Malassezia globosa CBS 7966]
 gi|159104193|gb|EDP43084.1| hypothetical protein MGL_2680 [Malassezia globosa CBS 7966]
          Length = 421

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 102/192 (53%), Gaps = 32/192 (16%)

Query: 28  CVADPEFGYYSTCNP------FGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVR 81
           C+ +P++GYY++ +        G  GDF+T+PEISQ+FGE+LA+F I  W+  G P  VR
Sbjct: 4   CLTNPDYGYYASKSQQENSRILGTRGDFITSPEISQVFGELLAVFFISRWQSAGAPKNVR 63

Query: 82  LVELGPGRGIMMLDILRVICKLKPDFFSVL-SIYMVETSERLTLIQKK------------ 128
           +VELGPGRG ++ D+LR      PD  S + SI ++E+S      Q+             
Sbjct: 64  IVELGPGRGTLLCDMLRTFSAF-PDMISAIRSIELIESSPLFIEQQEANLSATLSRFGRS 122

Query: 129 ---------QLASYGDKINWYTSLADVPL---GFTFLVANEFFDSLPIKQFVMTEHGIRE 176
                    QLA    ++ W+ S   VP     +T +VA+EFFD+LPI  F     G RE
Sbjct: 123 IANADTPVDQLAPNDLRVEWFASYEQVPTEPNAWTIVVAHEFFDALPIHIFEKHIDGWRE 182

Query: 177 RMIDIDQHDSLV 188
            M+D++     V
Sbjct: 183 VMVDVNDESKPV 194



 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 70/140 (50%), Gaps = 16/140 (11%)

Query: 233 GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYI 292
           GG  +VIDYG ++    D+ +A + H  V PL  PGQ+DL+++VDF  L         Y 
Sbjct: 287 GGCGLVIDYGGMRF-FSDSFRAFRAHKLVDPLEMPGQSDLTANVDFTFLMHAIHTTNAYT 345

Query: 293 NGLTTQGKFLEGLGIWQRAFSLMK--QTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
            G  +Q  FL  LG+  R  +L++  +  R+  +  +  RL+ T+     MG  ++++ +
Sbjct: 346 YGPLSQQDFLTALGLSLRVKNLVESNRADRQAEIQRAANRLIETNG----MGTQYQVMGI 401

Query: 351 SH---------EKVELMPFV 361
           S          E  E+ PF+
Sbjct: 402 SSPHRATAPEGEPEEVYPFI 421


>gi|330813698|ref|YP_004357937.1| hypothetical protein SAR11G3_00723 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486793|gb|AEA81198.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 300

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 152/298 (51%), Gaps = 13/298 (4%)

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFF-SVLSIYMVETSE 120
           M+AI+++  W +   P  + ++ELGPG G M  DI+  + K+  +FF S ++ Y +E S+
Sbjct: 1   MIAIWIVLFWNKIKKPKTLNILELGPGDGTMGKDIISSLGKI--NFFKSKVNYYFLEKSK 58

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMI 179
            L  IQKK L +  + I W  +L D       ++  NEFFD+LP+KQF  +     E+ +
Sbjct: 59  SLKKIQKKNLKNEKN-IYWIDNLKDFKKKDNLIILGNEFFDALPVKQFSKSGDSWFEKYV 117

Query: 180 DIDQHD--SLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
             +     S VF     +         +  +    E     ++ ++ ISD L       +
Sbjct: 118 FFNDKKQLSFVFKKAKLKSIKKIEKIYNLKINKFIEYPLILEKLIKRISDLLKNKNSIFL 177

Query: 238 VIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTT 297
            IDYG       DT+QA+  +   + L N G++D++  V+F  L  +    KL++   TT
Sbjct: 178 TIDYGEDSRICNDTVQAIYKNNKSNILQNVGESDITYQVNFFHLIKLFKKNKLHLVEFTT 237

Query: 298 QGKFLEGLGIWQRAFSLMKQTAR-KDILLDS-VKRLVSTSADKKSMGELFKILVVSHE 353
           Q  FL+ LGI +RA +  K   + + +LLD+ +KRL+        MG LFK+L++S++
Sbjct: 238 QSNFLQKLGIKERAINAKKNLKKNQQLLLDTALKRLLHPL----EMGSLFKVLIISNQ 291


>gi|158336911|ref|YP_001518086.1| hypothetical protein AM1_3782 [Acaryochloris marina MBIC11017]
 gi|158307152|gb|ABW28769.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 405

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 101/344 (29%), Positives = 164/344 (47%), Gaps = 46/344 (13%)

Query: 5   LIRKIVNLIKK--NGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGE 61
           L ++I N I +  + ++T  ++  L + DPE GYY+T     G  GDF T+P +   FGE
Sbjct: 11  LFQRIANRIHETPHQRITFAEFMELALYDPEQGYYATNQVQIGVAGDFFTSPHLCPDFGE 70

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPD---------FFSVLS 112
           +LA   +  W   G P    LVE+G G+G++  D+L+ +   K           F++ L 
Sbjct: 71  LLAEQFLDMWRVMGQPEPFTLVEMGAGQGLVAADVLKYLATRKQSAEASDDYAAFWTALR 130

Query: 113 IYMVETSERLTLIQKKQLASY---GDKINW--YTSLADVPLGFTFLVANEFFDSLPIKQF 167
             +VE +E L   Q++ L  +    DK+ W  +  L    +   F  +NE  D+LP+ QF
Sbjct: 131 YLIVEKAEGLIAAQQRLLQPFQFSPDKVQWMGFEQLPKTGIVGCFF-SNELVDALPVHQF 189

Query: 168 VMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLT--CSDYF------LGAIFENSPCRD 219
           V+ +  ++E  + +D  +S  F     E+ SN  T   ++Y       +GA +E+    +
Sbjct: 190 VVQDGALQEVFVTVDA-ESRSFT----EVISNPSTGRLAEYLVEQGIDIGAGYEDGYRSE 244

Query: 220 RE------MQSISDRLACDGGTAIVIDYGYLQ------SRVGDTLQAVKGH-TYVSPLVN 266
                   ++++S +L  D G  + IDYGYL        R+  TLQ  + H  +  P   
Sbjct: 245 INLAALDWLETVSQKL--DRGYVLTIDYGYLAPQYYSPQRLQGTLQCFRRHGAHQDPYAY 302

Query: 267 PGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
            G  D+++HV+F  L    +   L   G T QG FL  LG+  R
Sbjct: 303 LGHQDITAHVNFTTLKKQGLALGLTSMGYTQQGLFLMALGLGDR 346


>gi|152981198|ref|YP_001355125.1| hypothetical protein mma_3435 [Janthinobacterium sp. Marseille]
 gi|151281275|gb|ABR89685.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 386

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 172/370 (46%), Gaps = 41/370 (11%)

Query: 3   NKLIRKIVNLI-KKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFG 60
           N L   I + I ++ G ++  +Y  L +  P+ GYYS      G  GDF TAPEI+ +FG
Sbjct: 17  NTLQNLIADEINRRAGWISFARYMELALYAPDVGYYSGGAAKLGKDGDFTTAPEITSLFG 76

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E LA        Q    S  +++E G G G + LDIL   C          SI  VE S 
Sbjct: 77  ETLAHAAGELMAQ----SAPQILEFGAGTGKLALDIL-TECAAAGIPLERYSI--VELSG 129

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMI 179
            L   Q++ LA +  +++W   L D P  F+ +V  NE  D++P+   V  E    ER +
Sbjct: 130 ELRARQQQTLAGF-PQVSW---LDDFPPAFSGVVLGNEVLDAMPVSLVVKGEAEWLERGV 185

Query: 180 DI-DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC------D 232
            I D     V    D E+ +     ++  +G + E  P     M +++  L         
Sbjct: 186 SIADGRFIFVDRPCDQELITQIPDAAELPVGYLTEVHPIAAGFMHTLATMLTAGFEQSGK 245

Query: 233 GGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
           GG AI+IDYG      YL  R   TL    + H++  P   PG  D+++HVDF  ++  A
Sbjct: 246 GGAAILIDYGFPASEYYLDQRAEGTLMCHYRHHSHPDPFYLPGLQDITAHVDFTSMAYAA 305

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL-----LDSVKRLVSTSADKKS 340
           +   L + G  +Q  FL   G+  R  +    TA +D +      ++V++L S +     
Sbjct: 306 VRNGLEMVGYMSQAGFLLTAGLGDRLLA----TAPEDHMAYLPKANAVQKLTSPA----E 357

Query: 341 MGELFKILVV 350
           MGELFK+LVV
Sbjct: 358 MGELFKVLVV 367


>gi|254423748|ref|ZP_05037466.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
 gi|196191237|gb|EDX86201.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
          Length = 397

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 94/322 (29%), Positives = 155/322 (48%), Gaps = 30/322 (9%)

Query: 18  QMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           ++T  Q+  L +  P+ GYY+T  +  G+ GDFVT+P +S+ FGE++A   +  WE+ G 
Sbjct: 22  RITFAQFMDLALYHPQIGYYATPSSSLGSQGDFVTSPHMSRDFGEVVAEQFVDMWEKLGR 81

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           P    LVE+G G+G++  D +  +    PD F+ LS  +VE S+ L   Q+++L  + ++
Sbjct: 82  PDPFDLVEMGAGQGLVAEDAIAYLQSHHPDCFATLSYTIVEKSDSLKAEQQQRLRHWNEQ 141

Query: 137 ---INWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
              I W    A  P   T    +NE  D+ P+    + +  ++E  + I   +  +  +G
Sbjct: 142 GISIRWQNFDAIAPSSITGCAFSNELVDAFPVHWVELRDQKLQEIYV-IHTEEGFLAQLG 200

Query: 193 DHEIKSNFLTCSDYF--LGAIFENSPCRDRE---------MQSISDRLACDGGTAIVIDY 241
           D    S     + YF  +G    N P   R          +  I+D++  D G  + IDY
Sbjct: 201 DLSTPS----LASYFRRIGIDLSNYPEGYRTEVNLSALEWLAQIADKI--DRGYLLTIDY 254

Query: 242 GYLQ------SRVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           GY        +R   TLQ    H + S P ++ G+ D+++HVDF  + +      L   G
Sbjct: 255 GYSAQRYYSPARTEGTLQCYYQHNHHSDPFIHIGEQDITAHVDFTAIETQGNEVGLQSLG 314

Query: 295 LTTQGKFLEGLGIWQRAFSLMK 316
              QG FL  LG+  R  +L +
Sbjct: 315 FIQQGLFLMALGLGDRLQALYE 336


>gi|313220377|emb|CBY31232.1| unnamed protein product [Oikopleura dioica]
          Length = 363

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 103/334 (30%), Positives = 155/334 (46%), Gaps = 47/334 (14%)

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVIC----KLKPDFFSVLSI 113
           +FGE +  +++  W   G P     +ELGPGRG +  D L  I     K+  D  +++++
Sbjct: 1   MFGEHIGAWILQEWTIAGKPKSFEYLELGPGRGTLAKDALNAIQTLLDKVDDDKKTMINV 60

Query: 114 YMVETSERLTLIQKKQL------------------ASYGDKIN--WYTSLADVPLG--FT 151
             VE S  L+  Q + L                  AS G  I+  WY S   +P     +
Sbjct: 61  RFVEVSPVLSKKQAETLDLKITEVSEVEADGCYMKASNGSNISAEWYRSFETLPESNDIS 120

Query: 152 FLVANEFFDSLPIKQFVMTEHG--IRERMIDIDQHDS----LVFNIGDHEIKSNFLTC-- 203
           F + NEFFD+LPI QF   E+    RE ++D D  D      V   GD       L    
Sbjct: 121 FSICNEFFDALPIHQFDFNENTRQWREVIVDTDPVDKEKLRFVTAPGDTPAAKALLPMFD 180

Query: 204 SDYFLGAI-FENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVS 262
           +D   G    E SP      Q + +R+   GG++++IDYG+ + +  DTL+  K H  V 
Sbjct: 181 NDDLEGKRRVEVSPSSLIHCQWLCERIMKQGGSSLIIDYGH-EGQKEDTLRGFKNHKLVE 239

Query: 263 PLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT---- 318
            L NPG  D+++ V+F  L S+A    +  +   TQ  FL+ +GI  R   LM+ T    
Sbjct: 240 VLDNPGDIDITADVNFSHLRSVAEAIGVDASESITQDAFLKNMGIETRLLMLMRATISAP 299

Query: 319 ARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
           ARK+ L +    L+      K MG  F+++ +SH
Sbjct: 300 ARKN-LSECFDYLM------KEMGPKFRVMALSH 326


>gi|119177909|ref|XP_001240685.1| hypothetical protein CIMG_07848 [Coccidioides immitis RS]
          Length = 487

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 101/189 (53%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-----FGAVGDFVTAPEISQIF 59
           L + I ++I   G +++  Y   C+  PE GYY++        FG  GDFVT+PEISQ+F
Sbjct: 43  LAKTIADVINTAGPISIAAYMRQCLTSPEGGYYTSRGSTGVEVFGRKGDFVTSPEISQMF 102

Query: 60  GEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+L ++++  W   G  S  V+L+E+GPGRG +M D+LR +   K    S+ ++Y+VE 
Sbjct: 103 GELLGVWMVTEWMAQGRRSRGVQLIEVGPGRGTLMADMLRSVRNFKSFSSSIEAVYLVEA 162

Query: 119 SERLTLIQKKQLAS-----------------YGDKINWYTSLADVPLG---FTFLVANEF 158
           S  L  IQK+ L                    G  + W   +  +P G     F++A+EF
Sbjct: 163 SPTLRDIQKQMLCGDAPMEEIEVGYRSTSKHLGVPVVWTEHIRSLPQGDNDVPFIIAHEF 222

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 223 FDALPIHAF 231



 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 71/126 (56%), Gaps = 9/126 (7%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL--SSIAILYKLY 291
           G A+++DYG   S   ++L+ +K H  VSP  +PGQ DLS+ VDF  L  S+I+    + 
Sbjct: 349 GAALILDYGPSHSIPVNSLRGIKDHKLVSPFTSPGQVDLSADVDFIALADSAISASPGVE 408

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMK----QTARKDILLDSVKRLVSTSADKKSMGELFKI 347
           ++G T QG FL  LGI +RA  LMK    +T RK+I     KRLV        MG ++K 
Sbjct: 409 VHGPTEQGSFLHSLGISERAAQLMKRAEDETKRKNIEA-GWKRLVERGGG--GMGRIYKA 465

Query: 348 LVVSHE 353
           + +  E
Sbjct: 466 MAIIPE 471


>gi|303315715|ref|XP_003067862.1| hypothetical protein CPC735_041610 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240107538|gb|EER25717.1| hypothetical protein CPC735_041610 [Coccidioides posadasii C735
           delta SOWgp]
 gi|320031581|gb|EFW13542.1| hypothetical protein CPSG_09889 [Coccidioides posadasii str.
           Silveira]
          Length = 487

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 101/189 (53%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-----FGAVGDFVTAPEISQIF 59
           L + I ++I   G +++  Y   C+  PE GYY++        FG  GDFVT+PEISQ+F
Sbjct: 43  LAKTIADVINTAGPISIAAYMRQCLTSPEGGYYTSRGSTGVEVFGRRGDFVTSPEISQMF 102

Query: 60  GEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+L ++++  W   G  S  V+L+E+GPGRG +M D+LR +   K    S+ ++Y+VE 
Sbjct: 103 GELLGVWMVTEWMAQGRRSRGVQLIEVGPGRGTLMADMLRSVRNFKSFSSSIEAVYLVEA 162

Query: 119 SERLTLIQKKQLAS-----------------YGDKINWYTSLADVPLG---FTFLVANEF 158
           S  L  IQK+ L                    G  + W   +  +P G     F++A+EF
Sbjct: 163 SPTLRDIQKQMLCGDAPMEEIEVGYRSTSKHLGVPVVWTEHIRSLPQGDNDVPFIIAHEF 222

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 223 FDALPIHAF 231



 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 70/123 (56%), Gaps = 9/123 (7%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL--SSIAILYKLY 291
           G A+++DYG   S   ++L+ +K H  VSP  +PGQ DLS+ VDF  L  S+I+    + 
Sbjct: 349 GAALILDYGPSHSIPVNSLRGIKDHKLVSPFTSPGQVDLSADVDFIALADSAISASPGVE 408

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMK----QTARKDILLDSVKRLVSTSADKKSMGELFKI 347
           ++G T QG FL  LGI +RA  LMK    +T RK+I     KRLV        MG ++K 
Sbjct: 409 VHGPTEQGSFLHSLGISERAAQLMKRAEDETKRKNIEA-GWKRLVERGGG--GMGRIYKA 465

Query: 348 LVV 350
           + +
Sbjct: 466 MAI 468


>gi|134096343|ref|YP_001101418.1| hypothetical protein HEAR3190 [Herminiimonas arsenicoxydans]
 gi|133740246|emb|CAL63297.1| Conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 386

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 115/375 (30%), Positives = 168/375 (44%), Gaps = 53/375 (14%)

Query: 7   RKIVNLI-----KKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFG 60
            K+ NLI     + +G ++  +Y  L +  P+ GYYS      G  GDF TAPEI+ +FG
Sbjct: 17  HKLQNLIAEEIRRHDGWISFARYMELALYAPDLGYYSGGAAKLGKDGDFTTAPEITSLFG 76

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E LA        Q    S   ++E G G G + LDIL   C          +I  VE S 
Sbjct: 77  ETLAHAAGDLMAQ----SAPEILEFGAGTGKLALDIL-TECAAAGIHLEHYAI--VELSG 129

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMI 179
            L   Q++ LA +  +++W   L D P  F+ +V  NE  D++P+   V  EH   ER +
Sbjct: 130 ELRARQQQLLAGF-PQVSW---LDDFPPAFSGVVLGNEVLDAMPVSLVVKGEHAWLERGV 185

Query: 180 ----------DIDQHDSLVFNIGDHE-IKSNFLT----CSDYFLGAIFENSPCRDREMQS 224
                     D     +LV  I D E +   +LT     +  F+G +         EM +
Sbjct: 186 AYTDGKFVYADRPCDAALVAQIPDEENLPVGYLTEVHPVAAGFMGTL--------AEMFA 237

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
                +  GG AI+ DYG      YL  R   TL    + H +  P   PG  D+++HVD
Sbjct: 238 AGLEQSGKGGAAILFDYGFPAGEYYLDQRSEGTLMCHYRHHAHPDPFYLPGLQDITAHVD 297

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL-LDSVKRLVSTSA 336
           F  ++  A+   L + G  +Q  FL   G+  R        AR  +   ++V++L S + 
Sbjct: 298 FTAMAYAAVRSGLEMVGYMSQAAFLLAAGLGDRLLQTSPADARVYLPKANAVQKLTSPA- 356

Query: 337 DKKSMGELFKILVVS 351
               MGELFK+LVV 
Sbjct: 357 ---EMGELFKVLVVG 368


>gi|296813001|ref|XP_002846838.1| DUF185 domain-containing protein [Arthroderma otae CBS 113480]
 gi|238842094|gb|EEQ31756.1| DUF185 domain-containing protein [Arthroderma otae CBS 113480]
          Length = 490

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 118/442 (26%), Positives = 185/442 (41%), Gaps = 100/442 (22%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L ++I + I   G +++  +   C+   E GYY++      + FG  GDFVT+PEISQ+F
Sbjct: 40  LAKRITDAINTTGPISIAAFMRQCLTSDEGGYYTSRGAPGSDVFGKEGDFVTSPEISQMF 99

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+L I+++  W   G  S  V+L+E+GPG+G +M DILR +   K    S+  IY++E 
Sbjct: 100 GELLGIWIVTEWLSQGRRSSGVQLMEVGPGKGTLMADILRSVRNFKGFASSIEGIYLIEA 159

Query: 119 SERLTLIQKKQL-----------------ASYGDKINWYTS---LADVPLGFTFLVANEF 158
           S  L  IQK++L                    G  + W      L +V     F+VA+EF
Sbjct: 160 SPTLRDIQKQKLCGEAPMEECEIGHKSTSTHLGVPVYWTEHIRLLPEVENKAPFIVAHEF 219

Query: 159 FDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCR 218
           FD+LPI  F  + H      I+     +    +    +  N     +  +    E +   
Sbjct: 220 FDALPIHAF-QSVHSPPPETINTPTGPA---TLRQPPLPLNGTQWRELVVATNPEPTRES 275

Query: 219 DREMQSISDRLA---CDGGTAIVID-----YGYLQSRVGDTLQ-AVKGHTYV-------- 261
           D+  + +  RLA        ++V+      Y  L+S  G T++ + + HTY         
Sbjct: 276 DKNDKKLEFRLALAKSPTPASLVMPEMSPRYKALKSTRGSTIEISPESHTYAQEFARLIG 335

Query: 262 ---------SPLVNPGQADL-----------------------------------SSHVD 277
                    SP   P  A L                                   S+ VD
Sbjct: 336 GANPTGKDDSPTRTPAGAALILDYGPSSTIPVNSLRGIKNHQIVSPFATPGQVDLSADVD 395

Query: 278 FQRLSSIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMK----QTARKDILLDSVKRL 331
           F  L+  A+     + + G   QG FL  LGI +RA  L++    +T RK I   S +RL
Sbjct: 396 FTGLAESALNASPGVEVYGPNEQGSFLRSLGIAERAAQLLRNVKDETKRKQI-ESSWQRL 454

Query: 332 VSTSADKKSMGELFKILVVSHE 353
           V        MG+++K + +  E
Sbjct: 455 VDRGGG--GMGKIYKAMAIVPE 474


>gi|86609776|ref|YP_478538.1| hypothetical protein CYB_2336 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558318|gb|ABD03275.1| conserved hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 416

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 95/344 (27%), Positives = 158/344 (45%), Gaps = 39/344 (11%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEM 62
            KL   IV+ I+  G +T  Q+    + +P  GYY   +P G   D++T+P ++  F ++
Sbjct: 22  QKLRELIVSRIRAQGPVTFAQFMEWALYEPGLGYYEQGSPIGP--DYLTSPHLAADFAQL 79

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDIL------RVICKLK--PDFFSVLSIY 114
           LA  ++  W   G P   +++E+G G G +  D L      R   +L+  P F+  L   
Sbjct: 80  LAEQILQFWHILGSPPDFKVIEMGAGSGRLAQDWLTYVRSARPAARLREQPSFWQALDYG 139

Query: 115 MVETSERLTLIQKKQLASYGDKINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEH 172
           ++E S  L  +Q+++LA +G+K+ W  +  + D  +   F  +NE  D+ P+ +  + + 
Sbjct: 140 ILERSAHLRRLQQERLAPFGEKVRWLDWDGIPDESVTGCFF-SNELVDAFPVHRVQVQDG 198

Query: 173 GIRERMIDIDQHDSLVFNIGDHEIKSNFLT--CSDYF--LGAIFENSPCRDRE------- 221
            +RE  +D  +     F     E+  +  T    +YF  LG   E  P   +        
Sbjct: 199 ALREIYVDCSEAAEADFR----EVLGDLSTPELREYFARLGIPVETYPSGYQTEVNLKAL 254

Query: 222 --MQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADL 272
             +Q ++ +L    G  + IDYG      Y   R   TL A + H +Y  P V  G  DL
Sbjct: 255 EWLQLLARKLRR--GYVLTIDYGHTAQRYYSPHRAQGTLLAYRQHGSYTDPYVRVGSQDL 312

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMK 316
           ++HVDF  L  +     L   G T Q  FL  LG+ +R  +L +
Sbjct: 313 TAHVDFTTLEQVGESLGLRCLGFTRQSSFLVNLGLTERLAALSQ 356


>gi|119486211|ref|ZP_01620271.1| hypothetical protein L8106_17747 [Lyngbya sp. PCC 8106]
 gi|119456702|gb|EAW37831.1| hypothetical protein L8106_17747 [Lyngbya sp. PCC 8106]
          Length = 409

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 101/342 (29%), Positives = 164/342 (47%), Gaps = 42/342 (12%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAIFLICAWEQH 74
           N +++  +Y    +  P+ GYY+T     GA GDF TAP +   FGE+LA  L+  WE  
Sbjct: 29  NQRISFAEYMNWVLYHPQQGYYATPQTRIGASGDFFTAPHLGIDFGELLAEQLVEMWEIL 88

Query: 75  GFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYG 134
             P    LVE+G G+GI+  DIL+ I +  P  F V+   ++E S  L   Q+++L    
Sbjct: 89  HQPQPFTLVEMGAGQGILAADILQYIQRRYPHCFKVVDYIIIEKSAALKAEQQQKL---N 145

Query: 135 DKINWYTSLA-----DVP----LGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHD 185
           D+I    S+      D+P     G  F  +NE  D+LP+ Q ++  H +RE  + ++ H 
Sbjct: 146 DQIGSSVSVRWCEWDDIPNDSITGCFF--SNELVDALPVHQVIVRNHQLREIYVALNTHS 203

Query: 186 SLVFNIGDH--EIKSNFLT--CSDYF-------LGAIFENSPCRDREM------QSISDR 228
               +I  +  EI+++  T     YF       L  I+ +    +  +       +++++
Sbjct: 204 EGNNSINAYFTEIEADLSTPQLQTYFQSLKIDLLSEIYSDGYRTEINLAALDWITTVTNK 263

Query: 229 LACDGGTAIVIDYGYLQ------SRVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRL 281
           L    G  + IDYGY        +R   TLQ    H +  +P ++ GQ D+++HVDF  L
Sbjct: 264 L--QQGFVLTIDYGYSAERYYSPTRASGTLQCYYQHRHHNNPYIHIGQQDITAHVDFTAL 321

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI 323
                L  L + G T Q  FL  LG+  R  + + QT  +++
Sbjct: 322 EKQGELLGLEVIGFTQQALFLMALGLGDR-IAAISQTQGQNL 362


>gi|91774586|ref|YP_544342.1| hypothetical protein Mfla_0230 [Methylobacillus flagellatus KT]
 gi|91708573|gb|ABE48501.1| protein of unknown function DUF185 [Methylobacillus flagellatus KT]
          Length = 386

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 178/380 (46%), Gaps = 45/380 (11%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEML 63
           LIR+   ++   G ++  +Y  L +  P  GYYS     FG  GDFVTAPE++ +FG+ L
Sbjct: 23  LIRQ--EVVDAGGWVSFARYMELALYAPGLGYYSAGAQKFGVAGDFVTAPEMTPLFGQTL 80

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRG---IMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           A  ++    Q G      ++ELG GRG    +ML+ L++   L P+ + +L +     S 
Sbjct: 81  ARQVMAVLTQTGG----SILELGAGRGKLAAVMLEELQLANAL-PERYEILEVSAGLRSV 135

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMI 179
           +   +Q     +   ++ W  SL   P  FT +V ANE  D++P+      E G +E  +
Sbjct: 136 QQQYLQSVLAPALYARVAWLDSL---PEAFTGVVLANEVLDAVPVHLVRKEEAGWQELGV 192

Query: 180 DIDQHDSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQSISDRLACDGG 234
            ++Q  +L+     + D  + S    L   +Y+     E SP     + S++  L    G
Sbjct: 193 ALNQEGNLMLASRPLVDAGLVSGIEVLALPEYYQ---TETSPAARALVASLAQCL--QEG 247

Query: 235 TAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAIL 287
             + IDYG+        Q   G  +   + + +  PL+ PG  DL++HVDF  ++   I 
Sbjct: 248 VLLFIDYGFPRAEYYHPQRHQGTLMCHYRHYAHQDPLLYPGLQDLTAHVDFSAVAEAGIG 307

Query: 288 YKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-----LLDSVKRLVSTSADKKSMG 342
             L++ G  TQ +FL   GI +    LM +    D+     L  + ++L+S +     MG
Sbjct: 308 NGLHLLGYCTQAQFLINCGITE----LMSRVPAHDLMRYAPLASAAQKLLSPA----EMG 359

Query: 343 ELFKILVVSHEKVELMPFVN 362
           ELFK++ +      L  FV 
Sbjct: 360 ELFKVIALGRHVQPLSGFVR 379


>gi|91200015|emb|CAJ73057.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 377

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 102/379 (26%), Positives = 180/379 (47%), Gaps = 57/379 (15%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           I+  IK  G +T  ++  + +  PE+GYY S     G  GDF T+P + ++FGE++A+ L
Sbjct: 8   IIERIKNKGNITFAEFMQMALYYPEYGYYNSNAVSIGKSGDFYTSPAVHRMFGELIAVQL 67

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              W   G  S   +VE+G   G +  DI+R I    P F+  +  ++VE++  L   Q+
Sbjct: 68  EEMWRILGRAS-FTVVEMGANAGWLCYDIMRYIKNEYPWFYKKVQYFIVESNPHLREKQQ 126

Query: 128 KQLAS---YGDKINWYTSLADVPLGFTF------LVANEFFDSLPIKQFVMTEHGIRERM 178
           +       + +K++W++   D   GF+F       ++NEF D+LP+ + ++ E  ++E  
Sbjct: 127 ELFCGNPVFDEKLSWHSYGED---GFSFDAVQGCFLSNEFIDALPVHRLLVKEGEVKEIY 183

Query: 179 IDIDQHD--SLVFNIGDHEIKSNFLTCSDYFLGA--------IFE-NSPCRDREMQSISD 227
           +  + +D   +V ++ +H +K       DY + A        + E N   RD  +  ++ 
Sbjct: 184 VGYNGNDFYEIVGDVCNHALK-------DYCINAEMPLRESRVLEINLAARDY-LNHVAQ 235

Query: 228 RLACDGGTAIVIDYG------YLQSRVGDTLQAVK----GHTYVSPLVNPGQADLSSHVD 277
           +L C  G  + IDYG      Y  +  G TL+        H Y   L   G+ D+++ VD
Sbjct: 236 KLNC--GFVLTIDYGDTAQRRYRDNTTGGTLRCYYRHNVNHDYYERL---GEQDITASVD 290

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSAD 337
           F  L  +     L + GL  Q  +L  LG+ ++  ++          L++V + V     
Sbjct: 291 FSFLMDVGKGAGLEVTGLVKQSHYLIALGVLEKLNNIRNN-------LETVLK-VKNLFL 342

Query: 338 KKSMGELFKILVVSHEKVE 356
            + MGE+FK L + H  V+
Sbjct: 343 PEGMGEVFKAL-IQHRNVK 360


>gi|253700046|ref|YP_003021235.1| hypothetical protein GM21_1418 [Geobacter sp. M21]
 gi|251774896|gb|ACT17477.1| protein of unknown function DUF185 [Geobacter sp. M21]
          Length = 385

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 99/371 (26%), Positives = 156/371 (42%), Gaps = 32/371 (8%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGE 61
            KL   I+N I+ +G +T   +    + +P+ GYY++     GA GDF T+  +   FG 
Sbjct: 7   TKLAEIILNRIRTSGDITFASFMDAALYEPDLGYYTSAGRKVGAEGDFYTSMNVHSAFGR 66

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++A  +   WE    P+   + E G G G +  DIL  I +  P F+S L+  ++E    
Sbjct: 67  LIAQEICRFWEVLDSPASFTIAEAGAGGGQLAQDILDAISEDNPAFYSGLTYRLIEKEPS 126

Query: 122 LTLIQKKQLASYGDKINWYT--SLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERM 178
           L   Q  +L+ + D++ W +   LA   L FT  +++NE FD++P+    +TE G+RE  
Sbjct: 127 LQQAQAARLSRHADRLAWSSPDELAAGTLSFTGCIISNELFDAMPVHIVELTEAGLREVY 186

Query: 179 IDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG----- 233
           +  D          D+      L  S   L         R    Q     LA  G     
Sbjct: 187 VSAD----------DNGFVERLLPPSTPELEQYLRKYEVRLLPGQRAEINLAASGWIAQA 236

Query: 234 ------GTAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQR 280
                 G  + IDYGYL       Q + G  L   K  T  +P    G+ D+++H++F +
Sbjct: 237 AATLTRGFVLTIDYGYLSGELYTPQRKNGTLLCYYKHSTNENPYQLVGEQDITTHINFSQ 296

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKS 340
           L        L       Q +FL   G+ +    L  Q   +   L     L      +  
Sbjct: 297 LIVDGEESGLKKAWYGEQYRFLLAAGLMEELIRLEAQAKDEQESLKHRLALKKLMLPEGG 356

Query: 341 MGELFKILVVS 351
           MG+ FK+L+ S
Sbjct: 357 MGDTFKVLIQS 367


>gi|262276847|ref|ZP_06054640.1| putative cyclopropane-fatty-acyl-phospholipid synthase [alpha
           proteobacterium HIMB114]
 gi|262223950|gb|EEY74409.1| putative cyclopropane-fatty-acyl-phospholipid synthase [alpha
           proteobacterium HIMB114]
          Length = 346

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 99/343 (28%), Positives = 163/343 (47%), Gaps = 24/343 (6%)

Query: 21  VDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCV 80
           +D Y   C+   +  YY     FG  GDF+T+P IS IFGE++A+++   + +    S  
Sbjct: 15  LDDYINTCLYKYKSSYYEKKKIFGPRGDFITSPYISSIFGEIIAVYITNYFLEKKLYS-F 73

Query: 81  RLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWY 140
            ++E+G G G+M  DI+  I  +        S +++E SE L   QKK L+    K+NW 
Sbjct: 74  SILEIGAGEGVMARDIINTINTINKFKNINFSYFILEKSENLKKKQKKNLSK--LKVNWI 131

Query: 141 TSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSN- 199
            SL D+     F+V+NE  D+ PIK     ++   E+ +  D   + +  I ++    N 
Sbjct: 132 KSLDDLECKNLFIVSNELLDAFPIKHLKKIKNDWYEKYVYYDNKKNKI--ISEYAKLKNK 189

Query: 200 ------FLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA-IVIDYGYLQSRVGDTL 252
                  ++ ++ F+    E SP     +  I   L  +     +  DYGY  +   +TL
Sbjct: 190 NQKIFKLVSKNNDFI----EFSPLVIEFLNQIIKVLKKNKNNCFLTFDYGYQGNNFKNTL 245

Query: 253 QAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR-- 310
           Q +K H  VS   +PG  D++  ++F  +  I      + N + +Q +FL   GI +R  
Sbjct: 246 QGLKNHKKVSIFEDPGNVDITYLINFNLIKKIFNNKSNFNNIIMSQSEFLTRAGIIERLR 305

Query: 311 -AFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
            A +++     K  L  SV RL+      K MG LFK L+V++
Sbjct: 306 QATNILTSEKDKLKLEMSVDRLIHP----KKMGSLFKCLIVTN 344


>gi|320586267|gb|EFW98946.1| duf185 domain containing protein [Grosmannia clavigera kw1407]
          Length = 562

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 100/193 (51%), Gaps = 29/193 (15%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC------NPFGAVGDFVTAPEIS 56
             L +++   I   G + V  Y  +C+     GYY+        +PFG  GDFVT+PE+S
Sbjct: 62  TPLAKQLAEAISATGPVPVASYMRMCLTSDLGGYYTGALDKTGRDPFGRAGDFVTSPEVS 121

Query: 57  QIFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYM 115
           Q+FGE++ I+ +  W   G PS  V L+E+GPGRG +M DILR +        S+ S+YM
Sbjct: 122 QVFGELVGIWFVAEWMAQGRPSRGVELIEVGPGRGTLMDDILRTVRHFG-LAQSIESVYM 180

Query: 116 VETSERLTLIQKKQL-----------------ASYGD-KINWYTSLADVPLGF---TFLV 154
           VE S +L L QK  L                 + +G   I W  ++  +P      +F+V
Sbjct: 181 VEASPQLRLAQKTLLCGHDVALTESSLGYHGVSKHGSLPIVWTETIQSIPQSLENMSFIV 240

Query: 155 ANEFFDSLPIKQF 167
           A+EFFD+LPI  F
Sbjct: 241 AHEFFDALPIHVF 253



 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 14/133 (10%)

Query: 234 GTAIVIDYGYLQSRVG-DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY--KL 290
           G A+++DYG     V  ++L+ ++ H  VSP   PG  DLS+ VDF  +   A+    ++
Sbjct: 417 GAALILDYGPGDGTVPINSLRGIRRHRRVSPFAEPGLTDLSADVDFGAIVEAAVRASDRV 476

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILL---------DSVKRLVSTSADKKSM 341
            ++G   Q  FL  +GI +RA +L  + A                S KRLV        M
Sbjct: 477 ELHGPVDQADFLLQMGIRERAQALAAKAAASPAASSSSTPSDIDRSWKRLVDRG--PGGM 534

Query: 342 GELFKILVVSHEK 354
           G+++K+L +  E 
Sbjct: 535 GKVYKVLAILPEN 547


>gi|197119166|ref|YP_002139593.1| hypothetical protein Gbem_2793 [Geobacter bemidjiensis Bem]
 gi|197088526|gb|ACH39797.1| protein of unknown function DUF185 [Geobacter bemidjiensis Bem]
          Length = 386

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 160/374 (42%), Gaps = 38/374 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGE 61
            KL   I+N I+ +G +T   +    + +P+ GYY++     GA GDF T+  +   FG 
Sbjct: 8   TKLAEIILNRIRTSGDITFASFMESALYEPDLGYYTSAGRKVGAEGDFYTSMNVHSAFGR 67

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           ++A  +   WEQ   P+   + E G G G +  DIL  I +  P F++ L+  ++E    
Sbjct: 68  LIAQEICRFWEQLDSPASFTIAEAGAGGGQLAQDILDAISEDNPRFYNGLTYRLIEKEPS 127

Query: 122 LTLIQKKQLASYGDKINWYT--SLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERM 178
           L   Q  +L+ + D++ W +   LA   L FT  +++NE FD++P+    +TE G+RE  
Sbjct: 128 LQQAQAARLSRHADRLAWSSPDELASGTLSFTGCIISNELFDAMPVHIVELTEAGLREVY 187

Query: 179 IDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG----- 233
           +  +  D  V            L  S   L         R    Q     LA  G     
Sbjct: 188 VSANA-DGFV---------ERLLPPSTPELEKYLRKYEVRLLPGQRAEINLAASGWIAQA 237

Query: 234 ------GTAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQR 280
                 G  + IDYG+L       Q R G  L   K  T  +P    G+ D+++H++F +
Sbjct: 238 AATLTRGFVLTIDYGFLSGELYTPQRRNGTLLCYYKHSTNENPYQLVGEQDITTHINFSQ 297

Query: 281 L---SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSAD 337
           L      A L K +      Q +FL   G+ +    L  Q   +   L     L      
Sbjct: 298 LIVDGEEAGLKKAWYG---EQYRFLLSAGLMEELIRLEAQAKDEQESLKHRLALKKLMLP 354

Query: 338 KKSMGELFKILVVS 351
           +  MG+ FK+L+ S
Sbjct: 355 EGGMGDTFKVLIQS 368


>gi|284106845|ref|ZP_06386288.1| succinate dehydrogenase iron-sulfur subunit [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283830024|gb|EFC34300.1| succinate dehydrogenase iron-sulfur subunit [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 382

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 106/370 (28%), Positives = 167/370 (45%), Gaps = 44/370 (11%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST--------CNPFGAVG-DFVTAPEISQIF 59
           +  LI++ G +T  ++  L + D E GYY+T         +P G  G DF TAP +S + 
Sbjct: 1   MTTLIRETGPLTFARFMELALYDDEHGYYTTGGGRSASVTSPIGREGGDFFTAPSLSPVL 60

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
            + L   L    ++ G P    LVE+GPG G ++ D+L+   + +P   S L+  +VE S
Sbjct: 61  AKCLVRQLAEIDDRLGHPPVFDLVEMGPGDGTLLRDMLQECREQQPSLLSRLACILVERS 120

Query: 120 ERLTLIQKKQLASY---GDKINWYTSL---ADVPLGFTFLVANEFFDSLPIKQFVMTEHG 173
                 Q++ LA++   G +I W   L   ++  L  T L++NE  D+ P+ +  M + G
Sbjct: 121 PAFRRRQQETLAAWKEQGTEIQWVDELQAISEASLTGT-LLSNELVDAFPVHRVRMGQDG 179

Query: 174 IRERMIDIDQHDSLVFNIGDHEIK--SNFLTCSDYFLGAIFENSPCRD-----REMQSIS 226
           ++E  +    H +L    G+      S+FL+  D  L A F      +     +++  + 
Sbjct: 180 LQELYVTSRDH-ALQEQWGEPSTPDLSSFLSELDVELPAGFTTEISLEAVKWIKQVARVL 238

Query: 227 DRLACDGGTAIVIDYGYLQ------SRVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQ 279
           DR     G  I IDYG+         R   TL A   HT   +P    G+ DL++HV+F 
Sbjct: 239 DR-----GVVITIDYGHTARDYVALERKNGTLMAYYRHTVSTNPYQRVGEQDLTAHVNFS 293

Query: 280 RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKK 339
            L+       L   GLT    FL  LGI +      +++A        V R  +      
Sbjct: 294 SLAHTGEQVGLTTTGLTNLQHFLMSLGIEELVRGCDQESA--------VVRAAAQLLRPH 345

Query: 340 SMGELFKILV 349
            MG  FKIL+
Sbjct: 346 GMGTTFKILM 355


>gi|330938441|ref|XP_003305738.1| hypothetical protein PTT_18657 [Pyrenophora teres f. teres 0-1]
 gi|311317121|gb|EFQ86168.1| hypothetical protein PTT_18657 [Pyrenophora teres f. teres 0-1]
          Length = 519

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 96/189 (50%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-----STCNPFGAVGDFVTAPEISQIF 59
           L + +   I   G ++V  Y   C+  PE GYY     S  + FG  GDFVT+PEISQ+F
Sbjct: 51  LAKTLAEAITTTGPISVAAYMRQCLTHPEGGYYTRQTSSGQDQFGTKGDFVTSPEISQVF 110

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           GE++ I+L   W   G    V+++E+GPGRG +M D+LR I   K    S+ +IY+VE S
Sbjct: 111 GELVGIWLYAEWLAQGRREKVQIIEVGPGRGTLMDDVLRTISSFKAFTKSIEAIYLVEAS 170

Query: 120 ERLTLIQKKQLASYGD------------------KINWYTSLADVP---LGFTFLVANEF 158
             L   Q K L+   D                  +I W   +  VP       F++A+EF
Sbjct: 171 PYLQKQQAKLLSGTEDLKKNDIGFTAPCKYISGCQIQWCEDIRLVPKEDTAAPFILAHEF 230

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 231 FDALPIHVF 239



 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   +TL+ ++ HT VSP  +PG  DLS+ VDF  L+  A+     + 
Sbjct: 379 GAALILDYGPSSTIPANTLRGIRSHTTVSPFASPGLVDLSADVDFLALADTALSASPGVE 438

Query: 292 INGLTTQGKFLEGLGIWQRA---FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           ++G   Q  FL  +GI +RA    S  K    +  L    KRLV    +   MG+ +K L
Sbjct: 439 VHGPVEQSFFLSTMGIKERADRLLSAAKDEETRSRLETGWKRLVDRGPN--GMGKTYKAL 496

Query: 349 VV 350
            +
Sbjct: 497 AI 498


>gi|319778597|ref|YP_004129510.1| hypothetical protein TEQUI_0423 [Taylorella equigenitalis MCE9]
 gi|317108621|gb|ADU91367.1| Uncharacterized conserved protein [Taylorella equigenitalis MCE9]
          Length = 373

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 107/375 (28%), Positives = 163/375 (43%), Gaps = 60/375 (16%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIF 59
           +  KL + I         +  D++    +  P  GYY+   P FG+ GDFVTAPEIS  F
Sbjct: 14  ISQKLDKYIRQKFANRNVIEFDKWLNEVLYAPSLGYYNNALPIFGSKGDFVTAPEISHFF 73

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G+ L   +    EQ        ++E G G G M   IL+        +F      ++E S
Sbjct: 74  GKCLGNQIRQILEQ---CDSKHILEFGAGSGAMAKQILKASTDAHIKYF------ILELS 124

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVM---------- 169
             L  +Q+  L+ Y D+I W  SL +   G   ++ANE  DS+P K F            
Sbjct: 125 ADLRALQQNTLSEYADRIVWLDSLPEKFQGC--ILANEVLDSIPPKIFEFSDSEGHIEIG 182

Query: 170 ---TEHGIRERMIDIDQHDSL---VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ 223
              TE G     + I  H  +   + NI  +  + NF                  +  ++
Sbjct: 183 VRATEVGYEFAKVGIATHKEVLERIPNINGYRSEINFQA----------------EAWIR 226

Query: 224 SISDRLACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHV 276
           S++  L    G  ++IDYG+ +S         G  +   K HT+ +PL+N G  D++SHV
Sbjct: 227 SLAGLLT--NGGILLIDYGFARSEYYHPQRNEGTIMCHFKHHTHSNPLINIGIQDITSHV 284

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSA 336
           DF  ++  AI   L + G TTQ  FL   G       L  +  + + L  S K  ++T  
Sbjct: 285 DFTAVADSAIDAGLELWGYTTQASFLISCG-------LEHELLKTNDLSLSQKTGINTLI 337

Query: 337 DKKSMGELFKILVVS 351
            +  MGELFK+++ S
Sbjct: 338 SEAEMGELFKVMLFS 352


>gi|196231309|ref|ZP_03130168.1| protein of unknown function DUF185 [Chthoniobacter flavus Ellin428]
 gi|196224645|gb|EDY19156.1| protein of unknown function DUF185 [Chthoniobacter flavus Ellin428]
          Length = 379

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 138/319 (43%), Gaps = 21/319 (6%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFG 60
           EN     +   I++ G +    Y A  + DP++GYY       G  GDF T   +  +FG
Sbjct: 5   ENTAKNALRAEIQQRGPIPFRDYMARVLYDPDYGYYGASKAQVGRAGDFFTNVSVGPLFG 64

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
            +LA      W + G P+   +VE G   G    D+L  + +     ++  S+++VE   
Sbjct: 65  RLLARQFAEMWRRLGEPADFAIVEQGANSGDFAGDVLSALREFDAACYAATSLWLVEPLA 124

Query: 121 RLTLIQKKQLASYG-DKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
           +L L Q ++L  +G  KI W  S   +P       +NE  D+ P+ +         ER +
Sbjct: 125 KLRLAQTERLRDFGSSKIRWVDSPTALPSFQGVHFSNELLDAFPVHRVCRRGDRWMERSV 184

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ-SISDRLA-----CDG 233
           D  Q    VF   D EI S  L      LG +       + E+  +I+  LA        
Sbjct: 185 DF-QEGRFVFV--DAEIASPELNAH---LGHLPPVPEGYETEVNLAIAPWLAEVASKLSA 238

Query: 234 GTAIVIDYGYLQS------RVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRLSSIAI 286
           G  + IDYGY +       R   TL A   H     PL  PG+ DL++HVDF  L+  A 
Sbjct: 239 GFVLAIDYGYPRGDYYRPERSSGTLSAYAAHRREPDPLQRPGEIDLTAHVDFTILAETAP 298

Query: 287 LYKLYINGLTTQGKFLEGL 305
           L  L + G T Q  F+ GL
Sbjct: 299 LLGLQLAGFTDQHHFMVGL 317


>gi|206889280|ref|YP_002248408.1| hypothetical protein THEYE_A0565 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741218|gb|ACI20275.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 348

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 168/362 (46%), Gaps = 50/362 (13%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAIFLICAWEQH 74
           +G +  D++  + +  PE GYY+  +   G  GDF TA  +  +FG  LA  +   +++ 
Sbjct: 13  HGAIPFDEFMEMALYYPELGYYTKPDAKIGRQGDFFTASHLGSVFGFFLARQIEIFYQKL 72

Query: 75  GFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYG 134
             P    + E+GPG G +  DIL  I     D  + +   +VE +     +Q+++L  + 
Sbjct: 73  NCPKNFTVTEIGPGMGFLAKDILDNI-----DSSASIKYNLVEINPAFKKVQRERLKEHE 127

Query: 135 DKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHG-IRERMIDIDQHDSLVFNIGD 193
           DKI WY+S+  +      ++ NE FD+LP++ F + + G I E  +DI + + L+     
Sbjct: 128 DKIFWYSSIEQLESFSGLIICNEVFDALPVRIFEVNDSGQIMEVYVDIGEQEQLI----- 182

Query: 194 HEIKSNFLTCSDYFLGAIFENSPC----------RDREMQSISDRLA--CDGGTAIVIDY 241
            EI   FL C    L  + E +P            +  M+S+ + L+     G  ++ DY
Sbjct: 183 -EI---FLPCRTDTLEYLQEFAPWVLKMKKYRSEVNLAMKSLIESLSKKLKKGYILIFDY 238

Query: 242 GYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           GY            G  L   K +   +P +N G  D+++HV+F  +  +A +  L   G
Sbjct: 239 GYTSEEYYHPDRNKGTLLCYYKHNINENPYINIGHQDMTAHVNFTAVEKLATMAGLKFEG 298

Query: 295 LTTQGKFLEGL---GIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
             +QG +L  L    I+Q+ +        +  L +  KRLV      + MGE  +++++S
Sbjct: 299 YFSQGSYLISLCDEKIFQKIY--------QKNLKEHFKRLVLP----QGMGESHRVMILS 346

Query: 352 HE 353
            +
Sbjct: 347 KD 348


>gi|312219814|emb|CBX99756.1| similar to DUF185 domain-containing protein [Leptosphaeria
           maculans]
          Length = 478

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 94/178 (52%), Gaps = 26/178 (14%)

Query: 16  NGQMTVDQYFALCVADPEFGYY-----STCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
           N  + V  Y   C+  PE GYY     S  + FGA GDFVT+PEISQIFGE++ ++L   
Sbjct: 14  NSPIPVAAYMRQCLTHPEGGYYTRQTTSGQDQFGAKGDFVTSPEISQIFGELVGVWLYAE 73

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQL 130
           W   G    V+++E+GPGRG +M D+LR +  L+    S+ ++Y++E S  L   Q K L
Sbjct: 74  WHAQGRKDKVQIIEVGPGRGTLMDDVLRTVTSLRGFAQSIETVYLIEASPYLQKQQGKLL 133

Query: 131 ASYGD------------------KINWYTSLADVPLGFT---FLVANEFFDSLPIKQF 167
           +   D                  KI W   +  +P   T   F++A+EFFD+LPI  F
Sbjct: 134 SGTEDLQKSDIGLTAMCKYIPGCKIEWCEDIRLLPKEVTPTPFIIAHEFFDALPIHVF 191



 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 67/122 (54%), Gaps = 8/122 (6%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG L++   ++L+ ++ HT VSP   PG  DLS+ VDF  L+  A+     + 
Sbjct: 339 GAALILDYGSLETIPANSLRGIRNHTTVSPFAAPGLVDLSADVDFVALADSALRASPGVE 398

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQTARKDI---LLDSVKRLVSTSADKKSMGELFKIL 348
           ++G   QG FL  +GI +RA  LMK+   ++    L    +RLV        MG+ +K +
Sbjct: 399 VHGPVEQGFFLGTMGIKERAERLMKEAKDEEARQRLATGWQRLVDRHV---GMGKTYKAM 455

Query: 349 VV 350
            +
Sbjct: 456 AI 457


>gi|86606641|ref|YP_475404.1| hypothetical protein CYA_1998 [Synechococcus sp. JA-3-3Ab]
 gi|86555183|gb|ABD00141.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
          Length = 408

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/330 (27%), Positives = 153/330 (46%), Gaps = 22/330 (6%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFG 60
           + +L   I + I+  G +T  Q+    + +P  GYY   + P G   D+ T+P ++  F 
Sbjct: 24  DRRLPELIGSRIRARGPVTFAQFMEWALYEPGLGYYEREHLPLGW--DYRTSPHLAADFA 81

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           ++LA  +   W   G P    ++E+G G G +  D L  +C   PDF+  L   ++E S 
Sbjct: 82  QLLAEQIFQFWHILGSPPHFAVIEMGAGSGRLAEDWLAYVCSNWPDFWQALEYGILERSA 141

Query: 121 RLTLIQKKQLASYGDKINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERM 178
            L  +Q+++LA YG+K+ W  +  + D  +   F  +NE  D+ P+ +  +    +RE  
Sbjct: 142 FLRRLQQERLAGYGEKVRWLEWDEIPDGSVTGCFF-SNELVDAFPVHRVQVQAGALREIY 200

Query: 179 IDIDQHDSLVFNIGD---HEIKSNF----LTCSDYFLGAIFENSPCRDREMQSISDRLAC 231
           +D  + +     +GD     +++ F    +  + Y  G   E +      +Q ++ +L  
Sbjct: 201 VDWAEGEGFREVLGDLSTPALEAYFARLGIPIATYPSGYQTEVNLKALEWLQLLARKLRR 260

Query: 232 DGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSI 284
             G  + +DYG      Y   R   TL A + H TY  P V  G  DL++HVDF  L  +
Sbjct: 261 --GYVLTLDYGHTAQRYYSPQRFQGTLLAYRQHGTYADPYVWVGSQDLTAHVDFTTLQQV 318

Query: 285 AILYKLYINGLTTQGKFLEGLGIWQRAFSL 314
                L   G T Q  FL  LG+ +R  +L
Sbjct: 319 GESLGLKCLGFTQQSCFLVNLGLAERLAAL 348


>gi|113478172|ref|YP_724233.1| hypothetical protein Tery_4813 [Trichodesmium erythraeum IMS101]
 gi|110169220|gb|ABG53760.1| protein of unknown function DUF185 [Trichodesmium erythraeum
           IMS101]
          Length = 397

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 146/314 (46%), Gaps = 22/314 (7%)

Query: 15  KNGQMTVDQYFALCVADPEFGYYSTCNP--FGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           +N ++T  +Y  L +  P++GYY+T +P   G  GDF+T+P     FGE+LA   +  W 
Sbjct: 27  QNKRITFAEYMDLVLYHPQYGYYAT-HPVNIGKQGDFLTSPHWGSDFGELLAEQFLQMWH 85

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS 132
               P+   +VE+G G+GI+   IL  + +   DFF  +   +VE SE L + QK+ L S
Sbjct: 86  ILQRPNNFTIVEMGAGQGILAEQILGYLKQKHLDFFQTVEYLIVEKSEVLKVQQKQILQS 145

Query: 133 YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVF--- 189
           Y  + + +  ++   +   F  +NE  D+ P+ +F + E  I+E  +  +     V    
Sbjct: 146 YQVRWSDWDKISHSSITGCFF-SNELVDAFPVHKFRIEEREIKEIYVSSNSQGKFVEITD 204

Query: 190 NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS------ISDRLACDGGTAIVIDYGY 243
            I   EI   F       L  +       +  +Q+      +S++L    G  + IDYGY
Sbjct: 205 KISTPEIAEYFNLVDIDLLSFVDVEGYQSEVNLQALDWIKIVSNKLL--KGYLLTIDYGY 262

Query: 244 LQSRVGD------TLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
              R  +      TLQ   + H    P  N G+ D+++HVDF  L     L  L   G T
Sbjct: 263 QAVRYYNPVRKEGTLQCYYQHHRNNDPYWNVGRQDITAHVDFTALEKQGNLLDLETLGFT 322

Query: 297 TQGKFLEGLGIWQR 310
            QG FL  LG+  R
Sbjct: 323 KQGLFLMALGLGDR 336


>gi|222054854|ref|YP_002537216.1| protein of unknown function DUF185 [Geobacter sp. FRC-32]
 gi|221564143|gb|ACM20115.1| protein of unknown function DUF185 [Geobacter sp. FRC-32]
          Length = 382

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 161/359 (44%), Gaps = 16/359 (4%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           ++  I K G++T   + A C+ +P  GYY S     GA GDF T+  +  +FG ++A  +
Sbjct: 11  LLERIWKAGRLTFADFMAACLYEPGLGYYTSPGRKVGAEGDFYTSMNVHLMFGRLIAREI 70

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              WE  G P    + E G G G +  DIL  I +    F+ VL+  ++E    L   Q+
Sbjct: 71  SRMWEILGSPESFTIAEAGAGGGQLARDILDTIAETNRSFYDVLTYRLIEKEPTLKEAQQ 130

Query: 128 KQLASYGDKINWYT--SLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMID-IDQ 183
           ++L  +  +++W     LA   L F+  V +NE  D++P+    MT  G+ E  +  ID 
Sbjct: 131 EKLTRHLARLSWSAPEDLAAGRLHFSGCVLSNELIDAMPVHLVEMTPAGLMEVYVTAIDG 190

Query: 184 HDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
               + +       +++L  +   L  G   E +      ++S++D L  + G  + IDY
Sbjct: 191 EFGEMLDEPSTPALADYLKENGVTLLAGQRGEINLAATGWLRSVADTL--EKGFVLTIDY 248

Query: 242 GYLQS------RVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           GY         R   TL     HT    P    G  D++SHV+F  L    +   L+   
Sbjct: 249 GYEADELYAPMRKNGTLLCYYQHTTCEDPYTRVGAQDITSHVNFTALIREGVKCGLHRAW 308

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
              Q +FL G G+ +   +L K  A +  LL +   L         MG+ F++L+ + E
Sbjct: 309 FGEQYRFLLGAGLMEEMLALEKSGATETELLKTRLALKKLMLPDGGMGDTFRVLIQAKE 367


>gi|148263016|ref|YP_001229722.1| hypothetical protein Gura_0943 [Geobacter uraniireducens Rf4]
 gi|146396516|gb|ABQ25149.1| protein of unknown function DUF185 [Geobacter uraniireducens Rf4]
          Length = 385

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 95/355 (26%), Positives = 155/355 (43%), Gaps = 16/355 (4%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           +++ I   G++T   + A C+ +P  GYY S     GA GDF T+  +  +FG ++A  +
Sbjct: 13  LLDRILSKGRITFADFMAACLYEPGLGYYTSPGRKVGAEGDFYTSMNVHLVFGRLVAREI 72

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              WE  G P    ++E G G G +  DIL  I  +   F+  L+  +VE    L   QK
Sbjct: 73  CRMWESMGSPGRFDIIEAGAGAGQLAKDILDTIAGINLPFYDTLTYCLVEKEPTLKEAQK 132

Query: 128 KQLASYGDKINWYTSLADVPLGFTF---LVANEFFDSLPIKQFVMTEHGIRERMIDI--D 182
            +LA +  +++W+T       G TF   L++NE  D++P+    MT  G+ E  +     
Sbjct: 133 AKLADHLARLDWHTPEELAEGGSTFSGCLLSNELIDAMPVHLVEMTPAGLMEVYVTALDG 192

Query: 183 QHDSLVFNIGDHEIKSNFLTCS-DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
           +   ++      E+ +         F G   E S      +++ +   A + G  + IDY
Sbjct: 193 EFGEMLDEPSTPELAAYLKRLGISLFAGQRAEISLAAIGWLEAAAK--AVEKGFVLTIDY 250

Query: 242 GYLQS------RVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           GY         R   TL     HT   SP +  G  D++SHV+F  L        L+   
Sbjct: 251 GYPADELYAPMRKNGTLLCYYQHTTEESPYIRVGLQDITSHVNFTALMERGEELGLHTVW 310

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILV 349
              Q +FL G G+ +   +L K    +  L+ +   L         MG+ FK+L+
Sbjct: 311 FGEQYRFLLGAGLMEEMLALEKSGVSETELIKNRLALKKLMLPDGGMGDTFKVLI 365


>gi|225851499|ref|YP_002731733.1| hypothetical protein PERMA_1980 [Persephonella marina EX-H1]
 gi|225646678|gb|ACO04864.1| hypothetical protein PERMA_1980 [Persephonella marina EX-H1]
          Length = 388

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 108/387 (27%), Positives = 166/387 (42%), Gaps = 59/387 (15%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFG 60
           + +L+  I N IKK G ++   +  + +  PE GYY++     G  GDF TA E+ + FG
Sbjct: 10  KQQLVNIIKNRIKKEGSISFRDFMDIALYYPELGYYTSPKAKIGGYGDFFTASELDKAFG 69

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+L    +  +++ G     ++VE+G G+G +  DIL  +     D +      ++E S 
Sbjct: 70  ELLGKQFVEIYQKLG-EKNFQIVEIGAGKGYLAYDILNFLRANFEDVYRNSEYIIIEKSP 128

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVP----LGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
               +QK+ L S+ D + W   + D       G  F  +NE FDS P+         I E
Sbjct: 129 YHVNLQKEILKSF-DNVRWVQDIIDFEDESITGVIF--SNELFDSFPVHLIRKINGKIYE 185

Query: 177 RMIDIDQHDS------------------LVFNIGDHEIKSNFLTCSDYFLGAIFENSPCR 218
             I +DQ D+                  L  NI +       L  +DY            
Sbjct: 186 IYITVDQDDNVKEILKDPSEDIIRYLKELNINIPEGMTTEINLDAADY------------ 233

Query: 219 DREMQSISDRLACDGGTAIVIDYGYLQS------RVGDTLQAVKGHTYVSPLV-NPGQAD 271
              +Q I  +L    G  I IDYGY  +      R+  TL     H Y      N G  D
Sbjct: 234 ---IQKIGKKLKK--GYVITIDYGYPSAELYKYYRMKGTLLCYYKHRYSENYYENVGMQD 288

Query: 272 LSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRL 331
           ++SHV+F  L+    +  L + G T Q  FL  LG+    F+ +++        +S +RL
Sbjct: 289 ITSHVNFSALNYYGKIAGLELTGFTDQAHFLTNLGLMD-IFAQLQEKGD----YESYERL 343

Query: 332 --VSTSADKKSMGELFKILVVSHEKVE 356
             + T    K MGE FK+L + H+ VE
Sbjct: 344 NRLKTLVLPKGMGEKFKVL-IQHKNVE 369


>gi|254496625|ref|ZP_05109490.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354147|gb|EET12817.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 369

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 90/350 (25%), Positives = 154/350 (44%), Gaps = 40/350 (11%)

Query: 23  QYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVR 81
           ++  L +  P  GYYS+     G  GDF+TAPE++ +FG+ LA    C        + V 
Sbjct: 20  EFMQLALYAPGEGYYSSGLQKLGKQGDFITAPELTPLFGKTLAN--QCQQIMMTLDAPV- 76

Query: 82  LVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKKQLASYGDKINW 139
           L+E G G G + + IL  +  L   P+ + ++ +       +   I++K +    DK+ W
Sbjct: 77  LLEFGAGTGALCVAILEHLALLNCLPEAYYIMEVSANLRHRQAEFIRQK-IPHLADKVIW 135

Query: 140 YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSN 199
                + P     L ANE  D++P+ +F+ TEHG+ E  I +D+   L         K  
Sbjct: 136 LERWPETPFNGVIL-ANEVLDAMPVHRFMRTEHGVMESYITLDEQQQL---------KEV 185

Query: 200 FLTCS-----DYFLGAI-FENSPCRDREMQSISDRL-----ACDGGTAIVIDYGYLQS-- 246
           F  C      DY    +  E  P        I D +       + G  ++IDYG+ +   
Sbjct: 186 FKPCQNLRLLDYINQRLHLETVPYLSEANLFIDDWILNIYRILNQGVVLLIDYGFPRHEY 245

Query: 247 -----RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKF 301
                + G  +   + H++  PL++PG+ D+++HVDF  ++        ++ G T Q  F
Sbjct: 246 YHPDRQQGTLMCHYQHHSHPEPLLHPGEQDITAHVDFTHVAEAGQQAGFHVAGYTNQASF 305

Query: 302 LEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           L   G+     SL  +  +        K+ +        MGELFK++ ++
Sbjct: 306 LLANGLLSFVNSLENEVEQL-----KAKQAIKQLTQPSEMGELFKVIALN 350


>gi|315041064|ref|XP_003169909.1| hypothetical protein MGYG_08083 [Arthroderma gypseum CBS 118893]
 gi|311345871|gb|EFR05074.1| hypothetical protein MGYG_08083 [Arthroderma gypseum CBS 118893]
          Length = 501

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 98/189 (51%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L ++I + I   G +++  +   C+   E GYY++      + FG  GDFVT+PEISQ+F
Sbjct: 45  LAKRITDAINTTGPISIAAFMRQCLTSDEGGYYTSRGTPGSDVFGKEGDFVTSPEISQMF 104

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+L I+++  W   G  S  V+L+E GPG+G +M D+LR +   K    S+  +YMVE 
Sbjct: 105 GELLGIWIVTEWLSQGRRSSGVQLMEFGPGKGTLMADVLRSVRNFKAFASSIEGVYMVEA 164

Query: 119 SERLTLIQKKQL-----------------ASYGDKINWYTSLADVPLG---FTFLVANEF 158
           S  L  IQKK L                    G  + W   +  +P       F++A+EF
Sbjct: 165 SPTLREIQKKALCGDAPMEECEIGYKSVSTHLGVPVYWTEHIRILPESEDKAPFIIAHEF 224

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 225 FDALPIHAF 233



 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 66/125 (52%), Gaps = 7/125 (5%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ +K H  VSP   PG+ DLS+ VDF  L+  A+     + 
Sbjct: 363 GAALILDYGPSSTIPVNSLRGIKNHQVVSPFATPGEVDLSADVDFTGLAESALNASPGVE 422

Query: 292 INGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           + G   QG FL  LGI +RA  L+   K   ++  +  S +RLV        MG+++K +
Sbjct: 423 VYGPNEQGSFLRSLGIAERAAQLLRNVKDEEKRKQIESSWQRLVERGGG--GMGKIYKAM 480

Query: 349 VVSHE 353
            +  E
Sbjct: 481 AIVPE 485


>gi|326485066|gb|EGE09076.1| DUF185 domain-containing protein [Trichophyton equinum CBS 127.97]
          Length = 501

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 99/189 (52%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L ++I + I   G +++  +   C+   E GYY++      + FG  GDFVT+PEISQ+F
Sbjct: 45  LAKRITDAINTTGPISIAAFMRQCLTSDEGGYYTSRGTPGSDVFGKEGDFVTSPEISQMF 104

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+L I+++  W   G  S  V+L+E GPG+G +M DILR +   K    SV  +YM+E 
Sbjct: 105 GELLGIWIVTEWLSQGRRSSGVQLMEFGPGKGTLMADILRSVRNFKGFASSVEGVYMIEA 164

Query: 119 SERLTLIQKKQL-----------------ASYGDKINWYTSLADVPL---GFTFLVANEF 158
           S  L  IQKK L                 +  G  + W   +  +P       F++A+EF
Sbjct: 165 SPTLREIQKKALCGDAPMEECDIGYKSISSHLGVPVYWTEHIRILPQTEDKAPFIIAHEF 224

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 225 FDALPIHAF 233



 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 65/125 (52%), Gaps = 7/125 (5%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ +K H  VSP   PG+ DLS+ VDF  L+  A+     + 
Sbjct: 363 GAALILDYGPSSTIPVNSLRGIKNHEVVSPFATPGEVDLSADVDFTGLAESALDASPGVE 422

Query: 292 INGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           + G   QG FL  LGI +RA  L+   K   ++  +  S +RLV        MG ++K +
Sbjct: 423 VYGPNEQGSFLRSLGIAERAAQLLRNVKDEEKRKQIESSWQRLVERGGG--GMGRIYKAM 480

Query: 349 VVSHE 353
            +  E
Sbjct: 481 AIVPE 485


>gi|326471185|gb|EGD95194.1| hypothetical protein TESG_02686 [Trichophyton tonsurans CBS 112818]
          Length = 501

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 99/189 (52%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L ++I + I   G +++  +   C+   E GYY++      + FG  GDFVT+PEISQ+F
Sbjct: 45  LAKRITDAINTTGPISIAAFMRQCLTSDEGGYYTSRGTPGSDVFGKEGDFVTSPEISQMF 104

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+L I+++  W   G  S  V+L+E GPG+G +M DILR +   K    SV  +YM+E 
Sbjct: 105 GELLGIWIVTEWLSQGRRSSGVQLMEFGPGKGTLMADILRSVRNFKGFASSVEGVYMIEA 164

Query: 119 SERLTLIQKKQL-----------------ASYGDKINWYTSLADVPL---GFTFLVANEF 158
           S  L  IQKK L                 +  G  + W   +  +P       F++A+EF
Sbjct: 165 SPTLREIQKKALCGDAPMEECDIGYKSISSHLGVPVYWTEHIRILPQTEDKAPFIIAHEF 224

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 225 FDALPIHAF 233



 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 65/125 (52%), Gaps = 7/125 (5%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ +K H  VSP   PG+ DLS+ VDF  L+  A+     + 
Sbjct: 363 GAALILDYGPSSTIPVNSLRGIKNHEVVSPFATPGEVDLSADVDFTGLAESALDASPGVE 422

Query: 292 INGLTTQGKFLEGLGIWQRAFSLM---KQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           + G   QG FL  LGI +RA  L+   K   ++  +  S +RLV        MG ++K +
Sbjct: 423 VYGPNEQGSFLRSLGIAERAAQLLRNVKDEEKRKQIESSWQRLVERGGG--GMGRIYKAM 480

Query: 349 VVSHE 353
            +  E
Sbjct: 481 AIVPE 485


>gi|67539742|ref|XP_663645.1| hypothetical protein AN6041.2 [Aspergillus nidulans FGSC A4]
 gi|40738826|gb|EAA58016.1| hypothetical protein AN6041.2 [Aspergillus nidulans FGSC A4]
 gi|259479775|tpe|CBF70305.1| TPA: DUF185 domain protein (AFU_orthologue; AFUA_2G09740)
           [Aspergillus nidulans FGSC A4]
          Length = 504

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 103/192 (53%), Gaps = 32/192 (16%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP------FGAVGDFVTAPEISQI 58
           L R + N+IK  G + +  +    +  PE GYY+T  P      FG  GDFVT+PEISQ+
Sbjct: 41  LARTLANVIKTTGPVPIAAFMRQVLTSPEGGYYTT-KPGGGGEVFGKKGDFVTSPEISQV 99

Query: 59  FGEMLAIFLICAW-EQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           FGE++ I+ I  W  Q G  S V+L+E+GPG+G +M D+LR     KP   S+ +IY+VE
Sbjct: 100 FGELVGIWTIAEWMAQGGKKSGVQLMEIGPGKGTLMDDMLRTFRNFKPFTSSLEAIYLVE 159

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVA 155
            S  L  +QK+ L   G+ +   T +         +VP+ +               F+ A
Sbjct: 160 ASPTLREVQKQLLC--GNAVMEETDIGHRCTSKYFNVPVIWVEDIRLLPHEEDKTPFIFA 217

Query: 156 NEFFDSLPIKQF 167
           +EFFD+LPI  F
Sbjct: 218 HEFFDALPIHAF 229



 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 74/135 (54%), Gaps = 9/135 (6%)

Query: 224 SISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
           +I+ R+    G A+++DYG + +   ++L+ ++ H  V  L +PG+ D+S+ VDF  L+ 
Sbjct: 358 AIAKRIPS--GAALIMDYGTMSTVPINSLRGIQNHKIVPALSSPGRVDVSADVDFTSLAE 415

Query: 284 IAILYK--LYINGLTTQGKFLEGLGIWQRA---FSLMKQTARKDILLDSVKRLVSTSADK 338
            A+     + ++G   QG FL+ +GI +R     S +K   ++ IL    +RLV      
Sbjct: 416 AALEASEGVEVHGPVEQGHFLQAMGIAERMQQLLSTVKDEKKRKILETGWQRLVERGGG- 474

Query: 339 KSMGELFKILVVSHE 353
             MG+L+K++ +  E
Sbjct: 475 -GMGKLYKVMTIIPE 488


>gi|163859074|ref|YP_001633372.1| hypothetical protein Bpet4753 [Bordetella petrii DSM 12804]
 gi|163262802|emb|CAP45105.1| conserved hypothetical protein [Bordetella petrii]
          Length = 398

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 98/368 (26%), Positives = 167/368 (45%), Gaps = 42/368 (11%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYSTCN-----------PFG---AVGDFVTAPEISQ 57
           + +++G +  DQ+ A  +  P  GYY+  N           P G   A GDFVTAPE++ 
Sbjct: 30  IAERDGWLPFDQWMAQALYAPGLGYYAAGNVKLASAEAARTPDGLPVAPGDFVTAPELTP 89

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY-MV 116
           +FG  +A          G  +   ++E G G G +   +L  +     D   + + Y ++
Sbjct: 90  LFGHTVARQAADILAATGTDT---VLEFGAGTGALADSVLAAL-----DAQGISAQYRII 141

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIR- 175
           E S  L   Q+ +LA YG ++ W  +L +   G   ++ANE  D++P+  F   + G+  
Sbjct: 142 EVSADLRARQQARLAGYGARVQWLDALPERFAGC--VLANEVLDAMPVSLFRWNDDGVLL 199

Query: 176 ERMIDIDQHDSLVFN--IGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG 233
           ER + +D     ++        +            G + E +   +  MQ++   L  + 
Sbjct: 200 ERGVALDAAGQFIWQDRAAGEPLARAVAARMPPLPGYVSEINLQAEAWMQAMGGWL--ER 257

Query: 234 GTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G A++ DYG      Y   R G TL   ++ H +  PL  PG  D+++HVDF  ++  A 
Sbjct: 258 GAALLFDYGFPRGEYYHPQRAGGTLMCHLRHHAHADPLAAPGVQDITAHVDFTAMADAAQ 317

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARK-DILLDSVKRLVSTSADKKSMGELF 345
              L + G T+Q +FL   G+ +         AR    ++  V++L+S    +  MGELF
Sbjct: 318 GAGLQVLGYTSQARFLMNAGLAELLARHDPADARNYAQVVAPVQKLLS----EAEMGELF 373

Query: 346 KILVVSHE 353
           K+L V  +
Sbjct: 374 KVLAVGRD 381


>gi|300865239|ref|ZP_07110053.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300336712|emb|CBN55203.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 406

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 154/330 (46%), Gaps = 31/330 (9%)

Query: 18  QMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           Q+T  +Y  L +  P+ GYY+T     G  GDF T+P +   FGE+LA   +  W+  G 
Sbjct: 30  QITFAEYMDLALYHPQHGYYTTNEVNIGKHGDFFTSPHLGADFGEVLAEQFVQMWDILGK 89

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           P+   +VE+G G+GI+  DIL  +     DF  +L   ++E S  L   Q+++L +    
Sbjct: 90  PNSFIIVEMGAGQGILAADILAYLQLQYLDFSQILEYVIIEKSAVLKAEQQQRLTTIKSV 149

Query: 137 --INWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID---QHD------ 185
              NW     +   G  F  +NE  D+LP+ Q ++ +  I+E  +  +   Q D      
Sbjct: 150 RWCNWDEIPPNSIAGCFF--SNELVDALPLHQIIIDKGQIKEVYVTAESQVQEDGKTARK 207

Query: 186 --SLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
              ++  +   +I   F      L+ S Y  G   E +      + +++++L    G  +
Sbjct: 208 FAEVIGEVSTPKISEYFNLVGINLSASGYTDGYRTEVNLAALDWITTVAEKL--QRGYLL 265

Query: 238 VIDYGYL------QSRVGDTLQAVKGHT-YVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
            IDYGY       Q+R   TLQ    H  + +P +  G+ DL++HVDF  L     L  L
Sbjct: 266 TIDYGYPAHRYYNQNRREGTLQCYYHHQHHNNPYIYVGKQDLTAHVDFTALEKQGELCGL 325

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTAR 320
            + GLT QG FL  LG+  R  +L    A+
Sbjct: 326 ELVGLTQQGLFLMALGLGDRIAALSSNDAQ 355


>gi|302409170|ref|XP_003002419.1| DUF185 domain-containing protein [Verticillium albo-atrum VaMs.102]
 gi|261358452|gb|EEY20880.1| DUF185 domain-containing protein [Verticillium albo-atrum VaMs.102]
          Length = 515

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 98/192 (51%), Gaps = 27/192 (14%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-----NPFGAVGDFVTAPEISQ 57
             L +++ + I   G + +  Y  +C+     GYY+       + FG  GDFVT+PEISQ
Sbjct: 52  TPLAKQLADAISITGPVPLASYMRMCMTGDIGGYYTGLIEQGRDQFGTKGDFVTSPEISQ 111

Query: 58  IFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
           IFGE++ I+ +  W   G P+  V L+ELGPGRG +M DILR +   K    S+ +IYMV
Sbjct: 112 IFGELVGIWFVTEWMSQGKPNKGVELIELGPGRGTLMDDILRTVQNFKEFASSIDAIYMV 171

Query: 117 ETSERLTLIQKK-----------------QLASYGD-KINWYTSLADVPLG---FTFLVA 155
           E S  L   QK                   ++ YG+  I W   +  +P G      +VA
Sbjct: 172 EASPTLREAQKSLLCGPDAAMTESKIGHHSISKYGNIPIVWTGVVKAIPEGPEKMPLMVA 231

Query: 156 NEFFDSLPIKQF 167
           +EFFD+LPI  F
Sbjct: 232 HEFFDALPIHAF 243



 Score = 56.2 bits (134), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 8/127 (6%)

Query: 233 GGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--L 290
            G A+++DYG   +   ++L+ ++ H  V+P   PG  DLS+ VDF  L+         +
Sbjct: 377 AGAALILDYGTEDTIPINSLRGIRRHRRVNPFTEPGLVDLSADVDFAALAEAVTEASDGV 436

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTA----RKDILLDSVKRLVSTSADKKSMGELFK 346
            ++G   Q  FL  +GI +RA  L  +      R + +  S +RLV        MG+++K
Sbjct: 437 EVHGPVEQAAFLGQMGIKERAEMLSNRAGLPKERAEDIEKSWRRLVDRGPG--GMGKVYK 494

Query: 347 ILVVSHE 353
           ++ +  E
Sbjct: 495 VMAILPE 501


>gi|78043067|ref|YP_359248.1| hypothetical protein CHY_0386 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77995182|gb|ABB14081.1| conserved hypothetical protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 345

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 163/363 (44%), Gaps = 43/363 (11%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           LI KI     K   +T   +  L +  P++GYY+     G  GDF TAP +S+ FG  L 
Sbjct: 6   LIEKI-----KKMPLTFRDFMELALYHPDYGYYTRNVTLGKEGDFYTAPILSKSFGYTLG 60

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICK--LKPDFFSVLSIYMVETSERL 122
            ++   ++ +G P  + L+E G G G M  DIL       L P++      +++E S  L
Sbjct: 61  KYIFNLYQTYGMP--LTLLEFGAGTGKMAQDILVWFAAQGLFPEY------HILEISAHL 112

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDI 181
             +Q+K L    ++I     L + P  F+  ++ANE  D+ P+ + +  +   +E  + +
Sbjct: 113 REVQRKNLECQQNQIK---HLPEFPQNFSGIIIANEVVDAFPVHRVIYQKGIFQEIYVGV 169

Query: 182 DQHDSLVF---NIGDHEIKSNFLTCS-DYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
           D +         +   EI+      +     G IF  +    + ++ I  +L C  G  I
Sbjct: 170 DDNGKFFTYPSRLSSPEIELYLKEANISPVEGQIFNVNLEAGKWLEEIYQKLNC--GAFI 227

Query: 238 VIDYG------YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLY 291
           +IDYG      Y  +R   TL +   H    PL NPG+ D+++HVDF  L   A      
Sbjct: 228 IIDYGFDTAELYHPARSTGTLTSFSRHRQKDPLQNPGEQDITAHVDFGMLRKKAKSLGFK 287

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKK----SMGELFKI 347
                +QG+FL   GI         +  ++D L   ++    T   KK     MGE+FK+
Sbjct: 288 EELFLSQGEFLMKAGIM--------EFVKRDDLTRPLESYQETLKIKKLILPPMGEVFKV 339

Query: 348 LVV 350
           LV+
Sbjct: 340 LVL 342


>gi|16331364|ref|NP_442092.1| hypothetical protein slr0351 [Synechocystis sp. PCC 6803]
 gi|1001535|dbj|BAA10162.1| slr0351 [Synechocystis sp. PCC 6803]
 gi|1256598|gb|AAB72122.1| ORF416 [Synechocystis sp. PCC 6803]
          Length = 416

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 161/333 (48%), Gaps = 27/333 (8%)

Query: 1   MENKLIRKIVNLIKK--NGQMTVDQYFALCVADPEFGYYSTCNPFGAV-GDFVTAPEISQ 57
           M   ++  +++ I++  + ++T  ++    +  P++GYYS+     A+ GDFVTA  +  
Sbjct: 19  MTQNILPALLDHIRQSPHQRLTFAEFMEWVLYQPDYGYYSSGQVDIAIRGDFVTAIALGA 78

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
            FGE+LA   +  W++ G P    L+ELG G G     +L    +L P+FF+ L  +++E
Sbjct: 79  DFGELLAEQFLEMWQRLGEPDRFDLLELGAGTGAFAQTVLAQTQRLYPEFFAALHYHIIE 138

Query: 118 TSERLTLIQKKQLASYGD--KINWYT--SLA-DVPLGFTFLVANEFFDSLPIKQFVMTEH 172
            S  L   Q   L  + +  KI W T   LA D  +G  F  +NEFFD+LP+ +  + + 
Sbjct: 139 ESAALRRRQANLLEPWREMGKIQWQTWPELANDSLVGCCF--SNEFFDALPVHRVGIKQG 196

Query: 173 GIRERMIDIDQHD--SLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQS 224
            ++E+ I+    D  S+  ++   ++   F      LT   Y      E +    + ++ 
Sbjct: 197 VLKEQYIEAGSTDLTSVWDDLSTDKLVDYFASFGLQLTSPPYGENYETEVNLAAQQALEE 256

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
           I+  LA   G  + +DYG      Y   R G TLQ   +   + +P VN GQ D+++HV+
Sbjct: 257 IARVLAQ--GWVLTVDYGHPAGKYYHPQRTGGTLQCYFQQRHHDNPFVNLGQQDVTAHVN 314

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           F  L      Y L     + QG FL  LG+  R
Sbjct: 315 FTALEWWGECYGLNRLDFSQQGPFLMNLGLGDR 347


>gi|322709436|gb|EFZ01012.1| DUF185 domain-containing protein [Metarhizium anisopliae ARSEF 23]
          Length = 518

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 96/192 (50%), Gaps = 27/192 (14%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-----NPFGAVGDFVTAPEISQ 57
             L +++   I   G + +  Y  +C+     GYY+       + FG  GDFVT+PEISQ
Sbjct: 57  TPLAKQLFEAISTTGPVPLASYMRMCLTGDLGGYYTGAIGQDRDQFGVKGDFVTSPEISQ 116

Query: 58  IFGEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
           IFGE++ ++ I  W   G P   V+L+E+GPGRG +M D+LR I +      S+ S++MV
Sbjct: 117 IFGELVGVWFIAEWISQGQPKEGVQLIEVGPGRGTLMDDMLRTIKRFPAMVDSIESVFMV 176

Query: 117 ETSERLTLIQKKQLASY------------------GDKINWYTSLADVPL---GFTFLVA 155
           E S  L   QK  L                     G  + W  SL  +P+      F+VA
Sbjct: 177 EASPELREKQKTLLCGSDAPSEDCAAGFRSTGKHLGKPVVWAESLKSIPIEPNKVPFIVA 236

Query: 156 NEFFDSLPIKQF 167
           +EFFD+LPI  F
Sbjct: 237 HEFFDALPIHCF 248



 Score = 62.8 bits (151), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ ++ H  VSP   PG  DLS+ VDF  ++  A L    + 
Sbjct: 378 GAALILDYGTSDTIPINSLRGIRHHKLVSPFSAPGLVDLSADVDFTAIAEAATLASDGVE 437

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADK--KSMGELFKILV 349
           ++G   Q  FLE +GI +RA  L+K     +   + +++      D+    MG+++K L 
Sbjct: 438 VHGPVPQADFLELMGIRERAEMLIKAAGTDESTAERIRKSWRRLVDRGPSGMGKVYKALA 497

Query: 350 VSHE 353
           +  E
Sbjct: 498 ILPE 501


>gi|33594922|ref|NP_882565.1| hypothetical protein BPP0204 [Bordetella parapertussis 12822]
 gi|33564998|emb|CAE39945.1| conserved hypothetical protein [Bordetella parapertussis]
          Length = 419

 Score =  112 bits (280), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 95/368 (25%), Positives = 160/368 (43%), Gaps = 39/368 (10%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYSTC-----------NPFGAVGDFVTAPEISQIFG 60
           +    G +   Q+ +  +  P  GYY+              P    GDFVTAPE++ +F 
Sbjct: 54  IAAAGGWLPFSQWMSAALYAPGLGYYTAGATKLASPADAQGPALPAGDFVTAPELTPLFA 113

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK-PDFFSVLSIYMVETS 119
             +A  +              ++E G G G +   +LR +  L  P  +      +VE S
Sbjct: 114 ATVARQIAQVLRAT---DTASVLEFGAGTGALAEGVLRALAGLDCPARY-----LIVEVS 165

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI-RERM 178
             L   Q+ +LA +GD++ W   L D   G   ++ NE  D++P   F  +E G+ +ER 
Sbjct: 166 ADLRQRQQSRLAPFGDRVQWLDQLPDAFAGC--VLGNEVLDAMPATLFRWSETGVVQERG 223

Query: 179 IDIDQHDSLVFNI--GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
           + +D +    +     D  +            G + E +   +  ++S+   L    G A
Sbjct: 224 VTVDANGEFAWQDRDADAPLAQAVAQRMPPLPGYVSEINLQAEAWVRSMG--LWLQRGAA 281

Query: 237 IVIDYGYLQS------RVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK 289
           +++DYG+ +S      R G TL   ++ H +  P   PG  D++SHVDF  ++  A+   
Sbjct: 282 LLLDYGFPRSEYYHPQRAGGTLMCHLRHHAHADPFAAPGLQDITSHVDFTAMADAALAGG 341

Query: 290 LYINGLTTQGKFLEGLGIWQRAFSLMKQTARK-DILLDSVKRLVSTSADKKSMGELFKIL 348
           L + G  +Q +FL   G+      L    AR     +  V++L+S    +  MGELFK+L
Sbjct: 342 LQVLGYLSQARFLVNAGLLDALSQLDPADARAYAQAVAPVQKLLS----EAEMGELFKVL 397

Query: 349 VVSHEKVE 356
            V  +  E
Sbjct: 398 AVGRDMPE 405


>gi|307150081|ref|YP_003885465.1| hypothetical protein Cyan7822_0139 [Cyanothece sp. PCC 7822]
 gi|306980309|gb|ADN12190.1| protein of unknown function DUF185 [Cyanothece sp. PCC 7822]
          Length = 386

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 101/337 (29%), Positives = 151/337 (44%), Gaps = 27/337 (8%)

Query: 1   MENKLIRKIVNLIKKN--GQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQ 57
           +E+ LI+ I   I ++   +++  +Y  L +  P+FGYYS+     G  GD+ T+  +  
Sbjct: 2   IESTLIKTITERIHQSPLHRISFSEYMQLVLYHPQFGYYSSEKAKIGKSGDYFTSSSLGP 61

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
            FGE+LA   I  WE  G PS   L+E+G G G++  DIL    K  PD    L   ++E
Sbjct: 62  DFGELLAKQFIEMWEILGQPSHFILLEMGAGLGLLASDILNYFRKTAPDLLEKLEYQIIE 121

Query: 118 TSERLTLIQKKQLAS---YGDKINWYT--SLADVP-LGFTFLVANEFFDSLPIKQFVMTE 171
            S  L   QK+QL S    G KI W T   +AD   +G  F  +NE  D+ P+ +  +  
Sbjct: 122 QSLDLIARQKEQLQSELAQGIKIEWKTWQDIADESIIGCAF--SNELVDAFPVHRLAIQG 179

Query: 172 HGIRERMIDI-DQHDSLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQS 224
             ++E  +   D     + +    +    F      L    Y  G   E +      +++
Sbjct: 180 GELKEIYVTYSDNQFQEIIDKPTQDFNQYFQLVGVELPSDAYREGYQTEVNTAALSWLET 239

Query: 225 ISDRLACDGGTAIVIDYGYLQ------SRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
           +S +L    G  + IDYGY         R   TL    K H +  P +N G  D+++H+D
Sbjct: 240 LSKKLKR--GYLLTIDYGYPAHKYYHPQRYRGTLNCYYKHHHHHDPYINIGLQDITTHID 297

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL 314
           F  L     L  L   G T QG FL  LG+  R   L
Sbjct: 298 FTALERQGELCGLEKLGSTKQGMFLMSLGLGDRLAEL 334


>gi|225848099|ref|YP_002728262.1| hypothetical protein SULAZ_0267 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643810|gb|ACN98860.1| hypothetical protein SULAZ_0267 [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 384

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 109/370 (29%), Positives = 161/370 (43%), Gaps = 41/370 (11%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP--FGAVGDFVTAPEISQIF 59
           + +LI  ++N IKK G ++   +    +  P  GYY TC+    G  GDF T+ E+  +F
Sbjct: 6   KKELIDIVLNDIKKRGGISFKDFMDYALYYPSLGYY-TCDKEKIGGYGDFFTSSELDPVF 64

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G++LA      +  +     ++LVELG G+G++  DIL  I    P+F+  L    VE S
Sbjct: 65  GQLLAKQFNEIYLNYFKGKKIKLVELGSGKGVLAFDILNEIKTNYPEFYENLEFISVEKS 124

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
                IQ +Q    G  + W  S+ D+      + +NE FD+LP+       H I+++  
Sbjct: 125 P--FHIQHQQKVLNGFNVKWLESIEDLEDIEGIVYSNELFDALPV-------HLIKKKNG 175

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFE-------------NSPCRDREMQSIS 226
            I +   +  N  D EI       S+  L  I E             N   +D  +Q+I 
Sbjct: 176 KIYE---IYLNEKDGEIVEELREISEDVLTYIKELKIDIPEGMTTEVNLLAKDL-IQTIG 231

Query: 227 DRLACDGGTAIVIDYGYLQS------RVGDTLQAVKGHTYVSPLV-NPGQADLSSHVDFQ 279
            +L    G    +DYGY         R+  TL     HTY      N G  D++SHV+F 
Sbjct: 232 QKLKK--GFVFTVDYGYPSKELYKPYRMKGTLLCYYKHTYNENFYENIGFQDITSHVNFS 289

Query: 280 RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKK 339
            L        L   G T Q  FL  LG+      L ++   K    + + RL  T    K
Sbjct: 290 ALVYYGKKAGLEFTGFTDQAHFLINLGLGDIMIQLQEKGDSKS--FERINRL-KTLILPK 346

Query: 340 SMGELFKILV 349
            MGE FKIL+
Sbjct: 347 GMGEKFKILI 356


>gi|325265583|ref|ZP_08132274.1| protein of hypothetical function DUF185 [Kingella denitrificans
           ATCC 33394]
 gi|324982931|gb|EGC18552.1| protein of hypothetical function DUF185 [Kingella denitrificans
           ATCC 33394]
          Length = 384

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 163/369 (44%), Gaps = 49/369 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEML 63
           L + I N I++ G +   ++  L +  P  GYY+      G  GDF+TAP +S +F + L
Sbjct: 20  LCQLIQNEIREKGDIPFSRFMELALYAPNLGYYANGRLKIGQAGDFITAPTLSPLFAQTL 79

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
           A  L     + G      + E G G G++  D+L  +        S+ + Y+VE S +L 
Sbjct: 80  AQQLKPLLPEVG----GVIYEFGAGTGVLAADLLNALES------SLHTYYIVEVSAQLA 129

Query: 124 LIQKKQLASYG----DKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             Q++ +A Y     DK+ W   L +   G   L+ NE  D++PI++    E    +R  
Sbjct: 130 KQQRQHIAEYAPEFLDKVEWLAQLPEQLEGI--LIGNEVLDAMPIERIRHNESNKWQRAC 187

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE-------MQSISDRLACD 232
              + D  +    + E ++       YF     +N+P            +Q+++ +L   
Sbjct: 188 VSQEGDKFILKYQETEDENIVQAALQYFP----DNTPYTSELHLTQYAFIQTLAQKLT-- 241

Query: 233 GGTAIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
            G  I IDYG+        Q   G  +   + H+   P    G  DL+SHV+F  ++  A
Sbjct: 242 RGAMIWIDYGFDAAQYYHPQRNDGTLIGHHRHHSIHDPFYRVGLTDLTSHVNFSDIADAA 301

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSA-----DKKS 340
               L + G TTQ  FL  LGI +R   L +Q        DSV+ + + +A      +  
Sbjct: 302 CTNGLDLIGYTTQANFLFNLGILER---LGQQYPEA----DSVEYIRAAAAVHQLTAQHE 354

Query: 341 MGELFKILV 349
           MGELFK++ 
Sbjct: 355 MGELFKVIA 363


>gi|254491150|ref|ZP_05104331.1| conserved hypothetical protein [Methylophaga thiooxidans DMS010]
 gi|224463663|gb|EEF79931.1| conserved hypothetical protein [Methylophaga thiooxydans DMS010]
          Length = 379

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 111/371 (29%), Positives = 170/371 (45%), Gaps = 47/371 (12%)

Query: 14  KKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWE 72
           ++ G ++   Y   C+  P FGYYS   +  G  GDF TAPEIS +FG  +A  +  A +
Sbjct: 20  QQGGFISFADYMQRCLYQPGFGYYSAGSHKLGQGGDFTTAPEISPLFGYAVANQVHDALQ 79

Query: 73  QHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKKQL 130
           Q    +   ++E G G G + + +L  +  L   P+ + +L I     + +L LI+ +Q 
Sbjct: 80  Q---CTSKHILEFGAGSGQLAIAMLTQLESLNALPERYFILEISADLQARQLQLIE-QQR 135

Query: 131 ASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFN 190
               D++ W  +L DV  G   ++ANE  D++P+    +T  G+ ER + I+      F 
Sbjct: 136 PDLADRVEWIQTLPDVFNG--VMLANEVCDAMPVHLLRLTTSGMFERGVSIENGH---FI 190

Query: 191 IGDHEIKSNFLTCSDYFLGAIFENSPCRD----------REMQSISDRLACDGGTAIVID 240
             D ++    L     F   I E S   D            MQ+ +  L    G   +ID
Sbjct: 191 WQDKKLAHPRLIA---FAERINEPSQAEDYLTEVNLNAVDWMQTAAASL--QQGAIFIID 245

Query: 241 YG------YLQSRVGDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YG      Y   RV  TL++      +  PL  PG  D+S+HVDF  L+  A+    ++ 
Sbjct: 246 YGYPFNDYYAAERVQGTLRSYYRQQAIDDPLQLPGLQDISAHVDFTTLAETALEGGCHVA 305

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKK-----SMGELFKIL 348
           G   QG FL    I Q A  L    A+KD L      L  ++A K+      MG  FK+L
Sbjct: 306 GFHEQGDFLVAANITQIAAQL---EAKKDAL----SWLQHSAALKQLLMPHVMGYQFKVL 358

Query: 349 VVSHEKVELMP 359
            +S + +EL+P
Sbjct: 359 SLS-KAIELLP 368


>gi|33599197|ref|NP_886757.1| hypothetical protein BB0208 [Bordetella bronchiseptica RB50]
 gi|33575243|emb|CAE30706.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 419

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 96/371 (25%), Positives = 159/371 (42%), Gaps = 45/371 (12%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYSTC-----------NPFGAVGDFVTAPEISQIFG 60
           +    G +   Q+ +  +  P  GYY+              P    GDFVTAPE++ +F 
Sbjct: 54  IAAAGGWLPFSQWMSAALYAPGLGYYTAGATKLASPADAQGPALPAGDFVTAPELTPLFA 113

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK-PDFFSVLSIYMVETS 119
             +A  +              ++E G G G +   +LR +  L  P  +      +VE S
Sbjct: 114 ATVARQIAQVLRAT---DTASVLEFGAGTGALAEGVLRALAGLDCPARY-----LIVEVS 165

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI-RERM 178
             L   Q+ +LA +GD++ W   L D   G   ++ NE  D++P   F  +E G+ +ER 
Sbjct: 166 ADLRQRQQSRLAPFGDRVQWLDQLPDAFAGC--VLGNEVLDAMPATLFRWSETGVVQERG 223

Query: 179 IDIDQHDSLVFNIGDHEIK-----SNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG 233
           + +D      +   D +       +  +     ++  I   +    R M     R     
Sbjct: 224 VTVDADGEFAWQDRDADAPLAQAVAQRMPPLPGYVSEINLQAEAWVRGMGLWLQR----- 278

Query: 234 GTAIVIDYGYLQS------RVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G A+++DYG+ +S      R G TL   ++ H +  P V PG  D++SHVDF  ++  A+
Sbjct: 279 GAALLLDYGFPRSEYYHPQRAGGTLMCHLRHHAHADPFVAPGLQDITSHVDFTAMADAAL 338

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARK-DILLDSVKRLVSTSADKKSMGELF 345
              L + G  +Q +FL   G+      L    AR     +  V++L+S    +  MGELF
Sbjct: 339 AGGLQVLGYLSQARFLVNAGLLDALSQLDPADARAYAQAVAPVQKLLS----EAEMGELF 394

Query: 346 KILVVSHEKVE 356
           K+L V  +  E
Sbjct: 395 KVLAVGRDMPE 405


>gi|212536208|ref|XP_002148260.1| DUF185 domain protein [Penicillium marneffei ATCC 18224]
 gi|210070659|gb|EEA24749.1| DUF185 domain protein [Penicillium marneffei ATCC 18224]
          Length = 525

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 97/190 (51%), Gaps = 27/190 (14%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP------FGAVGDFVTAPEISQI 58
           L + + + I+  G +++  Y    + +P+ GYY+T +       FG  GDF+T+PEI+QI
Sbjct: 42  LAKILADAIRTTGPISIAAYMRQVLTNPDAGYYTTPSSQSKTEVFGKKGDFITSPEITQI 101

Query: 59  FGEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           FGE++ I+ +  W   G P   V L+E+GPG+G +M DILR +   K    S+ +IY+VE
Sbjct: 102 FGELVGIWAVTEWMAQGMPKEGVELIEVGPGKGTLMDDILRTVQNFKQFSKSIENIYLVE 161

Query: 118 TSERLTLIQKKQLAS------------------YGDKINWYTSLADVPLG--FTFLVANE 157
            S  L  IQK  L                     G  I W   +  +P      F+ A+E
Sbjct: 162 ASAPLREIQKNLLCGPDAVLEEIDIGYRGINKHTGAPIVWVEDIRLLPYNDKMPFIFAHE 221

Query: 158 FFDSLPIKQF 167
           FFD+LPI  F
Sbjct: 222 FFDALPIHAF 231



 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 68/126 (53%), Gaps = 8/126 (6%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ ++ H  +SP   PGQ D+S+ VDF  L+  A+     + 
Sbjct: 386 GAALILDYGTSSTIPVNSLRGIRQHKAISPFAYPGQVDVSADVDFISLAEAALEASEGVE 445

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQ----TARKDILLDSVKRLVSTSADKKSMGELFKI 347
           ++G   Q ++L  LGI +RA  L+K     + +   L  + KRLV    +   MG+L+K 
Sbjct: 446 VHGPVDQAEYLHSLGIAERAEQLLKHMPEDSEKHKTLQTAWKRLVDKGPN--GMGKLYKA 503

Query: 348 LVVSHE 353
           L +  E
Sbjct: 504 LAIVPE 509


>gi|311109371|ref|YP_003982224.1| hypothetical protein AXYL_06216 [Achromobacter xylosoxidans A8]
 gi|310764060|gb|ADP19509.1| hypothetical protein AXYL_06216 [Achromobacter xylosoxidans A8]
          Length = 395

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 162/373 (43%), Gaps = 48/373 (12%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNP---------FGAVGDFVTAPEISQIFGE 61
            +    G ++ D + A  +  P  GYY+  N              GDFVTAP++S +F  
Sbjct: 30  TIAAHGGWLSFDHWMAQALYAPGLGYYAAGNVKLADADGDVRAPAGDFVTAPQLSPLFAR 89

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
            LA        Q        ++E G G G +   +LR +  +     +     ++E S  
Sbjct: 90  TLARQAAQVLRQ---TQTETVLEFGAGTGALAEGVLRELDAMG---LAQTRYLILEVSAD 143

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHG-IRERMI 179
           L   Q ++LA++GD++ W  +L   P  F   V ANE  D++P+  F  +E G + ER +
Sbjct: 144 LRARQAERLAAFGDRVQWLDAL---PQSFAGCVLANEVLDAMPVSIFHWSEAGEVLERGV 200

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG----GT 235
            +D     V+   D              + A+       +  +Q  +   A  G    G 
Sbjct: 201 AVDASQDFVWQ--DRPAPPALAAAVAARMPAL--PGYVSEINLQGEAWIAAMGGWLERGA 256

Query: 236 AIVIDYGYLQS------RVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY 288
           A+++DYG+ +S      R G TL   ++ H +  P   PG  D+++HVDF  ++  A+  
Sbjct: 257 ALLVDYGFPRSEYYHPQRAGGTLMCHLRHHAHGDPFTAPGLQDITAHVDFTAMADAALEA 316

Query: 289 KLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-----LLDSVKRLVSTSADKKSMGE 343
            L + G T+Q +FL   G+      L+ Q    D+      +  V++L+S S     MGE
Sbjct: 317 GLQVLGYTSQARFLMNAGL----MDLLAQLDPSDVQQYAQAVAPVQKLLSES----EMGE 368

Query: 344 LFKILVVSHEKVE 356
           LFK+L V     E
Sbjct: 369 LFKVLAVGRGITE 381


>gi|33593985|ref|NP_881629.1| hypothetical protein BP3058 [Bordetella pertussis Tohama I]
 gi|33564059|emb|CAE43327.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332383402|gb|AEE68249.1| hypothetical protein BPTD_3022 [Bordetella pertussis CS]
          Length = 419

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 95/371 (25%), Positives = 160/371 (43%), Gaps = 45/371 (12%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYSTC-----------NPFGAVGDFVTAPEISQIFG 60
           +    G +   Q+ +  +  P  GYY+              P    GDFVTAPE++ +F 
Sbjct: 54  IAAAGGWLPFSQWMSAALYAPGLGYYTAGATKLASPADAQGPALPAGDFVTAPELTPLFA 113

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK-PDFFSVLSIYMVETS 119
             +A  +              ++E G G G +   +LR +  +  P  +      +VE S
Sbjct: 114 ATVARQVAQVLRAT---DTASVLEFGAGTGALAEGVLRALAGMDCPARY-----LIVEVS 165

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHG-IRERM 178
             L   Q+ +LA +GD++ W   L D   G   ++ NE  D++P   F  +E G ++ER 
Sbjct: 166 ADLRQRQQSRLAPFGDRVQWLDQLPDAFAGC--VLGNEVLDAMPATLFRWSETGTVQERG 223

Query: 179 IDIDQHDSLVFNIGDHEIK-----SNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG 233
           + +D   +  +   D +       +  +     ++  I   +    R M     R     
Sbjct: 224 VTVDADGAFAWQDRDADAPLAQAVAQRMPPLPGYVSEINLQAEAWVRGMGLWLQR----- 278

Query: 234 GTAIVIDYGYLQS------RVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G A+++DYG+ +S      R G TL   ++ H +  P V PG  D++SHVDF  ++  A+
Sbjct: 279 GAALLLDYGFPRSEYYHPQRAGGTLMCHLRHHAHADPFVAPGLQDITSHVDFTAMADAAL 338

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARK-DILLDSVKRLVSTSADKKSMGELF 345
              L + G  +Q +FL   G+      L    AR     +  V++L+S    +  MGELF
Sbjct: 339 AGGLQVLGYLSQARFLVNAGLLDALSQLDPADARAYAQAVAPVQKLLS----EAEMGELF 394

Query: 346 KILVVSHEKVE 356
           K+L V  +  E
Sbjct: 395 KVLAVGRDMPE 405


>gi|284053133|ref|ZP_06383343.1| hypothetical protein AplaP_16842 [Arthrospira platensis str.
           Paraca]
 gi|291568912|dbj|BAI91184.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 389

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 95/333 (28%), Positives = 151/333 (45%), Gaps = 30/333 (9%)

Query: 5   LIRKIVNLIKKNGQ--MTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGE 61
           L+ +I   I  + Q  +T  +Y  + + DP+ GYY+  +P  GA GDF T+P +   FGE
Sbjct: 6   LVDRISQRIGNHPQNPITFAEYMEMVLYDPQSGYYNHNSPQIGAQGDFFTSPHLGSDFGE 65

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +LA  L+  WE  G P    LVE+G G+GI+  DI+  + +  P    VL   + E S R
Sbjct: 66  LLAEQLVEMWEVLGKPEPFTLVEMGAGQGILAADIIGYLQRQYPQVVRVLDYAIAEKSRR 125

Query: 122 LTLIQKKQLASYGD---KINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           L   Q+++L   G+   +I W     +A+  +   F  +NE  D+ P+      ++ ++E
Sbjct: 126 LKTEQQQRLQQLGEPFTQIRWCNLDDIANHSITGCFF-SNELIDAFPVHLVTRQDNQLQE 184

Query: 177 RMIDID------QHDSLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQS 224
             +         Q   +V  +   ++   F      L    Y  G   E +      M++
Sbjct: 185 IYVTTTGKSPNFQLAEVVGELSTPQLADYFRLVGIDLLSDAYPEGYRTEVNLAALEWMET 244

Query: 225 ISDRLACDGGTAIVIDYGYLQSRV------GDTLQAVKGHTYVS-PLVNPGQADLSSHVD 277
           ++ +L    G  + IDYGY   R+        TLQ    H + + P +  GQ D+++HVD
Sbjct: 245 VARKL--QRGFVLTIDYGYSADRLYSPTRREGTLQCYYQHRHHNDPYIYIGQQDITAHVD 302

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           F  L        L   G T Q  FL  LG+  R
Sbjct: 303 FTALQQKGRSLGLQTIGFTQQALFLMALGLGDR 335


>gi|327302796|ref|XP_003236090.1| hypothetical protein TERG_03140 [Trichophyton rubrum CBS 118892]
 gi|326461432|gb|EGD86885.1| hypothetical protein TERG_03140 [Trichophyton rubrum CBS 118892]
          Length = 501

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 102/189 (53%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNP----FGAVGDFVTAPEISQIF 59
           L ++I + I   G +++  +   C+   E GYY S   P    FG  GDFVT+PEISQ+F
Sbjct: 45  LAKRITDAINTTGPISIAAFMRQCLTSDEGGYYTSRGTPGRDVFGKEGDFVTSPEISQMF 104

Query: 60  GEMLAIFLICAWEQHGFPSC-VRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+L I+++  W   G  S  V+L+E GPG+G +M DILR +   K    SV  +YM+E 
Sbjct: 105 GELLGIWIVTEWLSQGRRSSGVQLMEFGPGKGTLMADILRSVRNFKGFASSVEGVYMIEA 164

Query: 119 SERLTLIQKKQL---ASYGDKINWYTSLA---DVPLGFT--------------FLVANEF 158
           S  L  IQKK L   A   +    Y S++    VP+ +T              F++A+EF
Sbjct: 165 SPTLRDIQKKALCGDAPMEECDIGYKSISIHLGVPVYWTEHIRILTQTEDKAPFIIAHEF 224

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 225 FDALPIHAF 233



 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 9/126 (7%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ +K H  VSP   PG+ DLS+ VDF  L+  A+     + 
Sbjct: 363 GAALILDYGPSSTIPVNSLRGIKNHQVVSPFATPGEVDLSADVDFTGLAESALNASPGVE 422

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMK----QTARKDILLDSVKRLVSTSADKKSMGELFKI 347
           + G   QG FL  LGI +RA  L++    +  RK I   S +RLV        MG ++K 
Sbjct: 423 VYGPNEQGSFLRSLGIAERAAQLLRNVNDEEKRKQI-ESSWQRLVERGGG--GMGRIYKA 479

Query: 348 LVVSHE 353
           + +  E
Sbjct: 480 MAIVPE 485


>gi|289620095|emb|CBI53539.1| unnamed protein product [Sordaria macrospora]
          Length = 571

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 100/197 (50%), Gaps = 30/197 (15%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC--------NPFGAVGDFVTAPEIS 56
           L +++   I   G + +  +  +C+     GYY+          + FGA GDFVT+PEIS
Sbjct: 69  LAKQLAEAITATGPVPLASFMRMCLTGDIGGYYTGAIEKSEQNRDQFGAAGDFVTSPEIS 128

Query: 57  QIFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYM 115
           Q+FGE+  ++ +  W   G PS  V L+E+GPGRG +M D+LR I        S+ ++YM
Sbjct: 129 QVFGELCGLWYVTEWLAQGRPSKGVELIEVGPGRGTLMDDMLRTIQNFPEMAKSIDAVYM 188

Query: 116 VETSERLTLIQKKQL-----------------ASYGD-KINWYTSLADVPLG---FTFLV 154
           VE S +L + QK  L                   YG+  I W  ++  +P       F++
Sbjct: 189 VEASPQLRIAQKNLLCREDAAMSESKVGYHSHCKYGNIPIVWTETIKSIPYDPEKTPFIM 248

Query: 155 ANEFFDSLPIKQFVMTE 171
           A+EFFD+LPI  F + E
Sbjct: 249 AHEFFDALPIHAFQLVE 265



 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 71/144 (49%), Gaps = 16/144 (11%)

Query: 224 SISDRLACDGGTAIVIDYGYLQSRVG-DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
           S S   A   G A+++DYG     V  ++L+ ++ H  VSP   PG  DLS+ VDF  ++
Sbjct: 414 SPSHPKAQPRGAALILDYGPGDGSVPVNSLRGIRKHHLVSPFAEPGLTDLSADVDFSAIA 473

Query: 283 SIAILYK--LYINGLTTQGKFLEGLGIWQRAFSLMK---QTARKDI--------LLDSVK 329
             A+     + ++G   QG  LEG+G  +R  SL++   QT + D         L  S +
Sbjct: 474 EAAVNASEGVEVHGPVEQGWLLEGMGGRERVESLVRAGLQTKKGDEEKEKFVEDLRRSWE 533

Query: 330 RLVSTSADKKSMGELFKILVVSHE 353
           RLV    +   MG ++K L +  E
Sbjct: 534 RLVDRGPN--GMGRVYKALAIVPE 555


>gi|85079715|ref|XP_956406.1| hypothetical protein NCU00183 [Neurospora crassa OR74A]
 gi|28917469|gb|EAA27170.1| hypothetical protein NCU00183 [Neurospora crassa OR74A]
          Length = 568

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 100/199 (50%), Gaps = 30/199 (15%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC--------NPFGAVGDFVTAPE 54
             L +++   I   G + +  +  +C+     GYY+          + FGA GDFVT+PE
Sbjct: 65  TPLAKQLAEAITATGPVPLASFMRMCLTGDIGGYYTGAIEKSEQNRDQFGAKGDFVTSPE 124

Query: 55  ISQIFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSI 113
           ISQ+FGE+  ++ +  W   G PS  V L+E+GPGRG +M D+LR I        S+ ++
Sbjct: 125 ISQVFGELCGLWYVTEWLAQGRPSKGVELIEVGPGRGTLMDDMLRTIQNFPEMAKSIDAV 184

Query: 114 YMVETSERLTLIQKKQLAS-----------------YGD-KINWYTSLADVPLG---FTF 152
           YMVE S +L + QK  L                   YGD  I W  ++  +P       F
Sbjct: 185 YMVEASPQLRMAQKNLLCGKDAAMSESKVGYHSHCKYGDIPIVWTETIKSIPYDPEKTPF 244

Query: 153 LVANEFFDSLPIKQFVMTE 171
           ++A+EFFD+LPI  F + +
Sbjct: 245 IMAHEFFDALPIHAFQLVQ 263



 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 65/131 (49%), Gaps = 11/131 (8%)

Query: 234 GTAIVIDYGYLQSRVG-DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--L 290
           G A+++DYG     V  ++L+ ++ H  VSP   PG  DLS+ VDF  ++  A      +
Sbjct: 422 GAALILDYGPGDGSVPVNSLRGIRKHHLVSPFAEPGLTDLSADVDFTAIAEAATNASEGV 481

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTAR------KDILLDSVKRLVSTSADK--KSMG 342
            ++G   Q  +LEG+G  +R   L K++ R      KD  +  ++R      D+    MG
Sbjct: 482 EVHGPVEQAWWLEGMGGRERVEQLAKRSKRGNEEEEKDKFVKDLRRSWDRLVDRGPNGMG 541

Query: 343 ELFKILVVSHE 353
            ++K L +  E
Sbjct: 542 RIYKALAIVPE 552


>gi|189204400|ref|XP_001938535.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187985634|gb|EDU51122.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 519

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 95/189 (50%), Gaps = 26/189 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-----STCNPFGAVGDFVTAPEISQIF 59
           L + +   I   G ++V  Y   C+  PE GYY     S  + FG  GDFVT+PEISQ+F
Sbjct: 51  LAKTLAEAITTTGPISVAAYMRQCLTHPEGGYYTRQTSSGQDQFGTKGDFVTSPEISQVF 110

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           GE++ I+L   W   G    V+++E+GPGRG +M D+LR I   K    S+ +IY++E S
Sbjct: 111 GELVGIWLYAEWLAQGRREKVQIIEVGPGRGTLMDDVLRTISSFKGFTKSIEAIYLIEAS 170

Query: 120 ERLTLIQKKQLASYGD------------------KINWYTSLADV---PLGFTFLVANEF 158
             L   Q K L+   D                  +I W   +  V        F++A+EF
Sbjct: 171 PYLQKQQAKLLSGTEDLKKNDIGFAAPCKYIPGCQIQWCEDIRLVLKENTASPFILAHEF 230

Query: 159 FDSLPIKQF 167
           FD+LPI  F
Sbjct: 231 FDALPIHVF 239



 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (50%), Gaps = 7/122 (5%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   +TL+ ++ HT VSP   PG  DLS+ VDF  L+  A+     + 
Sbjct: 379 GAALILDYGPSSTIPANTLRGIRSHTTVSPFALPGLVDLSADVDFLALADTALSASPGVE 438

Query: 292 INGLTTQGKFLEGLGIWQRA---FSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           ++G   Q  FL  +GI +RA    S  K    K  L    KRLV    +   MG+ +K L
Sbjct: 439 VHGPVEQSFFLSTMGIKERADRLLSAAKDEETKRRLETGWKRLVDRGPN--GMGKTYKAL 496

Query: 349 VV 350
            +
Sbjct: 497 AI 498


>gi|284929791|ref|YP_003422313.1| hypothetical protein UCYN_12660 [cyanobacterium UCYN-A]
 gi|284810235|gb|ADB95932.1| uncharacterized conserved protein [cyanobacterium UCYN-A]
          Length = 403

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 101/375 (26%), Positives = 176/375 (46%), Gaps = 40/375 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQ------YFALCVADPEFGYYSTCN-PFGAVGDFVTAPEIS 56
           K +R I++++    Q T ++      Y  L + D + GYY + N   G+ GDF T+  + 
Sbjct: 14  KSMRSILDIVNDKVQSTTNKCITFFDYMNLVLYDSQQGYYGSGNVNIGSEGDFFTSSSLG 73

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
             FGE+LA       E  G  +   L+E+G G  ++  DIL+ + K  P+F+ +L   ++
Sbjct: 74  PDFGELLAEQFKEMAETLGCSNKFTLIEVGAGYAVLASDILKYLEKKYPEFYQILDYIII 133

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVP----LGFTFLVANEFFDSLPIKQFVMTEH 172
           E SE L   QK+ L  +  KI W +S  D+     +G  F  +NE  D+ P+ Q ++ + 
Sbjct: 134 EESEALIKKQKEHLKHFS-KIKW-SSWEDISNNSVVGCIF--SNELIDAFPVHQIIVQDK 189

Query: 173 GIRERMIDIDQH--DSLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQS 224
            ++E  + + +   +  +  +   ++   F      LT   Y      E +      +++
Sbjct: 190 ELKEVYVTVREGNIEETIQELSTSQLLEYFQLINIDLTSQHYPENYRTEVNLKALNWLET 249

Query: 225 ISDRLACDGGTAIVIDYGYLQS------RVGDTLQAVKGHTY-VSPLVNPGQADLSSHVD 277
           +S ++    G  + IDYG++ S      R   TL     H Y  +P +N G  D+++HVD
Sbjct: 250 VSHKIK--KGYLVTIDYGHIASKYYHPQRYQGTLSCYYQHRYHCNPYINLGSQDITAHVD 307

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTAR-KDILL--DSVKRLVST 334
           F  +     L  L + GLT Q  F   LG+ +R   L     +  D+L   DS+++L+  
Sbjct: 308 FSAMEIQGNLLGLELIGLTQQELFFINLGLGERLAELSSNKYKLSDVLARRDSLRQLI-- 365

Query: 335 SADKKSMGELFKILV 349
             D   +G  FK+L+
Sbjct: 366 --DPGGLGR-FKVLI 377


>gi|242795147|ref|XP_002482520.1| DUF185 domain protein [Talaromyces stipitatus ATCC 10500]
 gi|218719108|gb|EED18528.1| DUF185 domain protein [Talaromyces stipitatus ATCC 10500]
          Length = 526

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 97/190 (51%), Gaps = 27/190 (14%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP------FGAVGDFVTAPEISQI 58
           L + + + I+  G +++  Y    + +P+ GYY+T +       FG  GDF+T+PEI+QI
Sbjct: 42  LAKILADAIRTTGPISIAAYMRQVLTNPDAGYYTTPSSQSKTEVFGKKGDFITSPEITQI 101

Query: 59  FGEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           FGE++ I+ +  W   G P   V L+E+GPG+G +M DILR +   K    S+ +IY+VE
Sbjct: 102 FGELVGIWTVTEWMAQGMPKEGVELIEVGPGKGTLMDDILRTLRNFKTFSKSIENIYLVE 161

Query: 118 TSERLTLIQKKQLAS------------------YGDKINWYTSLADVPLG--FTFLVANE 157
            S  L  +QK  L                     G  I W   +  +P      F+ A+E
Sbjct: 162 ASAPLREVQKNLLCGPDAVLEEIDIGYRGINKHTGAPIVWVEDIRLLPYNDKMPFIFAHE 221

Query: 158 FFDSLPIKQF 167
           FFD+LPI  F
Sbjct: 222 FFDALPIHAF 231



 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (54%), Gaps = 11/128 (8%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ ++ H   SP   PGQ D+S+ VDF  L+  A+     + 
Sbjct: 386 GAALILDYGTTSTVPINSLRGIRQHATTSPFAYPGQVDVSADVDFTSLAEAALEASEGVE 445

Query: 292 INGLTTQGKFLEGLGIWQRAFSLM------KQTARKDILLDSVKRLVSTSADKKSMGELF 345
           ++G   Q +FL  LGI +RA  L+      K+  RK +L  + KRLV    +   MG+L+
Sbjct: 446 VHGPVDQAEFLHSLGIAERAEQLLSKLPADKEEKRK-MLQTAWKRLVDKGPN--GMGKLY 502

Query: 346 KILVVSHE 353
           K LV+  E
Sbjct: 503 KALVIVPE 510


>gi|322420164|ref|YP_004199387.1| hypothetical protein GM18_2661 [Geobacter sp. M18]
 gi|320126551|gb|ADW14111.1| protein of unknown function DUF185 [Geobacter sp. M18]
          Length = 386

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 130/301 (43%), Gaps = 32/301 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGE 61
            KL   I+  I+  G +T   +    + +P+ GYY S     GA GDF T+  +   FG 
Sbjct: 8   TKLAEIILKRIRSRGDITFASFMESALYEPDLGYYTSPGRKVGAEGDFYTSMNVHSAFGR 67

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +++  +   WE    P+   + E G G G +  DIL  I +  P+ +  L+  ++E    
Sbjct: 68  LISREIGRFWELLDSPASFTIAEAGAGGGQLAQDILDAIAQENPNLYGTLTYRLIEKEPT 127

Query: 122 LTLIQKKQLASYGDKINWYT--SLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERM 178
           L   Q  +L  + +++ W +   LAD  L FT  +++NE FD++P+    MT+ G++E  
Sbjct: 128 LQQAQAARLERHAERLAWSSPQELADAELSFTGCIISNELFDAMPVHLVEMTDEGLKEVF 187

Query: 179 IDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL--------- 229
           +  D +            +  FL  S   L A  +    R    Q     L         
Sbjct: 188 VSADANG----------FRERFLPPSSPELAAYLQKFEVRLMPGQRAEINLAAPAWIASA 237

Query: 230 --ACDGGTAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQR 280
             A + G  + +DYGYL       Q R G  L   K  T   P    G+ D+++H++F  
Sbjct: 238 ARALERGFVLTVDYGYLTEELYTPQRRNGTLLCYHKHTTNEDPYQLVGEQDITTHINFSA 297

Query: 281 L 281
           L
Sbjct: 298 L 298


>gi|159027143|emb|CAO86774.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 375

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 170/353 (48%), Gaps = 32/353 (9%)

Query: 9   IVNLIKKN--GQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEMLAI 65
           I+  IK++  G+++ D++  L +  P++GYY++     G+ GDF T+  +   FG++LA 
Sbjct: 7   ILEEIKQSAAGRISFDRWMDLALYHPDYGYYTSGKVEIGSKGDFFTSSSLGADFGQLLAE 66

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLI 125
             +   E  G      LVE+G G GI+  DIL  +     DF+  LS  ++E S++L   
Sbjct: 67  QFVEMAEFLGNSRGFTLVEVGAGSGILAKDILDYLSDSYADFYQNLSYIIIEQSQKLRER 126

Query: 126 QKKQLASYGDKINW--YTSLADVPL-GFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           Q+  LA Y   ++W  + +LAD  L G  F  +NE  D+ P+ + V+    +RE  + + 
Sbjct: 127 QRATLAGY-SPVSWQSWPNLADNSLVGCVF--SNELIDAFPVHRVVIESGELREIYLGLG 183

Query: 183 Q-HDSLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           +    ++ ++    IK  F      +  S Y  G   E +      +++++ +L  D G 
Sbjct: 184 EPFQEIIADLSTDRIKDYFDLVGINIPSSLYREGYQTEVNLLALDWLETVNRKL--DRGY 241

Query: 236 AIVIDYGYLQS------RVGDTLQAVKGHT-YVSPLVNPGQADLSSHVDFQRLSSIAILY 288
            + IDYGY         R   TLQ  + H  +  P +  G+ D+++HVDF  L       
Sbjct: 242 ILTIDYGYTAEKYYHPQRSQGTLQCYRQHQRHDHPYLWVGEQDITTHVDFTALQRQGEKL 301

Query: 289 KLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILL-----DSVKRLVSTSA 336
            L   G T QG FL  LG+  R   L +   + DIL      D++ +L++ + 
Sbjct: 302 GLKNLGFTQQGLFLMALGLGDRLNQLSQ--GKSDILTIFQRRDALHQLINPTG 352


>gi|145543013|ref|XP_001457193.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124425008|emb|CAK89796.1| unnamed protein product [Paramecium tetraurelia]
          Length = 429

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 105/407 (25%), Positives = 187/407 (45%), Gaps = 57/407 (14%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           LI  + + I + G ++  +++   +   +FGYY   + F   GDFVT+ EISQ+F E++ 
Sbjct: 22  LINIVRSEIAEKGAISFPRFWHQALLHEKFGYYMKQDVFNKDGDFVTSVEISQMFNELIG 81

Query: 65  IFLICAWEQHGF------PSCVRL--VELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
           I+L+  ++  G       P+  ++  +E GPG G +  ++LRV  +   +    L    V
Sbjct: 82  IWLLNTFQHIGVLDNNFRPTNQKMHILEFGPGLGTLSSNVLRVFAQF--NLLENLQYSYV 139

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLA------------DVPLGF-------------- 150
           E S+ +   Q++ +     K N Y                +V L +              
Sbjct: 140 EYSDYMRKKQQEAVLKQLQKSNIYPKFEYNNQKVEKFESDEVNLKWFKMYEHFLYEETRE 199

Query: 151 ------TFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH-DSLVFNIGDHEIKSNFLTC 203
                   ++A+EFFD+LP+  F  +     ER++ +D    +L F + D   ++ F + 
Sbjct: 200 GQHCDPVLILAHEFFDALPVNVFEYSNGQWCERLVGLDNDGKTLKFVLSDGPNQNYFSSE 259

Query: 204 SDYFL--GAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYV 261
               +  G   E SP       S+++ ++  GG A++IDYG  ++   D+++A++ H  +
Sbjct: 260 IKKLIKEGDTIEISPQSGVIANSLAELISKVGGAALIIDYGEKRA-FSDSVRAIQRHKLM 318

Query: 262 SP---LVNPGQADLSSHVDFQRLSSIAI-LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
                L  PG  DLS++V+F  L   A+ +  + +  + TQG +LE +GI  R   L K 
Sbjct: 319 DKKDILNKPGDCDLSAYVNFMALEQAALKVDGIKVPEIMTQGNWLEQMGIQARLQILCKN 378

Query: 318 T--ARKDILLDSVKRLVSTSADKKSMGELFKILVVSHEK-VELMPFV 361
              A +  L    +RLV ++     MG  FK + +   K   L PF+
Sbjct: 379 ANKATEKRLQSEYERLVHSN----QMGSNFKFMCIHRTKNNNLFPFI 421


>gi|237747069|ref|ZP_04577549.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378420|gb|EEO28511.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 384

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 103/382 (26%), Positives = 177/382 (46%), Gaps = 61/382 (15%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIF 59
           ++N+++ +I +   ++G ++   Y    + +PE+GYYS     FG  GDFVTAPE S ++
Sbjct: 17  LKNRIVARIES---RSGWISFADYMQQVLYEPEYGYYSGGAANFGGQGDFVTAPETSPLY 73

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G  +A  LI   EQ    +  +++E+G G G +  DIL    +L     SV    ++E S
Sbjct: 74  GRAMAHALIPLIEQ----TRPQILEIGAGTGRLAHDIL---AELASKGISVDCYDILELS 126

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             L   Q+  L++    +NW ++L +   G   ++ANE  D++P++  V  + G +E   
Sbjct: 127 SELRERQQTSLSAC-PHVNWLSALPERFDG--VVIANEVLDAMPVQLVVKRKTGWQE--- 180

Query: 180 DIDQHDSLVFNIGDHEIKSNFL----TCSDYFLGAIFENSPCRDRE-------------- 221
                      +G   +  +F+     C  +   AI    P  D                
Sbjct: 181 -----------LGVCHLNGDFVLSERPCDTFLADAITRQIPDSDSLPEGYVTEIHTHACG 229

Query: 222 -MQSISDRLACDGGTAIV-IDYG------YLQSRVGDTLQAVKGHT-YVSPLVNPGQADL 272
            ++++++ LA   G A V +DYG      Y + R   TL     H  +  P   PG  D+
Sbjct: 230 FVRTLAEMLASGSGAAAVFVDYGFPAHEYYHRDRSSGTLMCHYRHRLHTDPFFLPGLQDM 289

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDS--VKR 330
           ++HVDF  L+ IA    L +    +Q  FL G G+ +    +  +   +   L S  V++
Sbjct: 290 TAHVDFTALARIAEAGGLDLLCYASQANFLIGAGLMELMQGVSAEMDARQYSLQSQAVQK 349

Query: 331 LVSTSADKKSMGELFKILVVSH 352
           L+S +     MGELFK++++ H
Sbjct: 350 LLSPA----EMGELFKVMILGH 367


>gi|325981510|ref|YP_004293912.1| hypothetical protein NAL212_0818 [Nitrosomonas sp. AL212]
 gi|325531029|gb|ADZ25750.1| protein of unknown function DUF185 [Nitrosomonas sp. AL212]
          Length = 395

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 107/385 (27%), Positives = 177/385 (45%), Gaps = 57/385 (14%)

Query: 7   RKIVNLIKK-----NGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFG 60
           + ++ LIK+     +G ++ +Q+  L +  P  GYY S     G+ GDFVTAPEIS +FG
Sbjct: 19  QSVLTLIKEQILASDGWISFEQFMNLALYAPGMGYYNSGATKLGSAGDFVTAPEISSLFG 78

Query: 61  EMLAIFL--ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
             L + L  I    QH +     ++E G G G + LDIL  + K    P+ + ++ +   
Sbjct: 79  RTLVLQLSQISHCLQHPY-----ILEFGAGSGRLALDILIELEKTAELPEKYFIMEVSAE 133

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
               +LTL+  K       ++ W   L D   G   ++ANE  D++P+      ++ I E
Sbjct: 134 LRQRQLTLLASKA-PHLIHRVEWLERLPDQFNGI--ILANEVLDAMPVHLVAWHDNAIFE 190

Query: 177 RMID-----IDQHDSLVFNIGDHEIK------------SNFLTCSDYFLGAIFENSPCRD 219
           R +      +   D  + +I  H I             S+F   S++ L AI        
Sbjct: 191 RGVSWHNDQLTWQDRPLQDIYLHSIAGQMTSQINPNSDSHFEYVSEFNLSAI-------- 242

Query: 220 REMQSISDRLACDGGTAIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADL 272
             M+S++  L    G  ++IDYG+        Q   G  +   + H + +P   PG  D+
Sbjct: 243 GFMRSLAKLLRQ--GVILLIDYGFGRDEYYHPQRNQGTLMCHYRHHAHDNPFYLPGLQDI 300

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRL 331
           +SHVDF  ++  A+   L + G TTQ  FL   GI +    + ++ TAR     + +++L
Sbjct: 301 TSHVDFSAVTQAAVDSNLTLLGYTTQAFFLINSGITKILAQIPVEDTARYLPQSNQLQKL 360

Query: 332 VSTSADKKSMGELFKILVVSHEKVE 356
           ++ +     MGELFK++    E  E
Sbjct: 361 INPA----EMGELFKVIAFGKEFTE 381


>gi|221633566|ref|YP_002522792.1| ACR protein [Thermomicrobium roseum DSM 5159]
 gi|221157203|gb|ACM06330.1| Uncharacterized ACR [Thermomicrobium roseum DSM 5159]
          Length = 381

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 151/362 (41%), Gaps = 33/362 (9%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFG 60
           M + L   I   I + G +T  ++  L +  P+ GYY T    G  GDF+TAPE   IFG
Sbjct: 1   MGSPLADLIQREIAERGPITFARFMELALYHPQHGYYMTSVRAGRAGDFLTAPETHPIFG 60

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
            ++A  +   W+    P    LVE GPG G ++L ILR + + +P     L    +E S 
Sbjct: 61  WVIARQVAECWDLLDRPEPFHLVEYGPGSGTLVLAILRYLSQNEPHLLERLRYCPIEPSA 120

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFT--FLVANEFFDSLPIKQFVMTEHGIRERM 178
                  ++L + G    W   + D P       ++ANE  D+LP+ +       +RE  
Sbjct: 121 PARAELLRRLGTAG----WAHLVTDAPPAAASGLVLANEVVDALPVHRVRQEGGELRELF 176

Query: 179 IDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ----------SISDR 228
           +  D      F      + +  L  +D+   A     P   +E +           ++ R
Sbjct: 177 VGWDGQR---FVAVPGPLSTPEL--ADWL--ARLGVQPVEGQETEVCLAMLGWLDEVARR 229

Query: 229 LACDGGTAIVIDYGYLQSRVGDTLQAVKG--HTYVS------PLVNPGQADLSSHVDFQR 280
           L  + G  +V+DYG       D  +  +G   TY +      PL +PG+ D+++HVDF  
Sbjct: 230 L--ERGYLLVLDYGAPAPERADPTRFPRGTIRTYAAHARGSDPLADPGERDITAHVDFTM 287

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKS 340
           LS  A    L    LTTQ +FL   G+ +   +L  +         + +       D   
Sbjct: 288 LSLAAAERGLVPLALTTQAEFLAQAGLGELLVALQAEPGMTAAQYLAARAAALHLLDPGG 347

Query: 341 MG 342
           MG
Sbjct: 348 MG 349


>gi|172037853|ref|YP_001804354.1| hypothetical protein cce_2940 [Cyanothece sp. ATCC 51142]
 gi|171699307|gb|ACB52288.1| DUF185-containing protein [Cyanothece sp. ATCC 51142]
          Length = 377

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 164/355 (46%), Gaps = 47/355 (13%)

Query: 5   LIRKIVNLIKKNG--QMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGE 61
           ++  I++ IK +   ++T   Y  L +  PE GYYS+     G+ GDF TA  +   FGE
Sbjct: 1   MLEIIIDRIKNSSHHRITFADYMDLVLYHPEQGYYSSGKVNIGSEGDFFTASSLGSDFGE 60

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +LA       E         LVE+G G G +  DIL  + +   +F+  L+  ++E S+ 
Sbjct: 61  LLAEQFREMSEFLNNSDSFTLVEVGAGTGNLASDILNYLKQKHSNFYDQLNYIIIEESQA 120

Query: 122 LTLIQKKQLASYGDKINWYTSLADVP----LGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
           L   Q+ +L  + DKI W TS  D+P     G  F  +NE  D+ PI   ++T+H  + +
Sbjct: 121 LIKKQQDKLKGF-DKITW-TSWQDIPDNSITGCIF--SNELIDAFPI--HLVTKHNKQLK 174

Query: 178 MIDID-QHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDRE---------MQ 223
            I +  Q D L   I   EI +  L  SDYF    +    +N P   R          ++
Sbjct: 175 EIYVTWQDDQLKEKI--EEISTTKL--SDYFKLIDIDITKDNYPEDYRTEVNLKALGWLK 230

Query: 224 SISDRLACDGGTAIVIDYGYLQS------RVGDTLQAVKGHTYV-SPLVNPGQADLSSHV 276
            +S +L    G  + IDYGY  +      R   TL     H +  +P VN GQ D+++HV
Sbjct: 231 LVSAKLKK--GYLLTIDYGYSSAKYYHPQRYQGTLNCYHQHRHHHNPYVNLGQQDITAHV 288

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR-------AFSLMKQTARKDIL 324
           DF  L     L  L   GLT QG FL  LG+  R        +SL +   R+D L
Sbjct: 289 DFTALEKQGNLLGLETVGLTQQGLFLMALGLGDRLAELSNGNYSLPEILNRRDAL 343


>gi|78486156|ref|YP_392081.1| hypothetical protein Tcr_1815 [Thiomicrospira crunogena XCL-2]
 gi|78364442|gb|ABB42407.1| conserved hypothetical protein containing DUF185 [Thiomicrospira
           crunogena XCL-2]
          Length = 394

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 104/373 (27%), Positives = 167/373 (44%), Gaps = 40/373 (10%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEML 63
           L +KI  ++K++G M   ++  + +  P  GYY++  P  G  GDF+TAPE+S IF   L
Sbjct: 21  LQQKIRQMLKRHGMMPFPRFMEMALYTPGLGYYASGLPKIGQQGDFITAPEVSPIFSRCL 80

Query: 64  AIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLT 123
           A       E    P+   ++E G G+G M  DIL  +  L+     +   Y+VE S  L 
Sbjct: 81  ARQAAQVLETLETPN---VIEFGAGKGTMAKDILLELDALEQ---PIEQYYIVELSADLR 134

Query: 124 LIQKKQLASYGD----KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
             Q++ L +  +    K+ W   L   PL    ++ANE  D++P+++  + E       +
Sbjct: 135 ARQQETLQALPETLFNKVVWLDQLPKDPLQ-AVVLANEVLDAMPVERLRLEEEQSLRGYV 193

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE----------MQSISDRL 229
            I   D   F    H I    L  +   +  +      R  E          +QSI+D L
Sbjct: 194 -IFNEDKQRFGWDYHPITDATLQKASNAILNLIGTPSARGYETEINLNIHPWLQSIADFL 252

Query: 230 ACDGGTAIVIDYGYLQ------SRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLS 282
           +   G  ++IDYGY +      SR   TL+    H  +  P   PG  D+++HVDF  ++
Sbjct: 253 SQ--GAVLLIDYGYNRKEYYQPSRHMGTLRCHYQHRAHGDPFFFPGLQDITAHVDFTSVA 310

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVK--RLVSTSADKKS 340
                    + G TTQ  FL G G+ +     M      DI  +S+K  + + T      
Sbjct: 311 ESGFDTGFKVAGYTTQAHFLMGSGLLE-----MSGDPTADI-TESLKIAQQIKTLTLPDE 364

Query: 341 MGELFKILVVSHE 353
           MGE FK++ ++ +
Sbjct: 365 MGESFKVIALTKD 377


>gi|194376780|dbj|BAG57536.1| unnamed protein product [Homo sapiens]
          Length = 214

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 91/166 (54%), Gaps = 21/166 (12%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETSERLT 123
           I+ I  W   G  + ++LVELGPGRG ++ DILRV  +L     +  +S+++VE S++L+
Sbjct: 103 IWFISEWMATGKSTALQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEVSQKLS 162

Query: 124 LIQK--------------------KQLASYGDKINWYTSLADVPLG 149
            IQ                     K +   G  I+WY  L DVP G
Sbjct: 163 EIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKG 208


>gi|153206142|ref|ZP_01945405.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|120577272|gb|EAX33896.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
          Length = 388

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 163/373 (43%), Gaps = 61/373 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           IV  I +NG +T D+Y  L +  P  GYYS     FGA GDFVTAPEIS +F +      
Sbjct: 24  IVREIAENGPLTFDRYMQLALYAPGLGYYSAGSRKFGAAGDFVTAPEISSLFSQ------ 77

Query: 68  ICAWEQHGFPSCVRLV---------ELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
            C   Q     C +++         ELG G G M  DILR +      P  + +L I   
Sbjct: 78  -CVARQ-----CQQILIDLNGGDILELGAGSGRMAADILRELQHTGCLPHNYFILEI-SA 130

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           +  +R     K ++     ++ W   L   P     ++ NE  D++P+ +F + ++GI+E
Sbjct: 131 DLRDRQEKFIKNEIPELSHRVKWLNRLPS-PHFKGVILGNEVIDAMPVHKFKI-DNGIKE 188

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ--------SISDR 228
             ++  +++  V+ IG+          SDY            + E+         S++D 
Sbjct: 189 VYVNW-KNEQFVWEIGEPSA-----ALSDYIKNLTIHFPEGYESEVNLLLKGWIASLADI 242

Query: 229 LACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           L    G  ++IDYG+ +          G      + H++  PL+  G  D+++HVDF  +
Sbjct: 243 L--QEGLILLIDYGFPRHEYYHTDRDRGTIACHYRHHSHFDPLILTGIQDITAHVDFTAI 300

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVSTSADK 338
           +  A    L + G T Q  FL   GI     +LM Q    A    +   +K+L       
Sbjct: 301 AEAAAKQGLAVEGFTHQAGFLLNCGI----ATLMPQVEDVAEHYRIAQEIKKLTLPG--- 353

Query: 339 KSMGELFKILVVS 351
             MGELFK + ++
Sbjct: 354 -EMGELFKAIALT 365


>gi|296108510|ref|YP_003620211.1| hypothetical protein lpa_04164 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650412|gb|ADG26259.1| Hypothetical protein lpa_04164 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 370

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 171/376 (45%), Gaps = 54/376 (14%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEM 62
            L + ++N +K   ++    +    +  P  GYY++     G  GDF+TAPE++ ++G+ 
Sbjct: 2   NLKQTLINQLKLQKEIPFIDFMQQALYAPYEGYYTSGLQKLGKHGDFITAPELTSLYGKT 61

Query: 63  LAIFLICAWEQHGFP--SCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVET 118
           LA        Q   P      L E G G G + +D L  + +L+  P+ + +L +     
Sbjct: 62  LANQF-----QQILPLLDSPVLFEFGAGTGKLCIDTLTHLEQLQCLPESYLILEVSANLR 116

Query: 119 SERLTLIQKK--QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
             +  LIQ+K  QLA     I+W     + P     ++ANE  D++P+ +F+ +E  I E
Sbjct: 117 HRQQELIQQKIPQLAGL---IHWLDKWPEAPFN-GVIIANEVLDAMPVYRFMQSETEILE 172

Query: 177 RMIDIDQHDSL--VFN----------IGDH--EIKSNFLTCSDYFLGAIFENSPCRDREM 222
             + +D+HD L  +F           I +H   +   +LT ++ FL          D  +
Sbjct: 173 SYVTLDEHDQLAEIFKPVQNQRLLAYIKNHLPPLGYPYLTEANLFL----------DDWL 222

Query: 223 QSISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSH 275
            + S  L    G   +IDYG      Y   R   TL     H ++ +PL+NPG+ DL++H
Sbjct: 223 LNCSHMLK--KGALFIIDYGFPRHEYYHPDRNQGTLMCHYQHYSHPNPLLNPGEQDLTAH 280

Query: 276 VDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTS 335
           VDF  ++        +I G T Q  FL   G+     SL+  T   +  L + K+ +   
Sbjct: 281 VDFTHVAEAGHQAGFHIAGYTNQASFLLANGL----LSLI-HTLDDEQELFAAKQAIKQL 335

Query: 336 ADKKSMGELFKILVVS 351
                MGELFK++ ++
Sbjct: 336 TQPSEMGELFKVIALT 351


>gi|212217802|ref|YP_002304589.1| hypothetical protein CbuK_0124 [Coxiella burnetii CbuK_Q154]
 gi|212012064|gb|ACJ19444.1| hypothetical protein CbuK_0124 [Coxiella burnetii CbuK_Q154]
          Length = 417

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 163/373 (43%), Gaps = 61/373 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           IV  I +NG +T D+Y  L +  P  GYYS     FGA GDFVTAPEIS +F +      
Sbjct: 53  IVREIAENGPLTFDRYMQLALYAPGLGYYSAGSRKFGAAGDFVTAPEISSLFSQ------ 106

Query: 68  ICAWEQHGFPSCVRLV---------ELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
            C   Q     C +++         ELG G G M  DILR +      P  + +L I   
Sbjct: 107 -CVARQ-----CQQILIDLNGGDILELGAGSGRMAADILRELQHTGCLPHNYFILEI-SA 159

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           +  +R     K ++     ++ W   L   P     ++ NE  D++P+ +F + ++GI+E
Sbjct: 160 DLRDRQEKFIKNEIPELSHRVKWLNRLPS-PHFKGVILGNEVIDAMPVHKFKI-DNGIKE 217

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ--------SISDR 228
             ++  +++  V+ IG+          SDY            + E+         S++D 
Sbjct: 218 VYVNW-KNEQFVWEIGEPSA-----ALSDYIKNLTIHFPEGYESEVNLLLKGWIASLADI 271

Query: 229 LACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           L    G  ++IDYG+ +          G      + H++  PL+  G  D+++HVDF  +
Sbjct: 272 L--QEGLILLIDYGFPRHEYYHTDRDRGTIACHYRHHSHFDPLILTGIQDITAHVDFTAI 329

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVSTSADK 338
           +  A    L + G T Q  FL   GI     +LM Q    A    +   +K+L       
Sbjct: 330 AEAAAKQGLAVEGFTHQAGFLLNCGI----ATLMPQVEDVAEHYRIAQEIKKLTLPG--- 382

Query: 339 KSMGELFKILVVS 351
             MGELFK + ++
Sbjct: 383 -EMGELFKAIALT 394


>gi|148361175|ref|YP_001252382.1| hypothetical protein LPC_3149 [Legionella pneumophila str. Corby]
 gi|148282948|gb|ABQ57036.1| conserved hypothetical protein; DUF185 [Legionella pneumophila str.
           Corby]
          Length = 372

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 171/376 (45%), Gaps = 54/376 (14%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEM 62
            L + ++N +K   ++    +    +  P  GYY++     G  GDF+TAPE++ ++G+ 
Sbjct: 4   NLKQTLINQLKLQKEIPFIDFMQQALYAPYEGYYTSGLQKLGKHGDFITAPELTSLYGKT 63

Query: 63  LAIFLICAWEQHGFP--SCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVET 118
           LA        Q   P      L E G G G + +D L  + +L+  P+ + +L +     
Sbjct: 64  LANQF-----QQILPLLDSPVLFEFGAGTGKLCIDTLTHLEQLQCLPESYLILEVSANLR 118

Query: 119 SERLTLIQKK--QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
             +  LIQ+K  QLA     I+W     + P     ++ANE  D++P+ +F+ +E  I E
Sbjct: 119 HRQQELIQQKIPQLAGL---IHWLDKWPEAPFN-GVIIANEVLDAMPVYRFMQSETEILE 174

Query: 177 RMIDIDQHDSL--VFN----------IGDH--EIKSNFLTCSDYFLGAIFENSPCRDREM 222
             + +D+HD L  +F           I +H   +   +LT ++ FL          D  +
Sbjct: 175 SYVTLDEHDQLAEIFKPVQNQRLLAYIKNHLPPLGYPYLTEANLFL----------DDWL 224

Query: 223 QSISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSH 275
            + S  L    G   +IDYG      Y   R   TL     H ++ +PL+NPG+ DL++H
Sbjct: 225 LNCSHMLK--KGALFIIDYGFPRHEYYHPDRNQGTLMCHYQHYSHPNPLLNPGEQDLTAH 282

Query: 276 VDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTS 335
           VDF  ++        +I G T Q  FL   G+     SL+  T   +  L + K+ +   
Sbjct: 283 VDFTHVAEAGHQAGFHIAGYTNQASFLLANGL----LSLI-HTLDDEQELFAAKQAIKQL 337

Query: 336 ADKKSMGELFKILVVS 351
                MGELFK++ ++
Sbjct: 338 TQPSEMGELFKVIALT 353


>gi|186685066|ref|YP_001868262.1| hypothetical protein Npun_F4975 [Nostoc punctiforme PCC 73102]
 gi|186467518|gb|ACC83319.1| protein of unknown function DUF185 [Nostoc punctiforme PCC 73102]
          Length = 395

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 165/361 (45%), Gaps = 48/361 (13%)

Query: 5   LIRKIVNLIKKNGQ--MTVDQYFALCVADPEFGYYSTCNPFGAV------GDFVTAPEIS 56
           L   I N I    Q  +T  ++  L +  PE+GYYS+     AV       DF T+P + 
Sbjct: 7   LCAAIANHITNTPQQRITFAEFMDLALYHPEYGYYSS----DAVKIGFKDSDFFTSPNLC 62

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
             FGE+LA   +  WE  G P    LVE+G G+G++ L IL+      PDFF+ L   +V
Sbjct: 63  SDFGELLAEQFLQMWEILGKPVPFSLVEMGAGQGLLALHILKYHQLHYPDFFTALEYIIV 122

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTF--LVANEFFDSLPIKQFVMTEHGI 174
           E S  L   Q+++L  +   + W  +L ++P         +NE  D+ P+ QF++    +
Sbjct: 123 EKSPILRQEQQQRLQDF--PVRW-CNLEEIPPNAIAGCFFSNELVDAFPVHQFILETGEL 179

Query: 175 RERMIDIDQHD--------SLVFNIGDHE----------IKSNFLTCSDYFLGAIFENSP 216
           RE  +  D+++        S    IG+            ++ NF T S Y  G   E + 
Sbjct: 180 REIYVTTDKNEKETNAPYPSFAEVIGEPSTPQLAEYLDLVEMNF-TQSAYPDGYRSEINL 238

Query: 217 CRDREMQSISDRLACDGGTAIVIDYGYLQSRVGD------TLQAVKGHTYV-SPLVNPGQ 269
                +  ++DRL    G  + IDYGY  SR  +      TLQ    H +  +P +N G+
Sbjct: 239 AALDWLSIVADRL--QRGYVLTIDYGYPASRYYNPRRSQGTLQCYYHHRFHDNPYINIGR 296

Query: 270 ADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVK 329
            D+++HVDF  L        L   G   QG FL  LG+  R  +L  Q   K  LL+ ++
Sbjct: 297 QDITAHVDFTALERWGQKCNLKNVGFIQQGLFLMALGLGDRIAALSYQ---KQPLLELLQ 353

Query: 330 R 330
           R
Sbjct: 354 R 354


>gi|254410642|ref|ZP_05024421.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196182848|gb|EDX77833.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 409

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 161/344 (46%), Gaps = 36/344 (10%)

Query: 2   ENKLIRKIVN---LIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQ 57
           ++K +R ++    +   N +++  +Y  L +  P+ GYY+T     G+ GDF T+  +  
Sbjct: 6   QDKSLRHLIADTIVATPNRRISFAEYMDLVLYHPQQGYYATGAVNIGSEGDFFTSSHLGH 65

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
            FGE+LA      WE   +P    LVE+G G+G++  D+L  + +  PD F+ L   +VE
Sbjct: 66  DFGELLAEQFAQIWEILEYPEPFTLVEMGAGQGLVAADVLNYLYRQYPDCFAALDYIIVE 125

Query: 118 TSERLTLIQKK---QLASYGDKINWYTSLADVP----LGFTFLVANEFFDSLPIKQFVMT 170
            +  L   Q++   QL   G  + W T   ++P    +G  F  +NE  D+ P+ Q V+ 
Sbjct: 126 KAAGLISKQQQVLTQLNLPGLPLRWCT-FDEIPDNSIIGCCF--SNELVDAFPVHQVVLE 182

Query: 171 EHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYF--LGAIFENSPCRDRE------- 221
           +  +RE  +     +    + G+    S+    ++YF  +G    +    D         
Sbjct: 183 KGKLREVYVTTVTTEGDEIHFGEVTNDSSTPQLNEYFQWIGIDLYSGAYPDGYRTEVNLA 242

Query: 222 ----MQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGHTYV-SPLVNPGQA 270
               M++I+++L    G  + IDYG      YL  R   TL+    H +  +P VN GQ 
Sbjct: 243 ALDWMETITNKL--QRGFLLTIDYGYSADRYYLPVRHQGTLKCYYRHRHHDNPYVNVGQQ 300

Query: 271 DLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL 314
           D+++HV+F  L     L  L    LT QG FL  LG+  R  +L
Sbjct: 301 DITAHVNFTALERQGELSGLQTVELTKQGLFLMALGLGDRISAL 344


>gi|119511132|ref|ZP_01630250.1| hypothetical protein N9414_16971 [Nodularia spumigena CCY9414]
 gi|119464227|gb|EAW45146.1| hypothetical protein N9414_16971 [Nodularia spumigena CCY9414]
          Length = 390

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 148/323 (45%), Gaps = 28/323 (8%)

Query: 18  QMTVDQYFALCVADPEFGYYST-CNPFGAVG-DFVTAPEISQIFGEMLAIFLICAWEQHG 75
           ++T  ++  L +  PE GYYS+     G  G DF T+P +   FGE+LA      W+   
Sbjct: 22  RITFAEFMDLALYHPEHGYYSSHAVKIGFQGSDFFTSPHLGADFGELLAEQFWQMWDILA 81

Query: 76  FPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD 135
            P    LVE+G G+G++ + IL       PDFF+ L   +VE S      Q+++L  +  
Sbjct: 82  RPVPFSLVEMGAGQGLLAMHILNYSGLHYPDFFAALDYVIVEKSPGFQQEQQQRLQDF-- 139

Query: 136 KINWYTSLADVPLGFTF--LVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDS------L 187
            + W  SL D+P         +NE  D+LP+ QF++T+  + E  +   + DS      +
Sbjct: 140 SVRW-CSLEDIPTDSITGCFFSNELVDALPVHQFILTDGKMHEVYVTTGKDDSEPLFLEV 198

Query: 188 VFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
              +   E++         LT   Y  G   E +      +  ++DRL    G  + IDY
Sbjct: 199 TGELSTPELQKYLDLVEIDLTARGYEDGYRSEINLAAGEWLSIVADRL--HRGYVLTIDY 256

Query: 242 GYLQSRVGD------TLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           GY   R  +      +LQ    H +  +P +N G  D+++HVDF  L      +KL   G
Sbjct: 257 GYPADRYYNPRRSQGSLQCYYNHRHHDNPYINVGMQDITAHVDFTALERWGDRFKLEKIG 316

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQ 317
              QG FL  LG+ +R  ++  Q
Sbjct: 317 FIQQGLFLMALGLGERLSAISHQ 339


>gi|291612639|ref|YP_003522796.1| hypothetical protein Slit_0167 [Sideroxydans lithotrophicus ES-1]
 gi|291582751|gb|ADE10409.1| protein of unknown function DUF185 [Sideroxydans lithotrophicus
           ES-1]
          Length = 384

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 98/365 (26%), Positives = 164/365 (44%), Gaps = 39/365 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEM 62
           +LIR   ++  ++G +   ++  L +  P  GYY+     FG  GDF+TAPE+S +FG  
Sbjct: 21  ELIRG--DIAAQSGWIPFSRFMELALYAPGLGYYTAGALKFGEAGDFITAPELSSLFGHT 78

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSE 120
           LA  L+         S   + ELG G G + +DIL  + +L   P+ +S+L +   +  E
Sbjct: 79  LARQLVEVMHA----SAPHIFELGAGSGKLAVDILGELERLGELPESYSILEV-SADLRE 133

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
           R   +  K L    +++ W  +L +   G   ++ NE  D+LP+     +   I ER + 
Sbjct: 134 RQQALLGKHLPHLVERVRWLDTLPEKISGA--VIGNEVLDALPVHLLYWSNRRILERGV- 190

Query: 181 IDQHDSLVFNIGDHEI--------KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACD 232
                +  F   D E+          N     DY    + E S      + S+ +R+  D
Sbjct: 191 --TSKATRFLWVDRELDVPALLDFAKNLKVPDDY----LSEVSLTTRGLIASLCERM--D 242

Query: 233 GGTAIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA 285
            G  I IDYG+        Q   G  +   + H++  P   PG  D++SHVDF  ++  A
Sbjct: 243 KGALIFIDYGFGAGEYYHPQRSRGTLMCHYRHHSHDDPFYLPGLQDITSHVDFTAVAEAA 302

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELF 345
           I +     G T+Q  FL   GI      +  +  +    L +  + +++ A+   MGELF
Sbjct: 303 IDHGASFLGYTSQAHFLFNNGITDHLGKVSPEDVKAYAPLSAQLQKLTSPAE---MGELF 359

Query: 346 KILVV 350
           K++ +
Sbjct: 360 KVIAL 364


>gi|54295688|ref|YP_128103.1| hypothetical protein lpl2776 [Legionella pneumophila str. Lens]
 gi|53755520|emb|CAH17019.1| hypothetical protein lpl2776 [Legionella pneumophila str. Lens]
          Length = 370

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/369 (27%), Positives = 172/369 (46%), Gaps = 40/369 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEM 62
            L + ++N +K   ++    +    +  P  GYY++     G  GDF+TAPE++ ++G+ 
Sbjct: 2   NLKQTLINQLKLQKEIPFIDFMQQALYAPYEGYYTSGLQKLGKHGDFITAPELTSLYGKT 61

Query: 63  LAIFLICAWEQHGFP--SCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVET 118
           LA        Q   P  +   L E G G G + +D L  + +L+  P+ + +L +     
Sbjct: 62  LANQF-----QQILPLLNSPVLFEFGAGTGKLCIDTLTHLEQLQCLPESYFILEVSADLR 116

Query: 119 SERLTLIQKK--QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
             +  LIQ+K  QLA     I+W     + P     ++ANE  D++P+ +F+ +E  I E
Sbjct: 117 HRQQELIQQKIPQLAGL---IHWLDKWPEAPFN-GVIIANEVLDAMPVYRFMQSETEILE 172

Query: 177 RMIDIDQHDSL--VFNIGDHE-----IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
             + +D+HD L  +F    ++     IK N L   DY    + E +   D  + + S  L
Sbjct: 173 SYVTLDEHDQLAEIFKPVQNQRLLAYIK-NRLPPLDY--PYLTEANLFLDDWLLNCSHML 229

Query: 230 ACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLS 282
               G   +IDYG      Y   R   TL     H ++ +PL+NPG+ D+++HVDF  ++
Sbjct: 230 K--KGALFIIDYGFPRHEYYHPDRNQGTLMCHYQHYSHPNPLLNPGEQDITAHVDFTHVA 287

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMG 342
                   +I G T Q  FL   G+     SL+  T   +  L + K+ +        MG
Sbjct: 288 EAGHQAGFHIAGYTNQASFLLANGL----LSLI-HTLDDEQELFAAKQAIKQLTQPSEMG 342

Query: 343 ELFKILVVS 351
           ELFK++ ++
Sbjct: 343 ELFKVIALT 351


>gi|254467893|ref|ZP_05081299.1| conserved hypothetical protein [beta proteobacterium KB13]
 gi|207086703|gb|EDZ63986.1| conserved hypothetical protein [beta proteobacterium KB13]
          Length = 363

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 110/381 (28%), Positives = 170/381 (44%), Gaps = 48/381 (12%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIF 59
           ++NK+   I N  + +G ++  ++  +C+ DP++GYYS+  N FG  GDF TAP + Q F
Sbjct: 5   LKNKICETIQN--EMDGSISFSKFMDMCLYDPDYGYYSSQFNQFGEHGDFYTAPMLGQTF 62

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
               AI L    EQ        ++E+G G   + +D   VI  L      + + Y++E S
Sbjct: 63  ----AITLTKQIEQCFSEVRGNILEIGAGNAQLAVD---VILNLYERNIYLDNYYILEKS 115

Query: 120 E-----RLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI 174
                 +L  +Q K       KI W     D   G   ++ANE FD++P   F   E+ I
Sbjct: 116 HELKQYQLQALQDKLPIELFKKITWVEDFIDQFNGV--IIANELFDAIPTDVFSSFENEI 173

Query: 175 RERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFL----GAI-FENSPCRDREMQSISDRL 229
            E+ + +D  +   F+    E K  F    DY L    G   FE SP      Q I  + 
Sbjct: 174 MEKKVRVDNQN---FSWALSENKKQF----DYQLSLGDGTFDFEYSPG----YQKIFTKF 222

Query: 230 A-CDGGTAIVIDYG------YLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
           A  +     + DYG      +  SR   T++  K +       N G+ D++ HV+F  L+
Sbjct: 223 ARAEQMVCFIFDYGMDERQLFNSSRPHGTVRGFKKNLLTEIFENIGEQDITYHVNFTHLA 282

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMG 342
            +   + L I G T Q  FL  LG+     + MK   +   LL  +  L S +     MG
Sbjct: 283 FLTQKFNLNILGYTHQSHFLNNLGLEIEDTNEMKDHLK---LLSDINLLTSPA----EMG 335

Query: 343 ELFKILVVSHE-KVELMPFVN 362
           EL K++ +S   +  L  F+N
Sbjct: 336 ELIKVMAISKSCQASLNGFIN 356


>gi|37521953|ref|NP_925330.1| hypothetical protein gll2384 [Gloeobacter violaceus PCC 7421]
 gi|35212952|dbj|BAC90325.1| gll2384 [Gloeobacter violaceus PCC 7421]
          Length = 396

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 162/373 (43%), Gaps = 34/373 (9%)

Query: 3   NKLIRKIVN---LIKKNGQMTVDQYFALCVADPEFGYYSTCNP--FGAVGDFVTAPEISQ 57
           N  +R ++         G++   Q+  L +  PE GYY+T +P   G  GD++TA  +  
Sbjct: 10  NPALRTLIAQRVAASPGGRLNFAQFMDLALYHPELGYYAT-HPGRIGGWGDYITAAHLGS 68

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
            FGE+LA+     W   G P     VE+G G+G+   D LR      PDF + L   +VE
Sbjct: 69  DFGELLAVQAAQLWRHLGKPEGFDFVEMGAGQGLFAADFLRHAHANLPDFAAALDYRIVE 128

Query: 118 TSERLTLIQKKQLASYGDKINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIR 175
            S      Q++ LA  G  + W     +A   +   F  ANE  D+LP+ QFV+    + 
Sbjct: 129 RSAAQLAEQRRVLA--GLPVRWCDLEQIAPDSVAGCFF-ANELVDALPVHQFVVHRGELL 185

Query: 176 ERMIDIDQHDSLVFNIGDHEIK--SNFLTCSDYFLGAIFE------NSPCRDREMQSISD 227
           E  + ++     V           + FL         + E      N    D  +++++ 
Sbjct: 186 EIYVALEGERDFVEVAAAPSTPRLAAFLDRCGIATAPLGEGYRSEVNLAALD-WLEAVAR 244

Query: 228 RLACDGGTAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQR 280
           RLA   G  + +DYGY        Q R G      +   + +P ++ G  D+++HV+F  
Sbjct: 245 RLAR--GYVLTVDYGYTARQYYAPQHRSGTLACYHRHRVHDNPYLHIGNQDITAHVNFTA 302

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA-RKDILLDSVKR---LVSTSA 336
           L +    Y L   G T Q  FL  LG+ +R  +L    A   +  L++  R    + T  
Sbjct: 303 LQTHGAAYALRSLGFTRQSFFLLALGLGERLAALGAPGAIENNAQLNAALRRREALRTLV 362

Query: 337 DKKSMGELFKILV 349
           D  SMG+ F +L+
Sbjct: 363 DPGSMGD-FGVLI 374


>gi|167628561|ref|YP_001679060.1| hypothetical protein HM1_0432 [Heliobacterium modesticaldum Ice1]
 gi|167591301|gb|ABZ83049.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 389

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 107/390 (27%), Positives = 165/390 (42%), Gaps = 56/390 (14%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIF 59
           M + L + I + I+  G +    Y  L +  P  GYY+  +P  G  GDF+TAPEIS +F
Sbjct: 1   MSSPLQQAIGDRIRAEGPIPFRDYMELALYHPRHGYYTAGDPPMGRRGDFITAPEISPLF 60

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G ++   L   WE    P    ++E GPGRG++   +L  +          L  ++VE S
Sbjct: 61  GRVIGRQLTEMWEHLKRPDRFDIIEFGPGRGLLAKAVLEALTAGP--LADRLVYHLVEIS 118

Query: 120 ERLTLIQKKQLAS-----YGDKI-------NWYTSLADVPLGFTFLV-ANEFFDSLPIKQ 166
             L   Q++ LA      Y D          W  + A +P G T +V +NEF D+LP+ +
Sbjct: 119 PTLRAHQRESLAGLPLTVYPDPAEAIPGSYGWSAAKA-LPCGLTGVVLSNEFLDALPVHR 177

Query: 167 FVMTEHGIRERMI--DIDQHDSLVFNIGD-----------HEIKSNFLTCSDYFLGAIFE 213
            +  +    E  +           ++ G              I    +T  +   G +FE
Sbjct: 178 LIHKDGRPWELYVAKGTAHAGPFCWHYGPLSDPCLEDWIARHITGKGVTLEE---GQLFE 234

Query: 214 NSPCRDREMQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGHTY-VSPLVN 266
            +      M+++ DRL    G  + +DYG      Y   R   TL   + H     PL +
Sbjct: 235 VNLAAADWMKAV-DRLLTR-GFVLTVDYGHPVEKLYSPERYEGTLVCYRRHRADADPLED 292

Query: 267 PGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLD 326
            G+ D+++H+DF  L S+A        GL +Q  F   L  W R   L+   A       
Sbjct: 293 VGEKDMTAHLDFTSLQSVASELGWQNLGLISQMWF---LAHWLRPEDLLTGPAM------ 343

Query: 327 SVKRLVSTSADKK-----SMGELFKILVVS 351
           +V+      A KK      MGE+FK+L+ S
Sbjct: 344 TVEDFRRHQALKKVLLPGGMGEIFKVLIQS 373


>gi|30249153|ref|NP_841223.1| hypothetical protein NE1166 [Nitrosomonas europaea ATCC 19718]
 gi|30180472|emb|CAD85077.1| DUF185 [Nitrosomonas europaea ATCC 19718]
          Length = 390

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 162/359 (45%), Gaps = 29/359 (8%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLA--IFLI 68
           +    G ++   Y    +  PE GYYS     FG  GDFVTAPEIS +FG+ LA  I  I
Sbjct: 25  IAHSGGWISFADYMETVLYTPETGYYSGGAAKFGTAGDFVTAPEISPLFGQALARQIAPI 84

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQ 126
            +    G      ++E G G G + +D+L  + +L   P  + +L +   +  +R   + 
Sbjct: 85  LSAVNQG-----SILEFGAGSGKLAVDLLCALEELNNLPQHYYILDL-SADLQQRQRAMI 138

Query: 127 KKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRER-MIDIDQ-- 183
           ++ +     +++W ++L +   G   ++ANE  D++P+         I ER +I  DQ  
Sbjct: 139 EQHIPHLASRVSWLSALPEQFEG--LILANEVLDAMPVHLVAWQNGNIAERGVIWKDQGP 196

Query: 184 -HDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
                    G+    +  L  +D F   ++ +           S  +    G  +++DYG
Sbjct: 197 VWQDQPLAAGELLDVARQLPPADQFSYPLYISEISLTNRHFICSLAMLLQRGAILLVDYG 256

Query: 243 YLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGL 295
           + Q+         G  +   + H +  P   PG  D++SHVDF  ++  A+   L + G 
Sbjct: 257 FGQNEYYHPQRHQGTLMCHYRHHAHDDPFFLPGLQDITSHVDFSTIARTALDSGLQLAGY 316

Query: 296 TTQGKFLEGLGIWQ-RAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE 353
           TTQ  FL   GI    A +   Q      L+  V+RLVS +     MGELFK++V+S +
Sbjct: 317 TTQAHFLINCGITDLLARTPADQPGSYLPLVSQVQRLVSPA----EMGELFKVMVLSRD 371


>gi|52843059|ref|YP_096858.1| hypothetical protein lpg2864 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52630170|gb|AAU28911.1| hypothetical protein lpg2864 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 372

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/369 (27%), Positives = 171/369 (46%), Gaps = 40/369 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEM 62
            L + ++N +K   ++    +    +  P  GYY++     G  GDF+TAPE++ ++G+ 
Sbjct: 4   NLKQTLINQLKLQKEIPFIDFMQQALYAPYEGYYTSGLQKLGKHGDFITAPELTSLYGKT 63

Query: 63  LAIFLICAWEQHGFP--SCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVET 118
           LA        Q   P      L E G G G + +D L  + +L+  P+ + +L +     
Sbjct: 64  LANQF-----QQILPLLDSPVLFEFGAGTGKLCIDTLTHLEQLQCLPESYFILEVSANLR 118

Query: 119 SERLTLIQKK--QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
             +  LIQ+K  QLA     I+W     + P     ++ANE  D++P+ +F+ +E  I E
Sbjct: 119 HRQQELIQQKIPQLAGL---IHWLDKWPEAPFN-GVIIANEVLDAMPVYRFMQSETEILE 174

Query: 177 RMIDIDQHDSL--VFNIGDHE-----IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
             + +D+HD L  +F    ++     IK N L   DY    + E +   D  + + S  L
Sbjct: 175 SYVTLDEHDQLTEIFKPVQNQRLLAYIK-NRLPPLDY--PYLTEANLFLDDWLLNCSHML 231

Query: 230 ACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLS 282
               G   +IDYG      Y   R   TL     H ++ +PL+NPG+ D+++HVDF  ++
Sbjct: 232 K--KGALFIIDYGFPRHEYYHPDRNQGTLMCHYQHYSHPNPLLNPGEQDITAHVDFTHVA 289

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMG 342
                   +I G T Q  FL   G+     SL+  T   +  L + K+ +        MG
Sbjct: 290 EAGHQAGFHIAGYTNQASFLLANGL----LSLI-HTLDDEQELFAAKQAIKQLTQPSEMG 344

Query: 343 ELFKILVVS 351
           ELFK++ ++
Sbjct: 345 ELFKVIALT 353


>gi|88810999|ref|ZP_01126255.1| hypothetical protein NB231_09363 [Nitrococcus mobilis Nb-231]
 gi|88791538|gb|EAR22649.1| hypothetical protein NB231_09363 [Nitrococcus mobilis Nb-231]
          Length = 362

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/345 (26%), Positives = 157/345 (45%), Gaps = 31/345 (8%)

Query: 25  FALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLA--IFLICAWEQHGFPSCVR 81
            A+ + +P  GYYS     FG  GDF TAP IS++F   LA  +  I      G      
Sbjct: 1   MAIALYEPGLGYYSAGQRRFGPAGDFTTAPLISELFARTLAQQVAQILTALDGGV----- 55

Query: 82  LVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKKQLASYGDKINW 139
           ++ELG G G M  D+L  + +L+  P+ + +L +      E+   I  + +     ++ W
Sbjct: 56  VLELGAGTGHMAADLLSELERLEHLPERYLILEVSAALRQEQAQTI-ARTVPKLRSRVEW 114

Query: 140 YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSN 199
              L + PL    L ANE  D+LP+K+F +  +G++E+++ + +  +L + +   + K +
Sbjct: 115 LDRLPETPLRGVIL-ANEVIDALPVKRFQINSNGVQEQVVTLGEDATLTWALAPADPKLD 173

Query: 200 FLTCS-DYFLGA------IFENSPCRDREMQSISDRLACDGGTAIVIDYGYL-------Q 245
               + +  LG       + E  P     + S++  +  + G A+ +DYGY        Q
Sbjct: 174 TAVANIEAELGRRLPPDYVSEWCPRLAPWIASLAGVM--EAGAALFVDYGYPRAEYYHPQ 231

Query: 246 SRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGL 305
             +G  L   +   +  PLV PG  D+++ VDF   +   I   L + G TTQ  FL G 
Sbjct: 232 RHMGTLLCHYRNRVHDDPLVLPGLQDITAFVDFTLAARAGIEAGLEVLGFTTQAHFLIGA 291

Query: 306 GIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           G+      L  +TAR       + +          MGE +K+L +
Sbjct: 292 GL---PHLLEAETARAPEQAVHLTQQAKALLFPGQMGERYKVLAL 333


>gi|209363658|ref|YP_001423492.2| hypothetical protein CBUD_0057 [Coxiella burnetii Dugway 5J108-111]
 gi|207081591|gb|ABS77815.2| hypothetical protein CBUD_0057 [Coxiella burnetii Dugway 5J108-111]
          Length = 417

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 162/373 (43%), Gaps = 61/373 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           IV  I +NG +T  +Y  L +  P  GYYS     FGA GDFVTAPEIS +F +      
Sbjct: 53  IVREIAENGPLTFARYMQLALYAPGLGYYSAGSRKFGAAGDFVTAPEISSLFSQ------ 106

Query: 68  ICAWEQHGFPSCVRL---------VELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
            C   Q     C ++         VELG G G M  DILR +      P  + +L I   
Sbjct: 107 -CVARQ-----CQQILIDLNGGDIVELGAGSGRMAADILRELQHTGCLPHNYFILEI-SA 159

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           +  +R     K ++     ++ W   L   P     ++ NE  D++P+ +F + ++GI+E
Sbjct: 160 DLRDRQEKFIKNEIPELSHRVKWLNRLPS-PHFKGVILGNEVIDAMPVHKFKI-DNGIKE 217

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ--------SISDR 228
             ++  +++  V+ IG+          SDY            + E+         S++D 
Sbjct: 218 VYVNW-KNEQFVWEIGEPSA-----ALSDYIKNLTIHFPEGYESEVNLLLKGWIASLADI 271

Query: 229 LACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           L    G  ++IDYG+ +          G      + H++  PL+  G  D+++HVDF  +
Sbjct: 272 L--QEGLILLIDYGFPRHEYYHTDRDRGTIACHYRHHSHFDPLILTGIQDITAHVDFTAI 329

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVSTSADK 338
           +  A    L + G T Q  FL   GI     +LM Q    A    +   +K+L       
Sbjct: 330 AEAAAKQGLAVEGFTHQAGFLLNCGI----ATLMPQVEDVAEHYRIAQEIKKLTLPG--- 382

Query: 339 KSMGELFKILVVS 351
             MGELFK + ++
Sbjct: 383 -EMGELFKAIALT 394


>gi|310798388|gb|EFQ33281.1| hypothetical protein GLRG_08425 [Glomerella graminicola M1.001]
          Length = 512

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 96/190 (50%), Gaps = 27/190 (14%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-----NPFGAVGDFVTAPEISQIF 59
           L +++   I   G + +  Y  +C+     GYY+       + FG  GDFVT+PEISQIF
Sbjct: 63  LAKQLAEAISMTGPVPLASYMRMCLTGDIDGYYTGLAEENRDQFGLKGDFVTSPEISQIF 122

Query: 60  GEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ ++ +  W   G P   V L+E+GPGRG +M D+LR I   K    S+ +IYMVE 
Sbjct: 123 GELIGVWFVAEWLSQGKPKQGVELIEVGPGRGTLMDDMLRTIQNFKGLAQSIDAIYMVEA 182

Query: 119 SERLTLIQKKQLASYG-----DKINWYT----------------SLADVPLGFTFLVANE 157
           S +L   QK  L          K+ +++                S+   P    F+VA+E
Sbjct: 183 SPQLREAQKNLLCGPDAPMTESKVGYHSVCKYTNLPIVWTETIKSIPQSPNKMPFIVAHE 242

Query: 158 FFDSLPIKQF 167
           FFD+LPI  F
Sbjct: 243 FFDALPIHVF 252



 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 6/126 (4%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ ++ H  VSP   PG  DLS+ VDF  ++  A      + 
Sbjct: 373 GAALILDYGTSDTVPINSLRGIRRHRRVSPFSEPGLVDLSADVDFTAIAEAATRASQGVE 432

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQTARKD--ILLDSVKRLVSTSADK--KSMGELFKI 347
           ++G   QG FLE +GI QRA  L+ Q   K+  +  + + +      D+    MG+++K+
Sbjct: 433 VHGPIEQGAFLELMGIRQRAQVLINQVRGKEEFVKAEDIAKACGRLIDRGPGGMGKVYKV 492

Query: 348 LVVSHE 353
           + +  E
Sbjct: 493 MAILPE 498


>gi|288941549|ref|YP_003443789.1| hypothetical protein Alvin_1832 [Allochromatium vinosum DSM 180]
 gi|288896921|gb|ADC62757.1| protein of unknown function DUF185 [Allochromatium vinosum DSM 180]
          Length = 385

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/366 (27%), Positives = 172/366 (46%), Gaps = 45/366 (12%)

Query: 7   RKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAI 65
           R    +  + G +  D++  L +  P  GYY    P FG  GDFVTAPE+S +FG  LA+
Sbjct: 19  RVRAEIRARGGVLPFDRFMELALYAPGLGYYVAGAPKFGPGGDFVTAPELSPLFGRCLAV 78

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLT 123
              CA       S   ++E G G G + + IL  +  L+  P+ + +L     E S  L 
Sbjct: 79  --QCAEVLERLDSG-EILEFGAGSGALAVQILLELASLERLPERYRIL-----EPSPDLQ 130

Query: 124 LIQKKQLASYGD----KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHG-IRERM 178
             Q+  + +       + +W T+L +   G   ++ANE  D++P+ +F + + G I E  
Sbjct: 131 ERQRAAIQTAAPHLLARCDWLTALPERFDG--VVIANEVLDAMPVHRFRLGDAGEILE-- 186

Query: 179 IDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ-SISDRLAC-----D 232
           I + + D  +  +    + +  +        A   N+P  + E+   +S  L+      +
Sbjct: 187 IGVGERDGRLVEVAIPPVSTGLVEAVSALHEAGLANTPGYESEINLRLSPWLSALSRVME 246

Query: 233 GGTAIVIDYGYLQS------RVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIA 285
            G A++IDYGY ++      R   TL+    H  + +P V+ G  D+++HVDF   +   
Sbjct: 247 RGLALLIDYGYPRAEYYQPERHMGTLRCHHRHQAHSNPYVHLGLQDITAHVDFTAAAEAG 306

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARK---DILLDSVKRLVSTSADKKSMG 342
           +     + G TTQ  FL G GI +    LM+ +A +   D+ L + + L+ T     +MG
Sbjct: 307 VAAGFELAGFTTQAHFLIGCGIDR----LMQASAPETAFDLALGAKQLLLPT-----AMG 357

Query: 343 ELFKIL 348
           E FK+L
Sbjct: 358 ERFKVL 363


>gi|187476685|ref|YP_784708.1| hypothetical protein BAV0170 [Bordetella avium 197N]
 gi|115421271|emb|CAJ47776.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 400

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 100/365 (27%), Positives = 164/365 (44%), Gaps = 41/365 (11%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYST------CNPFGA---VGDFVTAPEISQIFGE 61
            +   +G ++ +Q+ A  +  P  GYY+        +P  A    GDF+TAPE+S +F  
Sbjct: 38  RIAAADGWLSFEQWMAQALYAPGLGYYTAGAVKLASDPGQAGLAAGDFITAPELSPLFAH 97

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
            LA      W Q       R++E G G G +   ++  + +L     SV    +VE S  
Sbjct: 98  TLA-RQAAQWLQ--ATQTHRVLEFGAGTGALAEGVMAELGRLG---LSV-EYAIVEVSAD 150

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHG-IRERMI 179
           L   Q+ +LA  G ++ W   L  +P  F  +V ANE  D++P++ F   E+G ++ER +
Sbjct: 151 LRARQQARLAPLGSRVQW---LDHLPQAFEGVVLANEVLDAMPVRLFRYDENGQVQERGV 207

Query: 180 DIDQHDSLVFNIGDHEIKSNF---LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
             DQ         D  +       L     ++  I   +    REM     R     G A
Sbjct: 208 SWDQGFVWRDRPADATLAEAVHARLPALPGYMSEINLQAEAWVREMGRWLKR-----GAA 262

Query: 237 IVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK 289
           ++IDYG      Y   R G +L   ++ H +  P V PG  D+++HVDF  ++  A+   
Sbjct: 263 LLIDYGFPRREYYHPQRAGGSLMCHLRHHAHADPFVAPGIQDITAHVDFTAIADAALEGG 322

Query: 290 LYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDS-VKRLVSTSADKKSMGELFKIL 348
           L + G T+Q +FL   G+      L     +      + V++L+S    +  MGELFK++
Sbjct: 323 LDVLGYTSQARFLMNAGLLDLLGQLDPSDVKTYAQATAPVQKLLS----EAEMGELFKVI 378

Query: 349 VVSHE 353
            +  +
Sbjct: 379 AIGRD 383


>gi|146322884|ref|XP_755307.2| DUF185 domain protein [Aspergillus fumigatus Af293]
 gi|129558508|gb|EAL93269.2| DUF185 domain protein [Aspergillus fumigatus Af293]
 gi|159129388|gb|EDP54502.1| DUF185 domain protein [Aspergillus fumigatus A1163]
          Length = 502

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 99/191 (51%), Gaps = 30/191 (15%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-----CNPFGAVGDFVTAPEISQIF 59
           L + + N IK  G + +  +    +  PE GYY+T        FG  GDFVT+PEISQ+F
Sbjct: 41  LAKTLANAIKVTGPIPIAAFMRQVLTSPEGGYYTTRPEGGGEVFGKKGDFVTSPEISQVF 100

Query: 60  GEMLAIFLICAWEQHGFP-SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE++ I+ I  W   G   S V+L+E+GPG+G +M D+LR     K    S+ +IY+VE 
Sbjct: 101 GELVGIWTITEWMAQGSKRSGVQLIEVGPGKGTLMDDMLRTFRNFKSFASSLEAIYLVEA 160

Query: 119 SERLTLIQKKQLASYGDKINWYTSLA--------DVPLGF--------------TFLVAN 156
           S  L  +QK++L   GD     T +         +VP+ +               F+ A+
Sbjct: 161 SPTLREVQKQRLC--GDAAMEETDIGHKSISKYFNVPVLWVEDIRLLPHEEDKTPFIFAH 218

Query: 157 EFFDSLPIKQF 167
           EFFD+LPI  F
Sbjct: 219 EFFDALPIHAF 229



 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG + +   ++L+ ++ H  V  L +PGQ D+S+ VDF  L+  AI     + 
Sbjct: 364 GAALIMDYGTMSTIPINSLRGIQHHRTVPALSSPGQVDVSADVDFMALAEAAIEASEGVE 423

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMK--QTARKDILLDS-VKRLVSTSADKKSMGELFKIL 348
           ++G   QG FL+ +GI +R   L++  Q   K   L+S  KRL+        MG+++K +
Sbjct: 424 VHGPVEQGDFLQVMGIAERMQQLLRGVQDEEKRKTLESGWKRLIERGGG--GMGKIYKFM 481

Query: 349 VVSHE 353
            +  E
Sbjct: 482 AIIPE 486


>gi|161830113|ref|YP_001597650.1| hypothetical protein COXBURSA331_A2027 [Coxiella burnetii RSA 331]
 gi|161761980|gb|ABX77622.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
          Length = 388

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 163/373 (43%), Gaps = 61/373 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           IV  I +NG +T+ +Y  L +  P  GYYS     FGA GDFVTAPEIS +F +      
Sbjct: 24  IVREIAENGPLTLARYMQLALYAPGLGYYSAGSRKFGAAGDFVTAPEISSLFSQ------ 77

Query: 68  ICAWEQHGFPSCVRLV---------ELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
            C   Q     C +++         ELG G G M  DILR +      P  + +L I   
Sbjct: 78  -CVARQ-----CQQILIDLNGGDILELGAGSGRMAADILRELQHTGCLPHNYFILEI-SA 130

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           +  +R     K ++     ++ W   L   P     ++ NE  D++P+ +F + ++GI+E
Sbjct: 131 DLRDRQEKFIKNEIPELSHRVKWLNRLPS-PHFKGVILGNEVIDAMPVHKFKI-DNGIKE 188

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ--------SISDR 228
             ++  +++  V+ IG+          SDY            + E+         S++D 
Sbjct: 189 VYVNW-KNEQFVWEIGEPSA-----ALSDYIKNLTIHFPEGYESEVNLLLKGWIASLADI 242

Query: 229 LACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           L    G  ++IDYG+ +          G      + H++  PL+  G  D+++HVDF  +
Sbjct: 243 L--QEGLILLIDYGFPRHEYYHTDRDRGTIACHYRHHSHFDPLILTGIQDITAHVDFTAI 300

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVSTSADK 338
           +  A    L + G T Q  FL   GI     +LM Q    A    +   +K+L       
Sbjct: 301 AEAAAKQGLAVEGFTHQAGFLLNCGI----ATLMPQVEDVAEHYRIAQEIKKLTLPG--- 353

Query: 339 KSMGELFKILVVS 351
             MGELFK + ++
Sbjct: 354 -EMGELFKAIALT 365


>gi|218439985|ref|YP_002378314.1| hypothetical protein PCC7424_3044 [Cyanothece sp. PCC 7424]
 gi|218172713|gb|ACK71446.1| protein of unknown function DUF185 [Cyanothece sp. PCC 7424]
          Length = 387

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 158/352 (44%), Gaps = 35/352 (9%)

Query: 4   KLIRKIVNLIKKNGQ--MTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFG 60
            LI+ ++  I ++ Q  +T  +Y  L +  PE GYY +  P  G  GD+ T+  +   FG
Sbjct: 5   NLIKILIEQINQSSQQGITFAEYMHLVLYHPELGYYCSHLPKIGTQGDYFTSSSLGADFG 64

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+LA   +  WE  G PS   +VE+G G G++  DIL    +    F   L+ +++E S 
Sbjct: 65  ELLAKQFLEMWEILGQPSPFIIVEMGAGLGLLAQDILNYFEQNNTHFLDSLNYWLIEQSS 124

Query: 121 RLTLIQKKQLASY---GDKINWYT--SLADVP-LGFTFLVANEFFDSLPIKQFVMTEHGI 174
            L   QK QL  Y   G K++W T   +AD   +G  F  +NE  D+ P+ +  + +  +
Sbjct: 125 TLIKAQKNQLTPYLEKGVKLDWKTWEDIADESIIGCVF--SNELVDAFPVHRVGLEKGEL 182

Query: 175 RERMIDIDQH--DSLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQSIS 226
           +E  +   ++    ++ +    E+   F           Y  G   E +      ++++S
Sbjct: 183 KEIYVTYTENTFKEILADPSSEELNHYFKFVGVEFPSDAYPEGFQTEVNLSALSWLKTLS 242

Query: 227 DRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGHT-YVSPLVNPGQADLSSHVDFQ 279
            +L    G  + IDYG      Y   R   TL     H  +  P +N G  DL++HVDF 
Sbjct: 243 QKLKR--GYILTIDYGYPAHKYYHPQRYRGTLNCYYQHRHHHDPYINIGYQDLTAHVDFT 300

Query: 280 RLSSIAILYKLYINGLTTQGKFLEGLGIWQR-------AFSLMKQTARKDIL 324
            L        L   G T QG FL  LG+  R        ++L++   R+D L
Sbjct: 301 ALERQGQKCGLEKLGFTQQGLFLMSLGLGDRLNDLSSGRYNLIEVMNRRDAL 352


>gi|54298855|ref|YP_125224.1| hypothetical protein lpp2922 [Legionella pneumophila str. Paris]
 gi|53752640|emb|CAH14075.1| hypothetical protein lpp2922 [Legionella pneumophila str. Paris]
          Length = 370

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 102/369 (27%), Positives = 170/369 (46%), Gaps = 40/369 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEM 62
            L + ++N +K   ++    +    +  P  GYY++     G  GDF+TAPE++ ++G+ 
Sbjct: 2   NLKQTLINQLKLQKEIPFIDFMQQALYAPYEGYYTSGLQKLGKHGDFITAPELTSLYGKT 61

Query: 63  LAIFLICAWEQHGFP--SCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVET 118
           LA        Q   P      L E G G G + +D L  + +L+  P+ + +L +     
Sbjct: 62  LANQF-----QQILPLLDSPVLFEFGAGTGKLCIDTLTHLEQLQCLPESYFILEVSANLR 116

Query: 119 SERLTLIQKK--QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
             +  LIQ+K  QLA     I+W     + P     ++ANE  D++P+ +F+ +E  I E
Sbjct: 117 HRQQELIQQKIPQLAGL---IHWLDKWPETPFN-GVIIANEVLDAMPVYRFMQSETEILE 172

Query: 177 RMIDIDQHDSL--VFNIGDHE-----IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
             + +D+HD L  +F    ++     IK N L   DY    + E +   D  + + S  L
Sbjct: 173 SYVALDEHDQLAEIFKPVQNQRLLAYIK-NRLPPLDY--PYLTEANLFLDDWLLNCSHML 229

Query: 230 ACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLS 282
               G   +IDYG      Y   R   TL     H ++ +PL+NPG+ D++SHVDF  ++
Sbjct: 230 K--KGALFIIDYGFPRHEYYHPDRNQGTLMCHYQHYSHPNPLLNPGEQDITSHVDFTHVA 287

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMG 342
                   ++ G T Q  FL   G+     SL+  T   +  L   K+ +        MG
Sbjct: 288 EAGHQAGFHVAGYTNQASFLLANGL----LSLI-HTLDDEQELFVAKQAIKQLTQPSEMG 342

Query: 343 ELFKILVVS 351
           ELFK++ ++
Sbjct: 343 ELFKVIALT 351


>gi|39995584|ref|NP_951535.1| hypothetical protein GSU0476 [Geobacter sulfurreducens PCA]
 gi|39982347|gb|AAR33808.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298504603|gb|ADI83326.1| protein of unknown function DUF185 [Geobacter sulfurreducens KN400]
          Length = 386

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 99/368 (26%), Positives = 162/368 (44%), Gaps = 24/368 (6%)

Query: 1   MENKLIRKIVN--LIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQ 57
           +++  +R I++  + ++ G++    + A C+ +P  GYY S     GA GDF T+  + +
Sbjct: 4   IDDSRLRGIIHDRIKERGGRIPFADFMAACLYEPGLGYYTSPGRKVGAEGDFYTSINVHR 63

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           +FG ++   +   WE  G P+   LVE G G G +  D+L  + +L P+ ++ L++ +VE
Sbjct: 64  VFGRLIGREICRMWEVMGCPAPFTLVEAGAGHGRLAADVLDAVRELNPELYASLTLRLVE 123

Query: 118 TSERLTLIQKKQLASYGDKINWY--TSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGI 174
               L   Q++ LA + D++ W     L    L FT  L +NE  DS P     MT  G+
Sbjct: 124 AEPSLAEAQRQVLAEHLDRVAWNDPAELMGGTLTFTGCLYSNELIDSFPTHVVEMTPAGL 183

Query: 175 RERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL----- 229
           RE  +  D  D     +   ++ S     +DYF        P +  E+   + R      
Sbjct: 184 REVFVTADG-DGFAEQL---DLPST-PDLADYFRRIDVNLQPGQRTEINLNACRWLEGVA 238

Query: 230 -ACDGGTAIVIDYGYLQS------RVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDFQRL 281
              + G  + +DYG+L        R   TL     HT    P    G  D++SHVDF  L
Sbjct: 239 RCLERGFVLTVDYGFLSPELYGPMRQNGTLLCYFRHTIQEDPYQRVGHQDITSHVDFTTL 298

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSM 341
                   L+      Q +FL   G+ +   +L    A ++  +     L      +  M
Sbjct: 299 ILRGEELGLHKAWFGEQYRFLMAAGLMEELMALEAAAATEEERIKIRLVLKKLVLPEGGM 358

Query: 342 GELFKILV 349
           G+ FKILV
Sbjct: 359 GDTFKILV 366


>gi|322695717|gb|EFY87521.1| DUF185 domain-containing protein [Metarhizium acridum CQMa 102]
          Length = 460

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 88/171 (51%), Gaps = 27/171 (15%)

Query: 24  YFALCVADPEFGYYSTC-----NPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPS 78
           Y  +C+     GYY+       + FG  GDFVT+PEISQIFGE++ ++ I  W   G P 
Sbjct: 20  YMRMCLTGDLGGYYTGAIGQNRDQFGVKGDFVTSPEISQIFGELVGVWFIAEWISQGQPK 79

Query: 79  -CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLAS----- 132
             V+L+E+GPGRG +M D+LR I +      S+ S++MVE S  L   QK  L       
Sbjct: 80  QGVQLIEVGPGRGTLMDDMLRTIKRFPAMVDSIESVFMVEASPELREKQKTLLCGSDAPS 139

Query: 133 -------------YGDKINWYTSLADVPL---GFTFLVANEFFDSLPIKQF 167
                         G  + W  SL  +P+      F+VA+EFFD+LPI  F
Sbjct: 140 EDCAAGSRSTGKHLGKPVVWAESLKSIPIEPNKVPFIVAHEFFDALPIHCF 190



 Score = 62.8 bits (151), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 68/128 (53%), Gaps = 12/128 (9%)

Query: 234 GTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--LY 291
           G A+++DYG   +   ++L+ ++ H  VSP   PG  DLS+ VDF  ++  A L    + 
Sbjct: 320 GAALILDYGTSDTIPINSLRGIRHHKLVSPFSAPGLVDLSADVDFTAIAEAATLASDGVE 379

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMK------QTARKDILLDSVKRLVSTSADKKSMGELF 345
           ++G   Q  FLE +GI +RA  L+K       TA++  +  S KRLV        MG+++
Sbjct: 380 VHGPVPQADFLELMGIRERAEMLIKAAGTDESTAQR--IRKSWKRLVDRG--PSGMGKIY 435

Query: 346 KILVVSHE 353
           K L +  E
Sbjct: 436 KALAILPE 443


>gi|261752818|ref|ZP_05996527.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261742571|gb|EEY30497.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 155

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 85/154 (55%), Gaps = 7/154 (4%)

Query: 209 GAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPG 268
           GAIFE +P R   MQ I+ R+A   G A+ IDYG+L+S  GDTLQA+    Y     +PG
Sbjct: 6   GAIFEAAPARTALMQEIASRIAATRGAALNIDYGHLESGFGDTLQAMLKQAYDDVFAHPG 65

Query: 269 QADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL--MKQTARKDILLD 326
            ADL+SHVDF  L   A        G  TQG+FL  +G+  RA  L   K  A ++ +  
Sbjct: 66  VADLTSHVDFDILQKTAKACGCK-TGTMTQGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQ 124

Query: 327 SVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
            V+RL +       MG LFK+L  S E+  L+PF
Sbjct: 125 DVERLAAPD----QMGTLFKVLAFSDEQTRLLPF 154


>gi|237756343|ref|ZP_04584893.1| ATP synthase beta subunit/transription termination factor
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691494|gb|EEP60552.1| ATP synthase beta subunit/transription termination factor
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 384

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 104/360 (28%), Positives = 156/360 (43%), Gaps = 20/360 (5%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEM 62
           +LI  I   I++ G ++   +  + +  P  GYY S     G +GDF T+ E+   FG +
Sbjct: 8   ELINIIKQKIQQEGAISFKDFMEMALYYPNLGYYTSEKEKIGGLGDFYTSSELDPAFGNL 67

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           LA      +E +      ++VE+G G+G +  D+L  I    P+ + +L    VE S   
Sbjct: 68  LAKQFNEIYENYFKNQKFQIVEIGSGKGYLAYDVLSYIKNNYPNLYKILEFISVEKSPYH 127

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QKK L  + D I+++  L ++      + +NE FD+LP+         I E  I ++
Sbjct: 128 RDYQKKLLKDF-DNISFHEDLTEINNINGIIYSNELFDALPVHLIRKINGKIFEVYITLE 186

Query: 183 QHD-SLVFNIGDHEIKSNFLTCS-DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
             D   V      +I       + D   G   E +      +Q I ++L  + G    ID
Sbjct: 187 GDDIKEVLKEPQKDILQYLKDLNIDISEGMTTEINLYAKDLIQEIGNKL--EKGFVFTID 244

Query: 241 YGYLQS------RVGDTLQAVKGHTYVSPLV-NPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY         R+  TL     HTY      N G  D++SHV+F  L       KLY  
Sbjct: 245 YGYPSKELYKPYRMRGTLLCYYKHTYNENFYQNVGLQDITSHVNFSALVYYGKKSKLYFL 304

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRL--VSTSADKKSMGELFKILVVS 351
           G T Q  FL  LG+      L ++   K     S +RL  + T    K MGE FKIL+ S
Sbjct: 305 GFTDQAHFLISLGLMDIFQELQEKGDYK-----SYERLNRLKTLILPKGMGEKFKILIQS 359


>gi|282896985|ref|ZP_06304987.1| Protein of unknown function DUF185 [Raphidiopsis brookii D9]
 gi|281197637|gb|EFA72531.1| Protein of unknown function DUF185 [Raphidiopsis brookii D9]
          Length = 402

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 102/369 (27%), Positives = 164/369 (44%), Gaps = 43/369 (11%)

Query: 5   LIRKIVNLIKKNGQ--MTVDQYFALCVADPEFGYYST--CNPFGAVGDFVTAPEISQIFG 60
           L + I + I+ + Q  +T  +Y  L +   E+GYYS+  C       DF T+P +S+ FG
Sbjct: 3   LAQIITDCIQSSEQKRITFAEYMDLVLYHREYGYYSSHSCQIGFEGSDFFTSPSLSEDFG 62

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSE 120
           E+LA   +  WE    P   +LVE+G G+G++   IL  +    PDFF ++   +VE S 
Sbjct: 63  ELLAEQFLQMWENLDRPRPFQLVEMGAGKGVLAAQILTYLKSHHPDFFEIIEYIIVEKSP 122

Query: 121 RLTLIQKKQLASYGDKINWYTSLADVPLGFTF--LVANEFFDSLPIKQFVMTEHGIRERM 178
           +L   Q+++L  +   I W   L ++  G       +NE  D+ P+ QF++    ++E  
Sbjct: 123 QLRGEQQQRLEIF--SIQW-LDLQELHPGSIIGCFFSNELVDAFPVHQFILQNGKLQEIY 179

Query: 179 IDI--------DQHDSLVFNIGDHEI-----KSNFLTCSDYFLGAIFENSP-CRDREMQS 224
           +           QH S   +I   E      + +     +Y      + SP     + +S
Sbjct: 180 VTFRTAPPNLKTQHSSQSLDIEILEFIEVIGEPSTPKLEEYLQLVGIDLSPNVYPEDYRS 239

Query: 225 ISDRLACDG----------GTAIVIDYGYLQSRV------GDTLQAVKGHTYV-SPLVNP 267
             +  A D           G  + IDYGY  +R         TLQ    H Y  +P +  
Sbjct: 240 EINLAALDWLSIVANCLQRGYVLTIDYGYPATRYYHPRRSQGTLQCYYQHRYHDNPYIKV 299

Query: 268 GQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILL-- 325
           G+ D+++HVDF  L +      L   G T QG FL  LG+  R  +L  Q      LL  
Sbjct: 300 GEQDITTHVDFTALENWGKKCGLNPVGWTQQGLFLMALGLGDRIAALSYQQQSVSQLLKR 359

Query: 326 -DSVKRLVS 333
            +++ +L+S
Sbjct: 360 REALHQLIS 368


>gi|165918264|ref|ZP_02218350.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|165918124|gb|EDR36728.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
          Length = 388

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 162/373 (43%), Gaps = 61/373 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           IV  I +NG +T  +Y  L +  P  GYYS     FGA GDFVTAPEIS +F +      
Sbjct: 24  IVREIAENGPLTFARYMQLALYAPGLGYYSAGSRKFGAAGDFVTAPEISSLFSQ------ 77

Query: 68  ICAWEQHGFPSCVRLV---------ELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
            C   Q     C +++         ELG G G M  DILR +      P  + +L I   
Sbjct: 78  -CVARQ-----CQQILIDLNGGDILELGAGSGRMAADILRELQHTGCLPHNYFILEI-SA 130

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           +  +R     K ++     ++ W   L   P     ++ NE  D++P+ +F + ++GI+E
Sbjct: 131 DLRDRQEKFIKNEIPELSHRVKWLNRLPS-PHFKGVILGNEVIDAMPVHKFKI-DNGIKE 188

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ--------SISDR 228
             ++  +++  V+ IG+          SDY            + E+         S++D 
Sbjct: 189 VYVNW-KNEQFVWEIGEPSA-----ALSDYIKNLTIHFPEGYESEVNLLLKGWIASLADI 242

Query: 229 LACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           L    G  ++IDYG+ +          G      + H++  PL+  G  D+++HVDF  +
Sbjct: 243 L--QEGLILLIDYGFPRHEYYHTDRDRGTIACHYRHHSHFDPLILTGIQDITAHVDFTAI 300

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVSTSADK 338
           +  A    L + G T Q  FL   GI     +LM Q    A    +   +K+L       
Sbjct: 301 AEAAAKQGLAVEGFTHQAGFLLNCGI----ATLMPQVEDVAEHYRIAQEIKKLTLPG--- 353

Query: 339 KSMGELFKILVVS 351
             MGELFK + ++
Sbjct: 354 -EMGELFKAIALT 365


>gi|215919266|ref|NP_820807.2| hypothetical protein CBU_1828 [Coxiella burnetii RSA 493]
 gi|206584150|gb|AAO91321.2| hypothetical protein CBU_1828 [Coxiella burnetii RSA 493]
          Length = 417

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 162/373 (43%), Gaps = 61/373 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           IV  I +NG +T  +Y  L +  P  GYYS     FGA GDFVTAPEIS +F +      
Sbjct: 53  IVREIAENGPLTFARYMQLALYAPGLGYYSAGSRKFGAAGDFVTAPEISSLFSQ------ 106

Query: 68  ICAWEQHGFPSCVRLV---------ELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
            C   Q     C +++         ELG G G M  DILR +      P  + +L I   
Sbjct: 107 -CVARQ-----CQQILIDLNGGDILELGAGSGRMAADILRELQHTGCLPHNYFILEI-SA 159

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           +  +R     K ++     ++ W   L   P     ++ NE  D++P+ +F + ++GI+E
Sbjct: 160 DLRDRQEKFIKNEIPELSHRVKWLNRLPS-PHFKGVILGNEVIDAMPVHKFKI-DNGIKE 217

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ--------SISDR 228
             ++  +++  V+ IG+          SDY            + E+         S++D 
Sbjct: 218 VYVNW-KNEQFVWEIGEPSA-----ALSDYIKNLTIHFPEGYESEVNLLLKGWIASLADI 271

Query: 229 LACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           L    G  ++IDYG+ +          G      + H++  PL+  G  D+++HVDF  +
Sbjct: 272 L--QEGLILLIDYGFPRHEYYHTDRDRGTIACHYRHHSHFDPLILTGIQDITAHVDFTAI 329

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVSTSADK 338
           +  A    L + G T Q  FL   GI     +LM Q    A    +   +K+L       
Sbjct: 330 AEAAAKQGLAVEGFTHQAGFLLNCGI----ATLMPQVEDVAEHYRIAQEIKKLTLPG--- 382

Query: 339 KSMGELFKILVVS 351
             MGELFK + ++
Sbjct: 383 -EMGELFKAIALT 394


>gi|254702247|ref|ZP_05164075.1| hypothetical protein Bsuib55_15506 [Brucella suis bv. 5 str. 513]
          Length = 173

 Score =  106 bits (264), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 85/154 (55%), Gaps = 7/154 (4%)

Query: 209 GAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPG 268
           GAIFE +P R   MQ I+ R+A   G A+ IDYG+L+S  GDTLQA+    Y     +PG
Sbjct: 24  GAIFEAAPARTALMQEIASRIAATRGAALNIDYGHLESGFGDTLQAMLKQAYDDVFAHPG 83

Query: 269 QADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL--MKQTARKDILLD 326
            ADL+SHVDF  L   A        G  TQG+FL  +G+  RA  L   K  A ++ +  
Sbjct: 84  VADLTSHVDFDILQKTAKACGCK-TGTMTQGEFLLAMGLVDRAGRLGAGKDAAFQEKIRQ 142

Query: 327 SVKRLVSTSADKKSMGELFKILVVSHEKVELMPF 360
            V+RL +       MG LFK+L  S E+  L+PF
Sbjct: 143 DVERLAAPD----QMGTLFKVLAFSDEQTRLLPF 172


>gi|212211857|ref|YP_002302793.1| hypothetical protein CbuG_0201 [Coxiella burnetii CbuG_Q212]
 gi|212010267|gb|ACJ17648.1| hypothetical protein CbuG_0201 [Coxiella burnetii CbuG_Q212]
          Length = 417

 Score =  106 bits (264), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 162/373 (43%), Gaps = 61/373 (16%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           IV  I +NG +T  +Y  L +  P  GYYS     FGA GDFVTAPEIS +F +      
Sbjct: 53  IVREIAENGPLTFARYMQLALYAPGLGYYSAGSRKFGAAGDFVTAPEISSLFSQ------ 106

Query: 68  ICAWEQHGFPSCVRLV---------ELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMV 116
            C   Q     C +++         ELG G G M  DILR +      P  + +L I   
Sbjct: 107 -CVARQ-----CQQILIDLNGGDILELGAGSGRMAADILRELQHTGCLPHNYFILEI-SA 159

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           +  +R     K ++     ++ W   L   P     ++ NE  D++P+ +F + ++GI+E
Sbjct: 160 DLRDRQEKFIKNEIPELSHRVKWLNRLPS-PHFKGVILGNEVIDAMPVHKFKI-DNGIKE 217

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ--------SISDR 228
             ++  +++  V+ IG+          SDY            + E+         S++D 
Sbjct: 218 VYVNW-KNEQFVWEIGEPSA-----ALSDYIKNLTIHFPEGYESEVNLLLKGWIASLADI 271

Query: 229 LACDGGTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           L    G  ++IDYG+ +          G      + H++  PL+  G  D+++HVDF  +
Sbjct: 272 L--QEGLILLIDYGFPRHEYYHTDRDRGTIACHYRHHSHFDPLILTGIQDITAHVDFTAI 329

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ---TARKDILLDSVKRLVSTSADK 338
           +  A    L + G T Q  FL   GI     +LM Q    A    +   +K+L       
Sbjct: 330 AEAAAKQGLAVEGFTHQAGFLLNCGI----ATLMPQVEDVAEHYRIAQEIKKLTLPG--- 382

Query: 339 KSMGELFKILVVS 351
             MGELFK + ++
Sbjct: 383 -EMGELFKAIALT 394


>gi|171687044|ref|XP_001908463.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943483|emb|CAP69136.1| unnamed protein product [Podospora anserina S mat+]
          Length = 529

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 95/192 (49%), Gaps = 27/192 (14%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-----NPFGAVGDFVTAPEISQ 57
             L +++   I+  G + +  +  +C+     GYY+       + FG  GDFVT+PEISQ
Sbjct: 70  TPLAKQLAAAIELTGPIPLASFMRMCLTSDIGGYYTGAIEKDRDQFGLKGDFVTSPEISQ 129

Query: 58  IFGEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV 116
           +FGE++ ++ +  W   G  S  V L+E+GPGRG +M D+LR I        S+ +IYMV
Sbjct: 130 VFGELIGVWFLTEWLAQGRQSRGVELIEVGPGRGTLMDDVLRTIQSFPAMANSIDAIYMV 189

Query: 117 ETSERLTLIQKKQLASYGDKIN------------------WYTSLADVPLG---FTFLVA 155
           E S  L + QK  L      +                   W  ++  +P+      F+VA
Sbjct: 190 EASPELRMAQKNLLCGEDAPMTESKVGYHSVCKYNALPIVWTETIKSIPIAPQKMPFIVA 249

Query: 156 NEFFDSLPIKQF 167
           +EFFD+LPI  F
Sbjct: 250 HEFFDALPIHAF 261



 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (51%), Gaps = 8/126 (6%)

Query: 234 GTAIVIDYGYLQSRVG-DTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK--L 290
           G A+++DYG     +  ++L+ ++ H  VSP   PG  DLS  VDF  ++  A      +
Sbjct: 390 GAALILDYGPGDGTIPTNSLRGIRKHRRVSPFAEPGLTDLSVDVDFAGIAESATRASEGV 449

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKD---ILLDSVKRLVSTSADKKSMGELFKI 347
            ++G   QG FLE +GI +RA  L K+   ++    +  + +RLV        MG++++ 
Sbjct: 450 EVHGPVAQGDFLELMGIRERAEVLAKRAGEEEKGRAVEKAWRRLVDRGPG--GMGKVYQA 507

Query: 348 LVVSHE 353
           L +  E
Sbjct: 508 LAIVPE 513


>gi|75909412|ref|YP_323708.1| hypothetical protein Ava_3205 [Anabaena variabilis ATCC 29413]
 gi|75703137|gb|ABA22813.1| Protein of unknown function DUF185 [Anabaena variabilis ATCC 29413]
          Length = 404

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 96/350 (27%), Positives = 151/350 (43%), Gaps = 39/350 (11%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYS--TCNPFGAVGDFVTAPEISQI 58
           ++  +  +I N      ++T  +Y  + +  PE+GYYS  T       GDF T+  +   
Sbjct: 7   LQTAITHRIAN--SPEARITFAEYMDMALYHPEYGYYSSNTVKIGFKGGDFFTSVNLGAD 64

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
            G++LA   +  WE  G P+   LVE+G G+G++ L IL+ I    P+ F+ L   +VE 
Sbjct: 65  LGDLLAEQFVQMWEILGKPTPFYLVEMGAGQGLLALHILKYIQVKYPNLFTALQYLIVEK 124

Query: 119 SERLTLIQKKQLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRER 177
           S  L   Q+++L  +   + W +     P   T    +NE  D+LP+ QF++    +RE 
Sbjct: 125 SPGLKQEQQERLQGF--SVRWCSWEEISPNSITGCFFSNELVDALPVHQFILEGGELREI 182

Query: 178 MIDIDQHD----------SLVFNIGDHEIKSNFLTCSDYF--LGAIFENSPCRDREMQSI 225
            + +              S  + + +     +    ++YF  +G         D     I
Sbjct: 183 YLTVQGEKEAQEAKNLSPSPNYELTEVAAAPSTPRLAEYFDLVGINLAQGGYEDGYRSEI 242

Query: 226 -----------SDRLACDGGTAIVIDYGYLQSRVGD------TLQAVKGHT-YVSPLVNP 267
                      +DRL    G  I IDYGY  SR  +      TLQ    H  + +P +N 
Sbjct: 243 NLAALDWLSIVADRL--QRGYVITIDYGYPASRYYNPRRSQGTLQCYYQHRHHNNPYINI 300

Query: 268 GQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
           GQ D+++HVDF  L        L   G T Q  FL  LG+  R  +L  Q
Sbjct: 301 GQQDITAHVDFTALERWGDRCGLEKLGFTQQALFLMALGLGDRIAALSYQ 350


>gi|307611736|emb|CBX01441.1| hypothetical protein LPW_31301 [Legionella pneumophila 130b]
          Length = 370

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 101/369 (27%), Positives = 171/369 (46%), Gaps = 40/369 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEM 62
            L + ++N +K   ++    +    +  P  GYY++     G  GDF+TAPE++ ++G+ 
Sbjct: 2   NLKQTLINQLKLQKEIPFIDFMQQALYAPYEGYYTSGLQKLGKHGDFITAPELTSLYGKT 61

Query: 63  LAIFLICAWEQHGFP--SCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVET 118
           LA        Q   P      L E G G G + +D L  + +L+  P+ + +L +     
Sbjct: 62  LANQF-----QQILPLLDSPVLFEFGAGTGKLCIDTLTHLEQLQCLPESYFILEVSANLR 116

Query: 119 SERLTLIQKK--QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
             +  LIQ+K  QLA     I+W     + P     ++ANE  D++P+ +F+ +E  I E
Sbjct: 117 HRQQELIQQKIPQLAGL---IHWLDKWPEAPFN-GVIIANEVLDAMPVYRFMQSEIEILE 172

Query: 177 RMIDIDQHDSL--VFNIGDHE-----IKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
             + +D+HD L  +F    ++     IK N L   DY    + E +   D  + + S  L
Sbjct: 173 SYVTLDEHDQLAEIFKPVQNQRLLAYIK-NRLPPLDY--PYLTEANLFLDDWLLNCSHML 229

Query: 230 ACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLS 282
               G   +IDYG      Y   R   TL     H ++ +PL+NPG+ D+++HVDF  ++
Sbjct: 230 K--KGALFIIDYGFPRHEYYHPDRNQGTLMCHYQHYSHPNPLLNPGEQDITAHVDFTHVA 287

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMG 342
                   +I G T Q  FL   G+     +L    A++   L + K+ +        MG
Sbjct: 288 EAGHQAGFHIAGYTNQASFLLANGLLSLIHTL--DDAQE---LFAAKQAIKQLTQPSEMG 342

Query: 343 ELFKILVVS 351
           ELFK++ ++
Sbjct: 343 ELFKVIALT 351


>gi|317401374|gb|EFV82009.1| hypothetical protein HMPREF0005_01017 [Achromobacter xylosoxidans
           C54]
          Length = 393

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 92/355 (25%), Positives = 158/355 (44%), Gaps = 32/355 (9%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCN-------PFGAVGDFVTAPEISQIFGEMLAIFLI 68
           +G +  D + A  +  P  GYY+  N            GDFVTAP+++ +F   LA  + 
Sbjct: 35  SGWLPFDHWMAEALYAPGLGYYAAGNVKLAEADARAPAGDFVTAPQLTPLFARTLARQVA 94

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
               Q        ++E G G G +   +LR   +L           ++E S  L   Q +
Sbjct: 95  QVLRQT---DTQTVLEFGAGTGALAEGVLR---ELDAQGLQETQYLILEISADLRARQAE 148

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI-RERMIDIDQHDSL 187
           +LA +G+++ W  +L +   G   ++ANE  D++P+  F  ++ G+  ER + +D     
Sbjct: 149 RLAPFGERVRWLDALPERFRGC--VLANEVLDAMPVSLFRWSDDGVVLERGVTLDPAQGF 206

Query: 188 VFN--IGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ 245
           V+        +            G + E +   +  +  +S  L  + G A+++DYG+ Q
Sbjct: 207 VWEDRPAPRRLAEAVAARMPALPGYVSEINLQAEAWIDGMSGWL--EQGAALLVDYGFPQ 264

Query: 246 S------RVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
                  R G TL   ++ H +  P   PG  D+++HVDF  ++  A    L + G T+Q
Sbjct: 265 GEYYHPQRAGGTLMCHLRHHAHGDPFTAPGLQDITAHVDFTAMADAAQAAGLQVLGYTSQ 324

Query: 299 GKFLEGLGIWQRAFSLMKQTARK-DILLDSVKRLVSTSADKKSMGELFKILVVSH 352
            +FL   G+ +    L    AR     +  V++L+S    +  MGELFK+L V  
Sbjct: 325 ARFLMNAGLMELLAQLDPTDARTYAQAVAPVQKLLS----EAEMGELFKVLAVGR 375


>gi|58700280|ref|ZP_00374748.1| Uncharacterized ACR, COG1565 superfamily [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58533203|gb|EAL57734.1| Uncharacterized ACR, COG1565 superfamily [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 243

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 128/251 (50%), Gaps = 24/251 (9%)

Query: 113 IYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEH 172
           I++VE S  L  IQK++L S    +NW+ ++ ++P   T  +ANEFFD+LPI QFV  + 
Sbjct: 3   IHLVEISPTLRKIQKEKLKSLD--VNWHKNIDNLPEQPTIFLANEFFDALPIDQFVYHDE 60

Query: 173 GIRERMIDIDQHDSLVFNIGDHEIKS-----------NFLTCSDYFLGAIFENSPCRDRE 221
           G  E M+      SL+ +     ++S             +T   +F GA+ E        
Sbjct: 61  GWYENMVTKQDDGSLLVSCQCVTLESRKKESWIPVSATQMTNGKFFNGAVVEICSVGVEI 120

Query: 222 MQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRL 281
           ++ +  ++  + G A+++DYGY+      TLQ++K H Y + L N G +D+++ V+FQ L
Sbjct: 121 LKKLEKKIYNNKGAALIVDYGYVYPAYKSTLQSIKQHKYANFLENVGNSDITALVNFQAL 180

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--RKDILLDSVKRLVSTSADKK 339
                  K     + TQ +FL   GI +R  +LMK  +  +K+ +     RL       +
Sbjct: 181 RDS---LKHVDCEILTQREFLYLFGIKERTQALMKSASDEQKNRIFSEFLRLT------E 231

Query: 340 SMGELFKILVV 350
           +MG LFK +++
Sbjct: 232 NMGTLFKAMLL 242


>gi|269839615|ref|YP_003324307.1| hypothetical protein Tter_2597 [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791345|gb|ACZ43485.1| protein of unknown function DUF185 [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 384

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 157/361 (43%), Gaps = 22/361 (6%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEM 62
           +L+R I   I + G++T +++  L +  P  GYYS   P  G  GD+ T+ ++S +FG  
Sbjct: 13  QLLRIIRREIAERGRITFERFMDLALYHPAHGYYSAGGPRIGPEGDYYTSTDVSPLFGAT 72

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           L   ++  WE  G P    +VE G G+G++  D+L       P+F+  +   +VE S   
Sbjct: 73  LGRQVVEMWELLGRPDPFHVVEHGAGKGLLAADLLGWAGAAHPEFYRAVRYLIVEVSPAA 132

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLV--ANEFFDSLPIKQFVMTEHGIRERMID 180
              Q++ L  +   ++W    AD+       V  +NE  D+LP  +  MT  GI E  + 
Sbjct: 133 RERQREHL--WRLPVSWADD-ADLEEDSIIGVCLSNELADALPFHRIRMTGAGIDELWV- 188

Query: 181 IDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSI--SDRL--ACDGGTA 236
           +D  D L   +   E     L       G         +  +++I  + R+  +   G  
Sbjct: 189 VD--DGLALGLAPGEPSDRRLEAYVERWGRALRPGQQAEANLRAIDWARRVVRSLRRGFF 246

Query: 237 IVIDYGYLQSRV------GDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRLSSIAILYK 289
           + IDYG     V        TL     HT    PL   G+ D+++HV+F  L+       
Sbjct: 247 LTIDYGGRAEEVHGPDHPDGTLTCYYRHTQNRDPLRRVGEQDITAHVNFSALAETVREAG 306

Query: 290 LYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILV 349
             + G TTQG FL  LGI + A     + A+     + V+  V        +G  FK+LV
Sbjct: 307 GEVTGYTTQGYFLAALGIGE-AVEWALRRAKSTREFEQVRAQVEELVRPDGLGG-FKVLV 364

Query: 350 V 350
            
Sbjct: 365 A 365


>gi|56750467|ref|YP_171168.1| hypothetical protein syc0458_c [Synechococcus elongatus PCC 6301]
 gi|81299900|ref|YP_400108.1| hypothetical protein Synpcc7942_1091 [Synechococcus elongatus PCC
           7942]
 gi|56685426|dbj|BAD78648.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81168781|gb|ABB57121.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 387

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 93/347 (26%), Positives = 151/347 (43%), Gaps = 33/347 (9%)

Query: 1   MENKLIRKIVNLIKKNGQ--MTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQ 57
           M   +  +++  ++   Q  +T+ Q+ +  + DPE GYYS+    FG  GDFVT+P +S 
Sbjct: 1   MTQAIPDRLLEWLESQPQRRLTMAQFMSWALYDPESGYYSSRTGQFGDRGDFVTSPSLSA 60

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
            F E+LA+     W+  G P     VE+G G G    D L  I     +  + L   ++E
Sbjct: 61  DFAELLAVQAAEFWQVLGRPDRFVWVEMGAGAGQFAGDFLAAIAGT--ELEATLHYRIIE 118

Query: 118 TSERLTLIQKKQLASYGDKINWYT--SLADVP-LGFTFLVANEFFDSLPIKQ-------- 166
            S +L   Q+++L  + D+++W+T    A  P +G  F  +NE  D+LP+ +        
Sbjct: 119 RSPQLRRQQQERLEPWRDRVDWWTWEDWATQPTVGVAF--SNELVDALPVHRIQWQGGEW 176

Query: 167 ---FVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQ 223
              +V    G+ + ++       LV    D  + +      +   G   E  P   + + 
Sbjct: 177 QEIYVTENAGVLQEVLGPLSSPDLVDVFADLGLAAAIARLPE---GYRTEVHPAAKQWLA 233

Query: 224 SISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGHTYVSPL-VNPGQADLSSHV 276
            +   L    G  + IDYG      Y   R   TLQA     + + L   PGQ DL++HV
Sbjct: 234 QVVQGLQR--GYLLTIDYGYSGDRYYAAGRTDGTLQAYWQQRFHNDLYARPGQQDLTAHV 291

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI 323
           +F  L        L     T Q  FL  LG+  R  +L +  +  D+
Sbjct: 292 NFSALEVWGEALGLKRLAFTEQALFLMALGLGDRLMALSQPQSGSDL 338


>gi|219127089|ref|XP_002183776.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405013|gb|EEC44958.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 349

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 100/359 (27%), Positives = 157/359 (43%), Gaps = 81/359 (22%)

Query: 41  NPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQH---------GFPSCVRLVELGPGRGI 91
           N  G  GDFVTAPE+SQ+FGE L I+    ++QH         G     + +E GPG+G 
Sbjct: 1   NIIGPQGDFVTAPEMSQVFGECLGIWF---YDQHKKLQKAKADGKRLDWQWLECGPGKGT 57

Query: 92  MMLDILRVIC--KLKPDFFSVLS-IYMVETSERLTLIQKKQLA----------------- 131
           ++ D+LR  C  K++ +F +    +++VE+S  L  +QK+ L                  
Sbjct: 58  LVSDLLRFACYGKIRHEFGATCKHVHLVESSPILRQVQKETLQRDLRDVAELEFVEESGI 117

Query: 132 -----SYGDKINWYTSLADVPLG--------FTFLVANEFFDSLPIKQFVMTEHGI-RER 177
                    +++W+ S A              T+ V  EF D+LP  QF  T  G  RER
Sbjct: 118 PENRNPNAVQVHWHDSFASFRAWQKQSTSRLTTYAVGQEFLDALPTYQFEKTADGTWRER 177

Query: 178 MIDID-QH---------------------DSLVFNIGDHEI--KSNFLTCSDYFLGAIFE 213
           +ID+  +H                      +L+   GD  +  + NF        G++ E
Sbjct: 178 LIDVALKHLPNAKKPRLRIVLAPLVTVPLKTLLQVDGDGRMLNEPNFAQT-----GSVVE 232

Query: 214 NSPCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLS 273
            SP     ++ ++  +   GG A+ IDYG  Q    DT++A   H  V  L  PGQ DL+
Sbjct: 233 VSPEAILLVKDVATLVDEQGGAALFIDYG--QEGSADTIRAFAKHEQVHFLSRPGQVDLT 290

Query: 274 SHVDFQRL----SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSV 328
           + VDF  L    +++   ++    G   QG FL  +G   R   L+++ +  D   D +
Sbjct: 291 ADVDFSALKHAVNALQTRHQTRAFGPVGQGHFLMSMGASDRVLQLIERDSTTDKEADDL 349


>gi|293602449|ref|ZP_06684895.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292819211|gb|EFF78246.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 402

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/366 (25%), Positives = 161/366 (43%), Gaps = 42/366 (11%)

Query: 15  KNGQMTVDQYFALCVADPEFGYYSTCN---------PFGAVGDFVTAPEISQIFGEMLAI 65
             G +  D + A  +  P  GYY+  N              GDFVTAP+++ +F   +A 
Sbjct: 41  NGGWLPFDHWMAQALYAPGLGYYAAGNVKLADADDDAKAPAGDFVTAPQLTPLFARTIAR 100

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLI 125
                  Q        ++E G G G +   +LR +  L     +     ++E S  L   
Sbjct: 101 QAAQVLRQT---QTHAVLEFGAGTGALAEGVLRELDALG---LTDTQYLILEVSADLRAR 154

Query: 126 QKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHG-IRERMIDIDQH 184
           Q ++LA++G ++ W  +L +   G   ++ANE  D++P+  F  +E G + ER + +D  
Sbjct: 155 QAERLAAFGARVQWLDALPNAFAGC--VLANEVLDAMPVSLFCWSEDGTVMERGVSLDAQ 212

Query: 185 DSLVFN--IGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG 242
              V++       +            G + E +   +  + ++   L  + G A+++DYG
Sbjct: 213 QDFVWSDRPAPPALAQAVAARMPALPGYVSEINLQGEAWIAAMGSWL--ERGAALLVDYG 270

Query: 243 ------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGL 295
                 Y   R G TL   ++ H +  PL  PG  D+++HVDF  ++  A+   L + G 
Sbjct: 271 FPRNEYYHPQRAGGTLMCHLRHHAHGDPLTAPGLQDITAHVDFTAMADAALEAGLQVLGY 330

Query: 296 TTQGKFLEGLGIWQRAFSLMKQTARKDI-----LLDSVKRLVSTSADKKSMGELFKILVV 350
           T+Q +FL   G+      L+ Q    D+      +  V++L+S    +  MGELFK+L V
Sbjct: 331 TSQARFLMNAGL----MDLLAQLDPSDVQQYAQAVAPVQKLLS----EAEMGELFKVLAV 382

Query: 351 SHEKVE 356
                E
Sbjct: 383 GRAMTE 388


>gi|149238706|ref|XP_001525229.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146450722|gb|EDK44978.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 612

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 97/212 (45%), Gaps = 44/212 (20%)

Query: 13  IKKNGQMTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQIFGEMLAIFLICAW 71
           I+  G + +  Y   C+  P+FGYY+T +P     GDF+T+PEIS +FGEM+ I+    W
Sbjct: 146 IRLTGPIPLSAYMRQCLTHPDFGYYTTRDPLNLKTGDFITSPEISSVFGEMIGIWFFNIW 205

Query: 72  EQ---HGFPSCVRLVELGPGRGIMMLDILRVICKL---KPDFFSVLSIYMVETSERLTLI 125
           +       P  +R +E GPG+G ++ D+L    K      D    + I M+E S  L   
Sbjct: 206 QTSKGKTPPKNIRFIEFGPGKGTLIHDVLHTFNKFVTTVSDIKPKIEIVMIEASPFLRKE 265

Query: 126 QKKQL------------------ASYGDKINWYTSLADVPLG------------------ 149
           Q+  L                    +G+ I W  +   +P G                  
Sbjct: 266 QQNLLCDTTKEFKKNDAGFDTSVTKWGNDIIWVDTEKSIPKGGSGKDGNGNNINAEDDNR 325

Query: 150 -FTFLVANEFFDSLPIKQFVMTEHGIRERMID 180
              +++A+EFFD+LPIK F+  E G RE +++
Sbjct: 326 LVNYIIAHEFFDALPIKSFIRQEDGWRELVVE 357



 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 232 DGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIA-ILYKL 290
           D G A+V+DYG       +TL+ +  H +VSP   PG+ DLS  VDFQ L ++   +  +
Sbjct: 484 DEGAALVVDYGPSSEIPENTLRGIYQHKFVSPFYKPGEVDLSVDVDFQNLKNLTEAVCNV 543

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
           Y  G   QG +L  +GI  R   L+K+ A  + + D +        D   MG+++K + +
Sbjct: 544 Y--GPIQQGDWLHNIGIGYRVDQLLKKNANDEEMQDKIYGAYRRLVDDDQMGKVYKFMAL 601


>gi|113866288|ref|YP_724777.1| hypothetical protein H16_A0257 [Ralstonia eutropha H16]
 gi|113525064|emb|CAJ91409.1| uncharacterized conserved protein [Ralstonia eutropha H16]
          Length = 399

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 165/378 (43%), Gaps = 74/378 (19%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNP-FGAVG----DFVTAPEISQIFGEMLAIFLICA 70
            G +  D+Y AL +  P  GYYS  +  FG       DF+TAPE+S  F   LA      
Sbjct: 33  GGWIGFDRYMALALYAPGLGYYSGGSAKFGRDARDGSDFITAPELSPFFARTLARQFAPL 92

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKK 128
             Q G P   R++E G G G +  D+L  + +    PD +++     VE S  L   Q+ 
Sbjct: 93  MAQ-GLP---RMLEFGAGTGRLAADLLLGLEQEGQLPDTYAI-----VELSGELRARQQA 143

Query: 129 QLAS----YGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRER------ 177
            LA       D++ W  +L   P  F   +V NE  D++P++ +  +     ER      
Sbjct: 144 TLAQRAPHLADRVTWLDTL---PASFEGVIVGNEVLDAMPVQLYARSGGRWHERGVVHSV 200

Query: 178 ----------------MIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
                           + D D  ++L    GDH++ +     ++ F+           R 
Sbjct: 201 ARSDDAAPAFRFEDRPLADADMPEALRAIPGDHDLVTETHAEAEGFI-----------RA 249

Query: 222 MQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSS 274
           + ++  R     G A  IDYG      Y   R G TL    + H +  P + PG  D+++
Sbjct: 250 VGAMLAR-----GAAFFIDYGFPAGEYYHPQRAGGTLMCHYRHHAHPDPFLYPGLQDITA 304

Query: 275 HVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVS 333
           HV+F  ++  A+   L + G  +Q +FL   GI +   +L    AR  +   ++V++L+S
Sbjct: 305 HVNFSGIALAAVDAGLTVAGFASQARFLMNAGITELLMALDPSDARAFLPQANAVQKLLS 364

Query: 334 TSADKKSMGELFKILVVS 351
               +  MGELFK++ ++
Sbjct: 365 ----EAEMGELFKVIALT 378


>gi|170734330|ref|YP_001766277.1| hypothetical protein Bcenmc03_2997 [Burkholderia cenocepacia MC0-3]
 gi|169817572|gb|ACA92155.1| protein of unknown function DUF185 [Burkholderia cenocepacia MC0-3]
          Length = 396

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 161/360 (44%), Gaps = 33/360 (9%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGD----FVTAPEISQIFGEMLAI 65
            +    G ++ D++    +  P  GYYS     FG   D    FVTAPE+S +F + LA 
Sbjct: 32  EIAAAGGWLSFDRFMERALYAPGLGYYSGGARKFGRRADDGSDFVTAPELSPLFAQTLAQ 91

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV-ETSERLTL 124
            +  A    G     R++E G G G +   +L  +  L  +    L + +  E  ER   
Sbjct: 92  PVAEALAASG---TRRVMEFGAGTGKLAAGLLATLDALGAELDEYLIVDLSGELRERQRD 148

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
             +  + +   K+ W  +L +   G   +V NE  D++P++ F   +   RER + +D  
Sbjct: 149 TIEAAVPALAAKVRWLDALPERFDGV--VVGNEVLDAMPVRLFAKVDGAWRERGVALDAR 206

Query: 185 DSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
            + VF+   +G   + +    L   D ++    E +    R + ++  R     G A++I
Sbjct: 207 HAFVFDDRPVGAAGLPAVLAPLDVGDGYVTETHEAALAFTRTVCTMLGR-----GAALLI 261

Query: 240 DYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYI 292
           DYG+        Q   G  +   + H +  P V PG  DL++HV+F  +   A+   + +
Sbjct: 262 DYGFPAHEYYHPQRDRGTLMCHYRHHAHDDPFVYPGLQDLTAHVEFTGIYEAAVATGVDL 321

Query: 293 NGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVSTSADKKSMGELFKILVVS 351
            G T+Q +FL   GI     ++     R  +   ++V++L+S    +  MGELFK++  S
Sbjct: 322 LGYTSQARFLLNAGITDALAAIDPSDIRAFLPAANAVQKLIS----EAEMGELFKVIAFS 377


>gi|126658233|ref|ZP_01729383.1| hypothetical protein CY0110_12577 [Cyanothece sp. CCY0110]
 gi|126620382|gb|EAZ91101.1| hypothetical protein CY0110_12577 [Cyanothece sp. CCY0110]
          Length = 378

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 100/357 (28%), Positives = 155/357 (43%), Gaps = 51/357 (14%)

Query: 5   LIRKIVNLIKK--NGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGE 61
           +++ I++ IK   N ++T   Y  L +   + GYYS+     G+ GDF TA  +   FGE
Sbjct: 1   MLKIIIDTIKNSPNQRITFADYMDLVLYHTQHGYYSSGKVNIGSEGDFFTASSLGSDFGE 60

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +LA       +         L+E+G G G +  DIL  + +   D +      ++E S+ 
Sbjct: 61  LLAEQFKEMSQLLNCSDSFTLIEVGAGTGNLAADILNYLKEKYSDCYDQFDYIIIEESQE 120

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTF--LVANEFFDSLPIKQFVMTEHGIRERMI 179
           L   QK +L  + DKI W  S  D+P       + +NE  D+ P+ Q +     ++E  +
Sbjct: 121 LIKEQKNKLEKF-DKITW-KSWEDIPNNSINGCIFSNELIDAFPVHQVIKKNKQLKEIYV 178

Query: 180 DIDQHDSLVFNIGDHEIKSNFLTCS-----DYF----LGAIFENSPCRDRE--------- 221
             +          D ++K      S     DYF    +    +N P   R          
Sbjct: 179 TWE----------DEQLKEKLEDISTPKLLDYFELIHIDITKDNYPENYRTEVNLKALDW 228

Query: 222 MQSISDRLACDGGTAIVIDYGYLQS------RVGDTLQAVKGHTYV-SPLVNPGQADLSS 274
           ++++S +L  + G  + IDYGY  S      R   TL     H +  +P VN GQ D+++
Sbjct: 229 LKTVSKKL--NKGYLLTIDYGYDASKYYHPQRYQGTLNCYYKHRHHHNPYVNLGQQDMTA 286

Query: 275 HVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR-------AFSLMKQTARKDIL 324
           HVDF  L     L  L   GLT QG FL  LG+  R        +SL +   R+D L
Sbjct: 287 HVDFTALEKQGNLLGLETVGLTQQGLFLMALGLGDRLAELSNGNYSLPEIFQRRDAL 343


>gi|251771853|gb|EES52427.1| conserved protein of unknown function [Leptospirillum
           ferrodiazotrophum]
          Length = 376

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 101/372 (27%), Positives = 161/372 (43%), Gaps = 39/372 (10%)

Query: 19  MTVDQYFALCVADPEFGYYSTCNPFG-AVGDFVTAPEISQIFGEMLAIFLICAWEQHGFP 77
           +T  ++     A PE GYY+     G   GDF+T+PE S  F  +LA+ +       G P
Sbjct: 2   VTFCEFMRQAAAGPEGGYYTRHAGIGREGGDFLTSPETSPAFATLLALQIGELDRALGSP 61

Query: 78  SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYG--D 135
               L+E GPG G +M D+L +  +  P FF  +S  + E    L   Q+++L  +    
Sbjct: 62  DPFYLIEAGPGNGTLMSDLLTIFRRADPAFFERVSPILCELPGVLEARQRERLREFELLH 121

Query: 136 KINWYT-----------SLADVP-LGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQ 183
              W             + +D P  G   ++ NEF D+LP+ +  +      E  +    
Sbjct: 122 PPRWIALPENLASTSGRAPSDWPEPGQGLVLGNEFLDALPVHRLRIQGGRWEECYVRAGS 181

Query: 184 H---DSLVFNIGDHEIKSNFLT--CSDYFLGAIFENSPCRD-REMQSISDRLACDGGTAI 237
               + +  ++ D E+    L    SD       E   C+D   + S+ D+     G  +
Sbjct: 182 EGVWEEIWGDLSDRELSGLLLERFGSDLSGWEGQETEVCQDLPRVLSLLDQ-CLSSGFML 240

Query: 238 VIDYGYLQS------RVGDTLQAVKGHTYVSPLV-NPGQADLSSHVDFQRLSSIAILYKL 290
            IDYG + S      R G TL+A +GH     L+ +PG  DL++ VDF +++    +   
Sbjct: 241 WIDYGDIGSEIRSKRRRGGTLRAYRGHQVSDRLIESPGHTDLTAFVDFSQVAGDLAVRGY 300

Query: 291 YINGLTTQGKFLEGLGI--WQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
            + G T Q  +L GLG   W RA S        D L D+  +  +T      MG +FK+L
Sbjct: 301 RLEGYTDQMSWLMGLGFEEWIRANS--------DRLSDAAIQEAATLVHPLRMGRIFKVL 352

Query: 349 VVSHEKVELMPF 360
           ++S     + P 
Sbjct: 353 LMSKAMGPMAPL 364


>gi|224827081|ref|ZP_03700178.1| protein of unknown function DUF185 [Lutiella nitroferrum 2002]
 gi|224600747|gb|EEG06933.1| protein of unknown function DUF185 [Lutiella nitroferrum 2002]
          Length = 383

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 108/371 (29%), Positives = 166/371 (44%), Gaps = 46/371 (12%)

Query: 1   MENKLIRKIV-NLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQI 58
           +  +L R I   +   +G +   +Y  L +  P  GYYS     FGA GDFVTAPE+S  
Sbjct: 14  VSQELSRHIAAEIATHDGWIPFSRYMELALYAPSLGYYSAGSRKFGAAGDFVTAPELSPY 73

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSV--LSIY 114
           FG  LA  L     Q G      L E G G G + +DIL  +  L   P+ +++  LS  
Sbjct: 74  FGRTLARQLAELLPQTGG----TLYEFGAGTGRLAVDILTELEALGQLPERYAIIDLSAD 129

Query: 115 MVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMT--- 170
           +VE  +R TL +   L     ++ W   L+++P  F   ++ NE  D++P +    T   
Sbjct: 130 LVE-RQRQTLAEA--LPHLAGRVEW---LSELPEQFDGVIIGNEVLDAMPCELLHWTPTP 183

Query: 171 -EHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
            + G+  R       D     I D  + +          G + E S      + +++ RL
Sbjct: 184 QQRGVTVRDGAFAWEDR---PIADPRLAAVAAALPPEAAGYLSEVSLANRAFIATLAARL 240

Query: 230 ACDGGTAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
               G  ++IDYG+        Q  +G  +   + HT   P   PG  DL+SHVDF  ++
Sbjct: 241 VR--GAILLIDYGFPEREYYHPQRHMGTLIGHYRHHTVDDPFYLPGLMDLTSHVDFTAVA 298

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ-----TARKDILLDSVKRLVSTSAD 337
                  L + G TTQ +FL   GI     +L++Q      AR    + +V++L+S    
Sbjct: 299 LAGTDAGLDLIGYTTQAQFLVNAGI----TALLQQLDPDDVARYAPRVAAVQKLLS---- 350

Query: 338 KKSMGELFKIL 348
              MGELFK++
Sbjct: 351 PNEMGELFKVI 361


>gi|296137278|ref|YP_003644520.1| protein of unknown function DUF185 [Thiomonas intermedia K12]
 gi|295797400|gb|ADG32190.1| protein of unknown function DUF185 [Thiomonas intermedia K12]
          Length = 410

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 98/323 (30%), Positives = 149/323 (46%), Gaps = 33/323 (10%)

Query: 4   KLIRKI-VNLIKKNGQMTVDQYFALCVADPEFGYYS----TCNPFGAVGDFVTAPEISQI 58
           +L+ +I   L    G +  D Y    +  P  GYY+        FG+  DFVTAPE+S +
Sbjct: 21  QLLAQIRAALHAGGGWLPFDAYMQQALYAPGLGYYTGQAGQFGDFGSDSDFVTAPELSPL 80

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIYMV 116
           FG  LA  +    +Q    +   +VE G G G +   IL  +  L   P  +++     V
Sbjct: 81  FGRTLAAQVAQVLQQSDLHT---VVEFGAGSGRLAAQILGELDHLGCAPRHYAI-----V 132

Query: 117 ETSERLTLIQKKQLASYG----DKINWYTSLADVPLGF-TFLVANEFFDSLPIKQFVMTE 171
           E S  L   Q + L S      D++ W+T+L   P  F   ++ NE  D++P+K     E
Sbjct: 133 EVSGALKHRQMQTLRSAVPHLFDRVQWWTAL---PETFEAVVIGNEVLDAMPVKLLHRHE 189

Query: 172 HGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC 231
            G  ER + + + D LVF      +           +GA+ E  P     +++++DRLA 
Sbjct: 190 DGWMERGV-VQEGDDLVFADRATALLPPAPEAHALPIGAVTEIHPQALAFVRTLADRLAR 248

Query: 232 DGGTAIVIDYGYLQ------SRVGDTLQAVKGHTYVSP-LVNPGQADLSSHVDFQRLSSI 284
             G A+ IDYG+ Q       R   TLQA   H  +   L+ PG AD++SH+DF  ++  
Sbjct: 249 --GAALFIDYGFPQREYYHPQRHMGTLQAHYRHRVLDDVLLWPGLADITSHIDFTAIALA 306

Query: 285 AILYKLYINGLTTQGKFLEGLGI 307
           A    L + G T+Q  FL   G+
Sbjct: 307 AQDAGLDVLGYTSQASFLMNCGL 329


>gi|166368128|ref|YP_001660401.1| hypothetical protein MAE_53870 [Microcystis aeruginosa NIES-843]
 gi|166090501|dbj|BAG05209.1| hypothetical protein MAE_53870 [Microcystis aeruginosa NIES-843]
          Length = 375

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 102/358 (28%), Positives = 166/358 (46%), Gaps = 42/358 (11%)

Query: 9   IVNLIKKN--GQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEMLAI 65
           I+  IK++  G+++ +++  L +  P++GYY++     G+ GDF T+  +   FG++LA 
Sbjct: 7   ILEEIKQSVAGRISFERWMDLALYHPDYGYYTSGKVEIGSKGDFFTSSSLGADFGQLLAE 66

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLI 125
             +   E  G      LVE+G G GI+  DIL  +     DF+  LS  ++E S++L   
Sbjct: 67  QFVEMAEFLGNSPGFTLVEVGAGSGILAKDILDYLSDSYADFYQNLSYIIIEQSQKLRER 126

Query: 126 QKKQLASYGDKINW--YTSLADVPL-GFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           Q+  LA Y   ++W  +  LAD  L G  F  +NE  D+ P+ + V+    +RE  + + 
Sbjct: 127 QQATLAGY-SPVSWQSWPDLADNSLVGCVF--SNELIDAFPVHRVVIESGELREIYLGLG 183

Query: 183 Q-HDSLVFNIGDHEIKSNFLTCSDYF-LGAIFENSPCRDREMQSISDRLACDG------- 233
           +    ++ ++    IK       DYF L  I   SP      Q+  + LA D        
Sbjct: 184 EPFQEIIGDLSTDRIK-------DYFDLVGINIPSPLYPEGYQTEVNLLALDWLETVNRK 236

Query: 234 ---GTAIVIDYGYLQS------RVGDTLQAVKGHT-YVSPLVNPGQADLSSHVDFQRLSS 283
              G  + IDYGY         R   TLQ  + H  +    +  G+ D+++HVDF  L  
Sbjct: 237 LDRGYILTIDYGYTAEKYYHPQRSQGTLQCYRQHQRHDHAYLWVGEQDITTHVDFTALQR 296

Query: 284 IAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILL-----DSVKRLVSTSA 336
                 L   G T QG FL  LG+  R   L +   + DIL      D++ +L++ + 
Sbjct: 297 QGEKLGLKNLGFTQQGLFLMALGLGDRLKELSQ--GKIDILTIFQRRDALHQLINPTG 352


>gi|257061621|ref|YP_003139509.1| hypothetical protein Cyan8802_3870 [Cyanothece sp. PCC 8802]
 gi|256591787|gb|ACV02674.1| protein of unknown function DUF185 [Cyanothece sp. PCC 8802]
          Length = 377

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 139/299 (46%), Gaps = 22/299 (7%)

Query: 18  QMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           ++T   Y  L +  P+ GYYS+ N   G  GDF TA  +   FGE+LA   +  W   G+
Sbjct: 15  KITFADYMNLALYHPQKGYYSSGNAKIGTQGDFFTASSLGADFGELLAEQFLEMWSILGY 74

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           P+   LVE+G G G    DIL  +    P F+  +   ++E ++ L   QK QL +  DK
Sbjct: 75  PNRFSLVEVGAGSGFFAADILDYLSNQHPHFYEAIEYLIIEEAKGLIEQQKAQLKN-SDK 133

Query: 137 INW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHD--SLVFNIG 192
           ++W  +  + +  +    + +NE  D+ P+    + +  ++E  + I +      + ++ 
Sbjct: 134 VSWKSWDEIENCSI-IGCIFSNELIDAFPVHLVTLEQGKLQEIYVTISEGKITEAIADLS 192

Query: 193 DHEIKSNF------LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ- 245
             +++  F      LT  DY      E +      +++++++L    G  + IDYGY   
Sbjct: 193 TSQLRDYFELVEVNLTAKDYPENYRTEVNLAALDCLKTVANKLK--KGYLLTIDYGYTAQ 250

Query: 246 -----SRVGDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
                 R   TL+    H +  +P VN G+ D+++HV+F  L +   L  L   G T Q
Sbjct: 251 KYYHPQRYQGTLKCYYKHRHHDNPYVNIGEQDITTHVNFTALENHGELLGLDKLGFTQQ 309


>gi|218248555|ref|YP_002373926.1| hypothetical protein PCC8801_3820 [Cyanothece sp. PCC 8801]
 gi|218169033|gb|ACK67770.1| protein of unknown function DUF185 [Cyanothece sp. PCC 8801]
          Length = 377

 Score =  102 bits (254), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 139/299 (46%), Gaps = 22/299 (7%)

Query: 18  QMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           ++T   Y  L +  P+ GYYS+ N   G  GDF TA  +   FGE+LA   +  W   G+
Sbjct: 15  KITFAHYMNLALYHPQKGYYSSGNAKIGTQGDFFTASSLGADFGELLAEQFLEMWSILGY 74

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           P+   LVE+G G G    DIL  +    P F+  +   ++E ++ L   QK QL +  DK
Sbjct: 75  PNRFSLVEVGAGAGFFAADILDYLSNQHPHFYEAIEYLIIEEAKGLIEQQKAQLKNR-DK 133

Query: 137 INW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHD--SLVFNIG 192
           ++W  +  + +  +    + +NE  D+ P+    + +  ++E  + I +      + ++ 
Sbjct: 134 VSWKSWDEIENCSI-IGCIFSNELIDAFPVHLVTLEQGKLQEIYVTISEGKITEAIADLS 192

Query: 193 DHEIKSNF------LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYGYLQ- 245
             +++  F      LT  DY      E +      +++++++L    G  + IDYGY   
Sbjct: 193 TSQLRDYFELVEVNLTAKDYPENYRTEVNLAALDCLKTVANKLK--KGYLLTIDYGYTAQ 250

Query: 246 -----SRVGDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
                 R   TL+    H +  +P VN G+ D+++HV+F  L +   L  L   G T Q
Sbjct: 251 KYYHPQRYQGTLKCYYKHRHHDNPYVNIGEQDITTHVNFTALENHGELLGLDKLGFTQQ 309


>gi|82701471|ref|YP_411037.1| hypothetical protein Nmul_A0337 [Nitrosospira multiformis ATCC
           25196]
 gi|82409536|gb|ABB73645.1| Protein of unknown function DUF185 [Nitrosospira multiformis ATCC
           25196]
          Length = 424

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 107/387 (27%), Positives = 165/387 (42%), Gaps = 70/387 (18%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGE 61
            KLI + ++     G ++ + Y  L +  P  GYYS     FG  GDFVTAPEIS +FG 
Sbjct: 48  TKLIHEKIS--AAGGWISFEHYMRLALYAPGMGYYSGGPAKFGQEGDFVTAPEISPLFGR 105

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETS 119
            +A       E     SC+  +E G G G + LD+L  + KL   P  + +L +   E  
Sbjct: 106 TVARQARQILELADEGSCI--LEFGAGTGKLALDLLVELEKLDCLPQQYFILEV-SAELR 162

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERM 178
           +R   + ++       ++ W   L  +P  F  L+ ANE  D++P+         + ER 
Sbjct: 163 QRQRQLLEQFAPHLASRVFW---LKHLPEQFNGLILANEVLDAMPVHLIAWRGTTVYERG 219

Query: 179 IDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDR---------- 228
           +    H+          I S  L       G +FE +       Q ++DR          
Sbjct: 220 VSSAGHEF---------IWSERLLAE----GVLFEAA-------QELADRIRLGRNEGEY 259

Query: 229 -----LACDG-----------GTAIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLV 265
                L   G           G  ++IDYG+        Q R G  +   + HT+ +P  
Sbjct: 260 VSEICLQARGFIASLGKMLQRGAILLIDYGFGRDEYYHPQRRQGTLMCHYRHHTHDNPFY 319

Query: 266 NPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-L 324
            PG  D++SHVDF   +S  +   L + G TTQ  FL   GI +         A+  + L
Sbjct: 320 LPGLQDITSHVDFSSAASSGLEAGLQLLGYTTQAHFLINCGITEILAETPAANAKDYLPL 379

Query: 325 LDSVKRLVSTSADKKSMGELFKILVVS 351
            + V++LVS +     MGELFK++++ 
Sbjct: 380 ANQVQKLVSPA----EMGELFKVMILG 402


>gi|188996566|ref|YP_001930817.1| protein of unknown function DUF185 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931633|gb|ACD66263.1| protein of unknown function DUF185 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 384

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 103/360 (28%), Positives = 154/360 (42%), Gaps = 20/360 (5%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEM 62
           +LI  I   I++ G ++   +  + +  P  GYY S     G +GDF T+ E+   FG +
Sbjct: 8   ELINIIKQKIQQEGAISFKDFMEMALYYPNLGYYTSEKEKIGGLGDFYTSSELDPAFGNL 67

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           LA      +E +      ++ ELG G+G++  D+L  I    P+ +  L    VE S   
Sbjct: 68  LAKQFNEIYENYFKNQKFQIAELGSGKGLLAYDVLSYIKNNYPNLYKTLEFISVEKSPYH 127

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              QKK L  + D +++Y  L ++      + +NE FD+LP+         I E  I ++
Sbjct: 128 RDYQKKLLKDF-DNVSFYEDLTEIDNINGIIYSNELFDALPVHLIRKIGGKIFEVYITLE 186

Query: 183 QHD-SLVFNIGDHEIKSNFLTCS-DYFLGAIFENSPCRDREMQSISDRLACDGGTAIVID 240
             D   V      +I       + D   G   E +      +Q I ++L  + G    ID
Sbjct: 187 GDDIKEVLKEPQKDILQYLKDLNIDIPEGMTTEINLYAKDLIQEIGNKL--EKGFVFTID 244

Query: 241 YGYLQS------RVGDTLQAVKGHTYVSPLV-NPGQADLSSHVDFQRLSSIAILYKLYIN 293
           YGY         R+  TL     HTY      N G  D++SHV+F  L       KL   
Sbjct: 245 YGYPSKELYKPYRMRGTLLCYYKHTYNENFYQNVGLQDITSHVNFSALVYYGKKSKLDFV 304

Query: 294 GLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRL--VSTSADKKSMGELFKILVVS 351
           G T Q  FL  LG+      L ++   K     S +RL  + T    K MGE FKIL+ S
Sbjct: 305 GFTDQAHFLISLGLMDIFQELQEKGDYK-----SYERLNRLKTLILPKGMGEKFKILIQS 359


>gi|91789925|ref|YP_550877.1| hypothetical protein Bpro_4086 [Polaromonas sp. JS666]
 gi|91699150|gb|ABE45979.1| protein of unknown function DUF185 [Polaromonas sp. JS666]
          Length = 394

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 160/360 (44%), Gaps = 46/360 (12%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAV--------GDFVTAPEISQIFGEM 62
           + +  G +  DQ+ AL +  P  GYY+     FG +         DFVTAPE+S  FG+ 
Sbjct: 42  IAEAGGWIGFDQFMALALYTPGLGYYANDSRKFGLMPGGVKDGGSDFVTAPELSPRFGQA 101

Query: 63  LAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
           LA  L  A +  G      + E G G G + L +L  +  L      V    +V+ S  L
Sbjct: 102 LARQLAQALQATG---TSEVWEFGAGSGALALQLLDTLGPL------VARYTIVDVSGSL 152

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
              Q+++LA++  K++W + L     G   +V NE  D++P+K     E    ER + + 
Sbjct: 153 MQRQRERLAAHAGKVHWASELPAEMRGV--VVGNEVLDAMPVKLLSRLEKVWHERGVVVH 210

Query: 183 QHDSLVFNIGDH--EIKS--NFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIV 238
           Q     F   D   E++         DY    + E  P  +  +++++DRL  + G   +
Sbjct: 211 QER---FTWADQRTELRPPLEVAGAHDY----LTEIHPQAEGFIRTLADRL--EAGAVFL 261

Query: 239 IDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAILYKLY 291
           +DYG      Y   R   T+   +GH +    L++ G  D+++HV+F  ++       L 
Sbjct: 262 LDYGFPEHEYYHPQRSMGTVMCHRGHLSDTDALLDVGSKDITAHVNFTGIALAGQDAGLQ 321

Query: 292 INGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           + G T+QG+FL   G+      L       D    + + +V     +  MGELFK++  S
Sbjct: 322 VLGYTSQGRFLLNCGL------LEGMEGGVDSANLAERAMVQKLIAEHEMGELFKVIAFS 375


>gi|116191777|ref|XP_001221701.1| hypothetical protein CHGG_05606 [Chaetomium globosum CBS 148.51]
 gi|88181519|gb|EAQ88987.1| hypothetical protein CHGG_05606 [Chaetomium globosum CBS 148.51]
          Length = 290

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 102/209 (48%), Gaps = 31/209 (14%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-----NPFGAVGDFVTAPEISQIF 59
           L +++   I+  G + +  Y  +C+     GYY+       + FG  GDFVT+PEISQ+F
Sbjct: 81  LAKQLGEAIEATGPVPLASYMRMCLTADIGGYYTGALEEGRDQFGLKGDFVTSPEISQVF 140

Query: 60  GEMLAIFLICAWEQHGFPS-CVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           GE+ AI+ +  W   G  S  V L+E+GPGRG +M D+LR    +     S+ +IYMVE 
Sbjct: 141 GELCAIWYVTEWMAQGRRSKGVELIEVGPGRGTLMDDMLRRFPAMA---NSIDAIYMVEA 197

Query: 119 SERLTLIQKKQLASYGDKIN------------------WYTSLADVPLG---FTFLVANE 157
           S  L + QK  L      +                   W  ++  +P+      F++A+E
Sbjct: 198 SPELRVAQKNLLCGEDAPMTESKVGYHSVCKYNALPIVWTETIKSIPIAPEKMPFIMAHE 257

Query: 158 FFDSLPIKQFVMTEHGIRERMIDIDQHDS 186
           FFD+LPI  F +   G     I+   HD+
Sbjct: 258 FFDALPIHAFELISVGFLRAHINF-LHDT 285


>gi|209527409|ref|ZP_03275915.1| protein of unknown function DUF185 [Arthrospira maxima CS-328]
 gi|209492144|gb|EDZ92493.1| protein of unknown function DUF185 [Arthrospira maxima CS-328]
          Length = 389

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 91/334 (27%), Positives = 150/334 (44%), Gaps = 32/334 (9%)

Query: 5   LIRKIVNLIKKNGQ--MTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGE 61
           L+ +I   I  + Q  +T  +Y  + + DP+ GYY+  +P  GA GDF T+P +   FGE
Sbjct: 6   LVDRISQRIGNHPQNRITFAEYMEMALYDPKQGYYNHNSPQIGAQGDFFTSPHLGSDFGE 65

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +LA  L+  WE  G P    LVE+G G+GI+  DI+  +    P    VL   + E S R
Sbjct: 66  LLAEQLVEMWEILGKPEPFTLVEMGAGQGILAADIIGYLQGQYPQVVGVLDYAIAEKSTR 125

Query: 122 LTLIQKKQLASYG---DKINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           L   Q+++    G    +I W     +A+  +   F  +NE  D+ P+       + ++E
Sbjct: 126 LKTEQQRRFQQLGAPFTQIRWCDLDEIANHSITGCFF-SNELIDAFPVHLVTRQNNQLQE 184

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYF----LGAIFENSPCRDRE---------MQ 223
             +      S  + + +   + +    +DYF    +  + E  P   R          ++
Sbjct: 185 IYLTTTGSKS-DYQLAEVVGELSTPQLADYFRLVGIDLLSEAYPEGYRTEVNLAALGWVE 243

Query: 224 SISDRLACDGGTAIVIDYGYLQSRV------GDTLQAVKGHT-YVSPLVNPGQADLSSHV 276
           +++ +L    G  + IDYGY   R+        TLQ    H  + +P +  G+ D+++HV
Sbjct: 244 TVARKLRR--GFVLTIDYGYSADRLYSPTRREGTLQCYYQHRHHNNPYIYIGEQDITAHV 301

Query: 277 DFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           DF  L        L   G T Q  F+  LG+  R
Sbjct: 302 DFTALQQKGRSLGLQTIGFTQQALFMMALGLGDR 335


>gi|17230849|ref|NP_487397.1| hypothetical protein alr3357 [Nostoc sp. PCC 7120]
 gi|17132452|dbj|BAB75056.1| alr3357 [Nostoc sp. PCC 7120]
          Length = 404

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 96/333 (28%), Positives = 146/333 (43%), Gaps = 37/333 (11%)

Query: 18  QMTVDQYFALCVADPEFGYYST--CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHG 75
           ++T  +Y  + +  PE GYYS+   N     GDF T+  +    G++LA   +  W   G
Sbjct: 22  RITFAEYMDMALYHPEHGYYSSNAVNIGFKGGDFFTSVNLGADLGDLLAEQFVQMWGIFG 81

Query: 76  FPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD 135
            P+   LVE+G G+G++ L IL+ I    P+ +  L   +VE S  L   Q+++L  +  
Sbjct: 82  QPTPFYLVEMGAGQGLLALHILKYIQVQYPNLYKALKYLIVEKSPGLKQEQQERLQGF-- 139

Query: 136 KINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDI--DQHDSLVFNIG 192
            + W +     P   T    +NE  D+LP+ QF++    +RE  + +  DQ      N+ 
Sbjct: 140 PVRWCSWEEISPNSITGCFFSNELVDALPVHQFILEGGELREIYLTMQEDQEAQEAKNLS 199

Query: 193 ---DHEIKSNFLTCS-----DYF--LGAIFENSPCRDREMQSI-----------SDRLAC 231
              ++E+       S     +YF  +G         D     I           +DRL  
Sbjct: 200 PSPNYELTEVAAAPSTPKLAEYFDLIGINLAQGGYEDGYRSEINLAALDWLSIVADRL-- 257

Query: 232 DGGTAIVIDYGYLQSRVGD------TLQAVKGHT-YVSPLVNPGQADLSSHVDFQRLSSI 284
             G  I IDYGY  SR  +      TLQ    H  + +P +N GQ D+++HVDF  L   
Sbjct: 258 QRGYVITIDYGYPASRYYNPRRSQGTLQCYYQHRHHNNPYINIGQQDITAHVDFTALERW 317

Query: 285 AILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQ 317
                L   G T Q  FL  LG+  R  +L  Q
Sbjct: 318 GDRCGLEKLGFTQQALFLMALGLGSRIAALSYQ 350


>gi|220907759|ref|YP_002483070.1| hypothetical protein Cyan7425_2351 [Cyanothece sp. PCC 7425]
 gi|219864370|gb|ACL44709.1| protein of unknown function DUF185 [Cyanothece sp. PCC 7425]
          Length = 410

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 151/338 (44%), Gaps = 39/338 (11%)

Query: 9   IVNLIKKNGQMTVDQ------YFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGE 61
           ++ LI    Q + DQ      Y  L +   + GYY S     G  GDF T+P +   F E
Sbjct: 12  LLALISAEIQASPDQRIPFARYMDLVLYQSQQGYYASNAVKIGQGGDFFTSPHLGSDFAE 71

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L    +  W+  G PS   LVE+G G+GI+  D+L+ + +  PDFF+ L+  +VE +  
Sbjct: 72  LLGEQFLQMWQVMGQPSAFNLVEMGAGQGIIANDLLKYLQRQYPDFFASLNYVIVEKAAG 131

Query: 122 LTLIQKKQLASYGD---KINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           L   QK  L  + +   ++ W     +AD  +    L +NE  D+ P+ Q V+ +  +++
Sbjct: 132 LIAEQKYHLKPWLETWGRLKWLGLEEIADGTIA-GCLFSNELLDAFPVDQVVIQQGQLQQ 190

Query: 177 RMIDID---------QH-------DSLVFNIGDH-EIKSNFLTCSDYFLGAIFENSPCRD 219
             + ++         QH       +  +  + ++ +     L  SDY  G   E +    
Sbjct: 191 VFVGLNPDHPGEGQRQHPFQEILAEPTMAGLAEYFQWLGIQLPGSDYPEGYRTEVNLAAL 250

Query: 220 REMQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADL 272
             + ++S +L    G  + IDYG      Y  +R   TLQ    H T  +P  N G  DL
Sbjct: 251 DWIATVSRKLQR--GYVLTIDYGYPARQYYQPARREGTLQCYYHHATNTNPYFNVGHQDL 308

Query: 273 SSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR 310
           ++HV+F  L        L   G T QG FL  LG+  R
Sbjct: 309 TAHVNFTALEQRGKECGLVNLGFTQQGLFLMSLGLGDR 346


>gi|217969131|ref|YP_002354365.1| hypothetical protein Tmz1t_0697 [Thauera sp. MZ1T]
 gi|217506458|gb|ACK53469.1| protein of unknown function DUF185 [Thauera sp. MZ1T]
          Length = 391

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 165/373 (44%), Gaps = 42/373 (11%)

Query: 4   KLIRKI-VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
           +L+  I   L    G +   +Y  L +  P  GYYS     FG  GDF+TAPE++ +FG+
Sbjct: 17  RLLEHIEAELAAAAGWIPFARYMELALYAPGLGYYSGGARKFGPGGDFITAPELTPLFGQ 76

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETS 119
            LA  +    EQ    S   L+E+G G G++  D+L  + +    P+ + +L +   E  
Sbjct: 77  ALAAQV----EQVMRASTPALIEVGAGTGLLAADLLLELERRGCLPERYGILEL-SGELR 131

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERM 178
           ER       ++     +++W  +L   P  F+  +VANE  D +P+   V    G+ ER 
Sbjct: 132 ERQFDTLAAKVPHLAARVHWLDAL---PERFSGAVVANEVLDVMPVHLLVSRAEGLFERG 188

Query: 179 IDIDQHDSLVFNI-------------GDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSI 225
           + I    + +  +             G   +        +Y    + E +      + + 
Sbjct: 189 VAIATDAAGIRRLCWADVPAAGAVAEGARALALPVPQSGEY----VTELNLAGKAWVAAW 244

Query: 226 SDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDF 278
           ++RL    G  ++IDYG      YL SR G TL    + H +  P + PG  D+++ VDF
Sbjct: 245 AERL--HAGALLLIDYGYPRAEYYLPSRSGGTLLCYYRHHAHGDPFLWPGLNDITAFVDF 302

Query: 279 QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADK 338
             ++       L + G TTQ +FL   G+ +    L ++ AR+        R V      
Sbjct: 303 TAVAEAGFEAGLDVQGYTTQAQFLFNCGVLE---CLERRGARESADYIRAARAVQRLTAP 359

Query: 339 KSMGELFKILVVS 351
           + MGELFK++ +S
Sbjct: 360 QEMGELFKVIALS 372


>gi|319761315|ref|YP_004125252.1| hypothetical protein Alide_0595 [Alicycliphilus denitrificans BC]
 gi|317115876|gb|ADU98364.1| protein of unknown function DUF185 [Alicycliphilus denitrificans
           BC]
          Length = 361

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 162/357 (45%), Gaps = 45/357 (12%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEISQIFGEMLAI 65
           +L    G +  D++  L +  P  GYY+      G++     DFVTAPE+S +FG++LA 
Sbjct: 15  DLAAAGGWIGFDRFMQLALYTPGLGYYAGGLRKLGSMPEDGSDFVTAPELSPVFGKVLAA 74

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLI 125
            +  A +  G      + E G G G +   +L  + +       V    +V+ S  L   
Sbjct: 75  QVREALDATG---TDEVWEFGAGSGALAGQLLEALGE------RVRRYTIVDLSGSLRAR 125

Query: 126 QKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHD 185
           Q+++LA++  +++W   L     G   +V NE  D++P++     +    ER + +D   
Sbjct: 126 QQERLAAHAGRVHWAERLPAAIEGV--VVGNELLDAMPVQLLHRVQGAWHERGVALDAGG 183

Query: 186 SLVFNIGDHEIKS--NFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG- 242
           +L ++     ++         DY    + E  P  +  M+++ +RLA   G A++IDYG 
Sbjct: 184 ALAWSDRPTALRPPVEIEGGHDY----LTEIHPQGEAFMRTLGERLAR--GAALLIDYGF 237

Query: 243 -----YLQSRVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
                Y   R   T+   + H     PL + G+ D+++HV+F  ++  A    L + G T
Sbjct: 238 GEDEYYHPQRHMGTVMCHRAHRADDDPLADVGEKDITAHVNFTAMALAAQDAGLNVLGYT 297

Query: 297 TQGKFLEGLGIWQ--RAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           +Q +FL   G+ Q     +L ++     ++L+              MGELFK+L V 
Sbjct: 298 SQARFLLNCGLLQEMERLTLAQRALAAKLMLE------------HEMGELFKVLAVG 342


>gi|270158226|ref|ZP_06186883.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289163517|ref|YP_003453655.1| hypothetical protein LLO_0173 [Legionella longbeachae NSW150]
 gi|269990251|gb|EEZ96505.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288856690|emb|CBJ10501.1| putative conserved hypothetical protein [Legionella longbeachae
           NSW150]
          Length = 370

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 160/373 (42%), Gaps = 82/373 (21%)

Query: 23  QYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVR 81
           ++  L +  P  GYYS+     G  GDF+TAPE++ +FG+ LA   +  ++    PS   
Sbjct: 21  EFMQLALYAPGEGYYSSGLQKLGKQGDFITAPELTPLFGKTLANQCLQVFDVLESPS--- 77

Query: 82  LVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKKQLAS----YGD 135
           + E G G G + + IL  + +    P+ +     Y++E S  L   Q++ +A        
Sbjct: 78  IFEFGAGSGALCVSILEYLAEYNSLPEAY-----YILEVSANLCHRQREMVAQKIPHLAH 132

Query: 136 KINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHE 195
            + W     + P     L ANE  D++P+ +F+ T  GI E  + +D+   +V       
Sbjct: 133 LVTWLDRWPETPFNGVVL-ANEVLDAMPVHRFMNTNQGIMESYVRLDEQQQVV------- 184

Query: 196 IKSNFLTCSDYFLGAIFENSPCRDREMQS-ISDRLACDG--------------------- 233
                          IF+  PC+++ +Q  I+ +++  G                     
Sbjct: 185 --------------EIFK--PCQNKRLQHYINHKISSLGVPYLSEVNLFIDDWILNTYRM 228

Query: 234 ---GTAIVIDYGYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSS 283
              G   +IDYG+ +          G  +   + H++ +P +N G  D+++HVDF  ++ 
Sbjct: 229 LKQGVVFLIDYGFPRHEYYHPDRNQGTLMCHYQHHSHSNPFLNLGAQDITAHVDFTHVAE 288

Query: 284 IAILYKLYINGLTTQGKFLEGLGIW---QRAFSLMKQTARKDILLDSVKRLVSTSADKKS 340
                  ++ G T Q  FL   G+      + S ++Q   K     ++K+L   S     
Sbjct: 289 AGQQAGFHVAGYTNQASFLLANGLLSFINSSDSELEQMRAK----QAIKQLTQPS----E 340

Query: 341 MGELFKILVVSHE 353
           MGELFK++ +S E
Sbjct: 341 MGELFKVIALSKE 353


>gi|330823189|ref|YP_004386492.1| hypothetical protein Alide2_0560 [Alicycliphilus denitrificans
           K601]
 gi|329308561|gb|AEB82976.1| protein of unknown function DUF185 [Alicycliphilus denitrificans
           K601]
          Length = 361

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 162/357 (45%), Gaps = 45/357 (12%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEISQIFGEMLAI 65
           +L    G +  D++  L +  P  GYY+      G++     DFVTAPE+S +FG++LA 
Sbjct: 15  DLAAAGGWIGFDRFMQLALYTPGLGYYAGGLRKLGSMPEDGSDFVTAPELSPVFGKVLAA 74

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLI 125
            +  A +  G      + E G G G +   +L  + +       V    +V+ S  L   
Sbjct: 75  QVREALDATG---TDEVWEFGAGSGALAGQLLEALGE------RVRRYTIVDLSGSLRAR 125

Query: 126 QKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHD 185
           Q+++LA++  +++W   L     G   +V NE  D++P++     +    ER + +D   
Sbjct: 126 QQERLAAHAGRVHWAERLPAAIEGV--VVGNELLDAMPVQLLHRVQGAWHERGVALDAGG 183

Query: 186 SLVFNIGDHEIKS--NFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG- 242
           +L ++     ++         DY    + E  P  +  M+++ +RLA   G A++IDYG 
Sbjct: 184 ALAWSDRPTALRPPVEIEGGHDY----LTEIHPQGEAFMRTLGERLAR--GAALLIDYGF 237

Query: 243 -----YLQSRVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
                Y   R   T+   + H     PL + G+ D+++HV+F  ++  A    L + G T
Sbjct: 238 GEDEYYHPQRHMGTVMCHRAHRADDDPLADVGEKDITAHVNFTAMALAAQDAGLNVLGYT 297

Query: 297 TQGKFLEGLGIWQ--RAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
           +Q +FL   G+ Q     +L ++     ++L+              MGELFK+L V 
Sbjct: 298 SQARFLLNCGLLQEMERLTLAQRALAAKLMLE------------HEMGELFKVLAVG 342


>gi|332709754|ref|ZP_08429713.1| hypothetical protein LYNGBM3L_43420 [Lyngbya majuscula 3L]
 gi|332351581|gb|EGJ31162.1| hypothetical protein LYNGBM3L_43420 [Lyngbya majuscula 3L]
          Length = 421

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 100/346 (28%), Positives = 160/346 (46%), Gaps = 40/346 (11%)

Query: 5   LIRKIVNLIK--KNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
           L + I N I    N  +T  QY  L +  P+ GYY++     G+ GDF T+P + + FGE
Sbjct: 15  LSKVIANHIATAPNQGITFAQYMDLALYHPQLGYYASGAVNIGSSGDFFTSPHLGKDFGE 74

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +LA      W+  G P+   L+E+G G+G++  D+L  + +  PD +  ++  +VE +  
Sbjct: 75  LLAEQFAQMWDILGQPNPFTLMEVGAGQGLLAADVLVYLHQHYPDCYGAVNYIIVEKATA 134

Query: 122 LTLIQKKQLASYGD----------KINW--YTSLADVPL-GFTFLVANEFFDSLPIKQFV 168
           +   QK+ L                + W  +  + D  L G  F  +NE  D+LP+ Q V
Sbjct: 135 MIAQQKQLLLKLNLPRLDNHQPSLPVRWCSWEEIQDNSLTGCCF--SNELVDALPVHQVV 192

Query: 169 MTEHGIRERMI-DIDQHD------SLVFNIGDHEIKSNF-LTCSDYFLGAIFENSPCRDR 220
           +    ++E  I  +DQ D       ++      +++  F L   D F G+  E   C   
Sbjct: 193 LQAGDLKEIYIATVDQDDDDIKFVEVLDTPSTPQLREYFDLVGIDLFSGSYPEGYRCEVN 252

Query: 221 -----EMQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQAVKGHT-YVSPLVNPG 268
                 +++++ RL  + G  + IDYG      YL +R   TLQ    H  + +P    G
Sbjct: 253 LAALDWIKTVAKRL--NQGFVLTIDYGYPAQKYYLPARDQGTLQCYYRHRHHNNPYSYIG 310

Query: 269 QADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL 314
           + D+++HVDF  L     L  L   GLT QG FL  LG+  R  +L
Sbjct: 311 EQDITAHVDFTALEQQGELCGLGKVGLTKQGLFLMALGLGDRIAAL 356


>gi|269838435|ref|YP_003320663.1| hypothetical protein Sthe_2425 [Sphaerobacter thermophilus DSM
           20745]
 gi|269787698|gb|ACZ39841.1| protein of unknown function DUF185 [Sphaerobacter thermophilus DSM
           20745]
          Length = 375

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 106/393 (26%), Positives = 157/393 (39%), Gaps = 75/393 (19%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
             L+  I + I   G++T   +  L +  P++GYY T     G  GDF+TAPE   IFG 
Sbjct: 17  EALVAIIRDRIADEGRITFAAFMELALYHPQYGYYRTDAVRAGRAGDFITAPEAHAIFGH 76

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
            +A  L   W Q   P    L E G G G + L IL  +     D  + L    VE    
Sbjct: 77  AIARRLAAMWRQLDRPEPFTLREYGAGAGTLALAILDGLRTDGDDLLTALRYEPVE---- 132

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTF---LVANEFFDSLPIKQFVMTEHGIRERM 178
           +  +++ +LA   D   +   L     G      ++ANEF D+ P+ +  M  HG     
Sbjct: 133 INPVREAELAERLDAAGFADVLHQPVPGEQITGCVLANEFVDAFPVHRVEM--HG----- 185

Query: 179 IDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG----- 233
                           E++  ++   D +     E  P    E   ISDRLA +G     
Sbjct: 186 ---------------GELREIYVVWRDGWFAD--EPGPLSTPE---ISDRLAREGITLAE 225

Query: 234 -----------------------GTAIVIDYGYLQS------RVGDTLQAVKGHT-YVSP 263
                                  G  +VIDYGY  +      R   TL+A   HT +  P
Sbjct: 226 GQRAEIALGPTGWIAEVAAALERGYVLVIDYGYPAAELYGPERRDGTLKAYTRHTVHDDP 285

Query: 264 LVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTA--RK 321
               G+ DL++HVDF  L   A  + L +  LTTQ  FL   GI +   ++ ++     +
Sbjct: 286 YRAVGEQDLTAHVDFTALMDAARDHGLTVLDLTTQADFLADAGIGEILVAMQRRPGITAE 345

Query: 322 DILLDSVKRLVSTSADKKSMGELFKILVVSHEK 354
           D L  + +  V    D   MG  F++L +  E+
Sbjct: 346 DYL--AARAAVMHLIDPGGMGR-FRVLTLGREE 375


>gi|300692832|ref|YP_003753827.1| hypothetical protein RPSI07_3218 [Ralstonia solanacearum PSI07]
 gi|299079892|emb|CBJ52570.1| conserved protein of unknown function [Ralstonia solanacearum
           PSI07]
          Length = 397

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 104/386 (26%), Positives = 165/386 (42%), Gaps = 44/386 (11%)

Query: 3   NKLIRKIVNLIKK-NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEIS 56
           ++L   IV  I+   G M  ++Y  L +  P  GYYS     FG      GDF+TAPE++
Sbjct: 19  DRLFSTIVRAIEAAGGWMPFERYMELALYAPGLGYYSGGAAKFGRRVEDGGDFITAPELT 78

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIY 114
             FG  +A   I    +   P    +VE G G G +  DIL  +  L  +PD + +    
Sbjct: 79  PFFGRTVA-HQIAQVLRTLPPGQRHVVEFGAGTGKLAADILTELETLGMRPDSYGI---- 133

Query: 115 MVETSERLTLIQKKQLASYGDKI----NWYTSLADVPLGFT-FLVANEFFDSLPIKQFVM 169
            +E S  L   Q++ LA+ G  +     W+ +L   P  FT  +V NE  D++P+  +  
Sbjct: 134 -IELSGELRQRQQQTLAALGPDLAGLARWHDTL---PARFTGVMVGNEVLDAMPVSLWAR 189

Query: 170 TEHGIRERMIDIDQHDSLVF-----NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS 224
                  R +  D +  L +     +  +   K   L   D F+    E +    R   +
Sbjct: 190 RGGVWHRRGVAFDANQGLRWSERAADPAEVPPKLAALPGRDDFITESHEAAEGFIRSTGA 249

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
             +R     G  ++IDYG      Y   R   TL    + H +  P   PG  D+++HVD
Sbjct: 250 ALER-----GLLLLIDYGFPAAEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVD 304

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSA 336
           F  ++  A    L + G  +Q +FL G G+ Q   +L      R     ++V++L+S   
Sbjct: 305 FSGIAQAAREAGLEVLGYASQARFLLGAGVGQLLMTLDPADPVRFLPAANAVQKLLS--- 361

Query: 337 DKKSMGELFKILVVSHEKVELMPFVN 362
            +  MGELFK + +       +P   
Sbjct: 362 -EAEMGELFKAIALGRGIDAALPLAG 386


>gi|253997960|ref|YP_003050023.1| hypothetical protein Msip34_0247 [Methylovorus sp. SIP3-4]
 gi|253984639|gb|ACT49496.1| protein of unknown function DUF185 [Methylovorus sp. SIP3-4]
          Length = 385

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 159/361 (44%), Gaps = 42/361 (11%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIF--- 66
           ++ +  G +   QY  L +  P  GYYS     FG  GDFVTAPE+S +F   LA     
Sbjct: 26  HIAEAGGWLDFAQYMDLVLYAPSLGYYSAGAKKFGPAGDFVTAPELSPLFARTLATQAAD 85

Query: 67  LICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTL 124
           +I A       +   ++ELG G G +  D+L  + +L+  P  + +L I       +   
Sbjct: 86  IISA-------TAGDVLELGAGSGRLAADLLLELDRLQQLPSQYRILEISAYLRQVQKDY 138

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMIDI-- 181
           +QK        ++ W  SL +V   F+ LV  NE  D+LP+        G+ +R + +  
Sbjct: 139 LQKVLPPHLMQRVEWLDSLPEV---FSGLVLGNEVLDALPVHILHQQADGLLQRGVGLAP 195

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
           D     V    D  I++ F    +  L   +    C        S       G  ++IDY
Sbjct: 196 DGEFQWVDQPADPLIQAAF---RETRLPEPYTTEICMAAGGLIASLASMLQRGVVLLIDY 252

Query: 242 GYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           G+        Q + G  +   + H +  P + PG  D+++HVDF R++  A+   L + G
Sbjct: 253 GFPRHEYYHPQRQQGTLMCHYRHHAHTDPFLYPGLQDITAHVDFTRIAESAMQQGLSVMG 312

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQTARKDI-----LLDSVKRLVSTSADKKSMGELFKILV 349
             +Q +FL   GI +     + + +  DI     L  S ++L+S +     MGELFK++ 
Sbjct: 313 YASQAQFLINCGITE----CLAEVSPHDIAVYAPLASSAQKLLSPA----EMGELFKVIA 364

Query: 350 V 350
           V
Sbjct: 365 V 365


>gi|171056795|ref|YP_001789144.1| hypothetical protein Lcho_0104 [Leptothrix cholodnii SP-6]
 gi|170774240|gb|ACB32379.1| protein of unknown function DUF185 [Leptothrix cholodnii SP-6]
          Length = 404

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 163/374 (43%), Gaps = 45/374 (12%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCN-PFG---AVG-DFVTAPEISQIF 59
           L+R    +    G ++ ++Y AL +  P  GYYS  +  FG   A G DFVTAPE+S +F
Sbjct: 41  LVRIAAAIEDAGGWISFERYMALALYTPGLGYYSRGDRQFGLMPASGSDFVTAPELSPLF 100

Query: 60  GEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETS 119
           G  LA  +  A +  G      + E G G G +   +L  +         +    +V+ S
Sbjct: 101 GRALARQVAQALQATG---TQEVWEFGAGSGALAAQLLGELGD------RITRYTIVDLS 151

Query: 120 ERLTLIQKKQL----ASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGI 174
             L   Q++++     +   K+ W   LA++P  F   +VANE  D++P+       H  
Sbjct: 152 GTLRARQRERIEAAHPALAHKVRW---LAELPERFEGVVVANELLDAMPVTLLHWDGHHW 208

Query: 175 RERMIDIDQHDSLV----FNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLA 230
            +R + ++   +          DH           + +GA+ E        + ++++RLA
Sbjct: 209 HDRGVALEPGSAAAGAPRLRFADHPTHLAPPVDQHWPVGAVVELPRIAVAYILTLAERLA 268

Query: 231 CDGGTAIVIDYG------YLQSRVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRLSS 283
              G A  IDYG      Y   R   TL   + H     PL +PG  D+++HVDF  ++ 
Sbjct: 269 R--GAAFFIDYGFPEHEFYHPQRSAGTLMCHRAHRADPDPLSDPGDKDITAHVDFTAIAV 326

Query: 284 IAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGE 343
            A    + + G T+Q +FL   G       L+      D+   ++ + + T   +  MGE
Sbjct: 327 AAQDAGMGVLGYTSQARFLMNCG-------LIGDLEHADLRERAMAQKLIT---EHEMGE 376

Query: 344 LFKILVVSHEKVEL 357
           LFK+L V+    E 
Sbjct: 377 LFKVLGVASAGAEF 390


>gi|118602453|ref|YP_903668.1| hypothetical protein Rmag_0438 [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567392|gb|ABL02197.1| protein of unknown function DUF185 [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
          Length = 364

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 102/370 (27%), Positives = 170/370 (45%), Gaps = 44/370 (11%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
           +I+    ++ D++  L +  P  GYY S    FG  GDF+TAPE S +FG  LA    CA
Sbjct: 11  IIQNANPISFDEFMDLALYHPTLGYYRSGLEKFGERGDFITAPETSDLFGFCLA--RQCA 68

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKK 128
              +G      ++E G G G++   IL  + +L   P  + +L +   E   R      K
Sbjct: 69  QVLNG---TNDILEFGAGSGVLATQILFKLGRLNSLPKKYYILEL-SAELKHRQAQAINK 124

Query: 129 QLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
            L    D++ W   L ++P  F+  ++ANE  D++P K+ V   +   E  +D   ++  
Sbjct: 125 ILPELMDRVVW---LDELPADFSGVVIANEVLDAMPAKRIVYKNNQFYELGVDYCGNE-F 180

Query: 188 VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRD-------REMQSISD-RLACDGGTAIVI 239
            + I D   +S+           +  N+   D       R M  I+   +A +    ++I
Sbjct: 181 CWKIFDLPYQSD---------KTLLPNNMVEDYKTEVNLRAMAWINSLYMATNEVLVLLI 231

Query: 240 DYG------YLQSRVGDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSIAILYKLYI 292
           DYG      +   R+  TL+    H    +P VN G+ D+++ V+F  ++  A +    +
Sbjct: 232 DYGMGRNEYFHPQRLNGTLRCYYQHKASENPFVNIGEQDITTSVNFSDIADQASVSGFKV 291

Query: 293 NGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
           +G  TQ  FL  LGI +  F  + +    + L   VK+LV  SA    MGE FK+L +S 
Sbjct: 292 SGYATQALFLISLGIDEYLFEQLDENKYIN-LAQQVKQLVLPSA----MGESFKVLALSK 346

Query: 353 E-KVELMPFV 361
           +  ++L  F+
Sbjct: 347 KLSIKLTGFI 356


>gi|119896778|ref|YP_931991.1| hypothetical protein azo0487 [Azoarcus sp. BH72]
 gi|119669191|emb|CAL93104.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 390

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 100/366 (27%), Positives = 157/366 (42%), Gaps = 40/366 (10%)

Query: 10  VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFLI 68
             +    G ++  +Y  + +  P  GYYS     FG  GDF+TAPE++ +FG+ LA  + 
Sbjct: 24  AEIAAAGGWLSFARYMEITLYAPGLGYYSGGARKFGPGGDFITAPELTPLFGQALASQV- 82

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQ 126
              EQ    S   ++E+G G G++  D+L  + +    PD + +L +   E  ER     
Sbjct: 83  ---EQVMRASAPAVIEVGAGTGLLATDLLLELERRGCLPDSYGILELSG-ELRERQFDTL 138

Query: 127 KKQLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH- 184
             Q      ++ W  SL   P  F+  +VANE  D +P+   V    G+ ER + + Q  
Sbjct: 139 ASQAPHLAGRVRWLESL---PESFSGAVVANEVLDVMPVHLVVARAEGLFERGVAVVQRE 195

Query: 185 DSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSIS-----------DRLACDG 233
           D       D          +     A+   +P     +  I+           +RL    
Sbjct: 196 DGPALQWADVPAAGAVREAAL----ALQLPTPSSGEYVTEINLAGGAWVAAWAERL--RQ 249

Query: 234 GTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G  ++IDYG      YL SR G TL    + H +  P + PG  D+++ VDF  ++  A 
Sbjct: 250 GAMLLIDYGYPRAEYYLPSRSGGTLLCYYRHHAHGDPFLWPGLNDITAFVDFTAVAEAAF 309

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFK 346
              L + G TTQ +FL   G+ +    L ++   +        R V      + MGELFK
Sbjct: 310 GAGLDVTGYTTQAQFLFNCGVLE---CLARRGPEERPEYIRAARAVQRLTAPQEMGELFK 366

Query: 347 ILVVSH 352
           +L VS 
Sbjct: 367 VLAVSR 372


>gi|302877437|ref|YP_003846001.1| hypothetical protein Galf_0192 [Gallionella capsiferriformans ES-2]
 gi|302580226|gb|ADL54237.1| protein of unknown function DUF185 [Gallionella capsiferriformans
           ES-2]
          Length = 388

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 173/374 (46%), Gaps = 44/374 (11%)

Query: 4   KLIRKIVNLIK-KNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
           +LI  I   I  + G ++  +Y  L +  P  GYY+   + FG  GDF+TAPE+S +FG 
Sbjct: 22  RLIEAIHREIADQGGWISFARYMELALYAPGLGYYTAGAHKFGEAGDFITAPELSPLFGR 81

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETS 119
            LA  +    E+    S   ++ELG G G + +D+L  + +L   PD + +L +     +
Sbjct: 82  TLARQVAQIMEE----SAPHILELGAGSGKLAVDMLGELERLGRLPDSYCILEVSADLRA 137

Query: 120 ERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
            +  LI  + L     +++W  +L +   G   +VANE  D+LP+      +  + E  +
Sbjct: 138 RQQALI-GQCLPHLLGRVHWLDALPEQVKG--AVVANEVLDALPVHLVRWQDSALSEIGV 194

Query: 180 DIDQHDSLVFN--IGDHEI--KSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC--DG 233
            +D+   +     I D ++   +  +   D ++  I     C     + +   LAC    
Sbjct: 195 ALDESGFVRVERAIADAQLLQAAQQIKVPDNYVSEI-----C--LAARGLVTSLACRLTQ 247

Query: 234 GTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           GT + IDYG      Y   R+  TL     H  +      PG  D+++HV+F  ++   I
Sbjct: 248 GTLLFIDYGFGAREFYHPQRLNGTLMCHYRHRAHDDAFFLPGLQDITAHVNFTDIAETGI 307

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-----LLDSVKRLVSTSADKKSM 341
              L ++G T+Q  FL   GI      LM +T+ +D+     L   +++L S +     M
Sbjct: 308 DAGLELSGYTSQAFFLINNGI----ADLMVETSPEDLRAYLPLSAQLQKLTSPA----EM 359

Query: 342 GELFKILVVSHEKV 355
           GELFK++ +S  + 
Sbjct: 360 GELFKVIALSKNRA 373


>gi|56477341|ref|YP_158930.1| hypothetical protein ebA3370 [Aromatoleum aromaticum EbN1]
 gi|56313384|emb|CAI08029.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 386

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 168/370 (45%), Gaps = 42/370 (11%)

Query: 4   KLIRKI-VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
           +L+R I  ++    G +   +Y  L +  P  GYYS     FG  GDF+TAPE++ +FG+
Sbjct: 16  RLVRSITASIAAAGGWIPFSRYMELALYSPGLGYYSGGARKFGPGGDFITAPELTPLFGQ 75

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETS 119
            LA  +    EQ    S   ++E G G G++  D+L  + + +  P+ + +L +      
Sbjct: 76  ALAAQV----EQVMRASAAHVIEAGAGTGLLAADLLLELERRECLPETYGILELSGELRE 131

Query: 120 ERLTLIQKK--QLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRE 176
            +  L+ +K  +LAS   ++ W  +L   P  F+  LVANE  D +P+   V    G+ E
Sbjct: 132 RQFDLLAEKAPRLAS---RVRWLDAL---PERFSGALVANEVLDVMPVHLVVSRPEGLFE 185

Query: 177 RMIDIDQHDSLVF-------NIGD--HEIKSNFLTCSDYFLGAIFENSPCRDREMQSISD 227
           R + +D   +L +        + D    +        +Y    + E +      +   + 
Sbjct: 186 RGVAVDPAGTLRWADSPASGAVADAARALDLPLPESGEY----VTELNLAARAWVGEWAQ 241

Query: 228 RLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQR 280
           RL C  G  +++DYG      YL SR   TL    + H +  P + PG  D+++ VDF  
Sbjct: 242 RLDC--GVLLLVDYGYPRAEYYLPSRSNGTLLCYYRHHAHADPFLWPGLNDITAFVDFTS 299

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKS 340
           ++  A    L + G T Q  FL   G+ +       +T+   I      + ++T    + 
Sbjct: 300 VAEAAFDAGLDVLGYTNQAAFLFNCGLLECLARRGPETSADYIRAARAAQRLTT---PQE 356

Query: 341 MGELFKILVV 350
           MGELFK+L +
Sbjct: 357 MGELFKVLAL 366


>gi|282901111|ref|ZP_06309043.1| protein of unknown function DUF185 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194010|gb|EFA68975.1| protein of unknown function DUF185 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 396

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 100/360 (27%), Positives = 164/360 (45%), Gaps = 30/360 (8%)

Query: 3   NKLIRKIVNLIKKNGQ--MTVDQYFALCVADPEFGYYST-CNPFG-AVGDFVTAPEISQI 58
           N L + I + I  + Q  +T  +Y  L +   E+GYYS+     G A GDF T+P +   
Sbjct: 10  NPLYQIIADYIDTSDQRRITFAEYMDLVLYHSEYGYYSSHSGQIGFAGGDFFTSPSLGDD 69

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGE+LA   +  WE    P    LVE+G G G++   IL+ +    PDF+ ++   ++E 
Sbjct: 70  FGELLAKQFLQMWENLDQPRPFHLVEMGGGTGVLAFQILKFLKNHHPDFWEIIEYIIIEK 129

Query: 119 SERLTLIQKKQLASYGDKINWYTSLADVP---LGFTFLVANEFFDSLPIKQFVMTEHGIR 175
           S +L   Q+++L   G  + W      +P   +G  F  +NE  D+ P+ QF++ +  ++
Sbjct: 130 SPKLKWEQQQRLE--GFSVQWLDLPEILPGSMVGCFF--SNELVDAFPVHQFILEKGKLQ 185

Query: 176 ERMIDIDQHDSLVFN--IGDHEIK--SNFLTCS--DYFLGAIFEN--SPCRDREMQSISD 227
           E  +     + + F   +G+      + +L     D    A  EN  S      +  +S 
Sbjct: 186 EIYVTYRASNPIEFMEVVGEPSTPKLAEYLQLVEIDISQNAYPENYRSEINLAALDWLSI 245

Query: 228 RLAC-DGGTAIVIDYGYLQSRV------GDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQ 279
              C   G  + IDYGY  +R         TLQ    H Y  +P +  G+ D+++++DF 
Sbjct: 246 VANCLQRGYVLTIDYGYPATRYYHPRRSQGTLQCYYQHRYHHNPYIKVGEQDITTYIDFT 305

Query: 280 RLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILL---DSVKRLVSTSA 336
            L +      L   G T QG FL  LG+  R  +L  Q      LL   +++ +L+S   
Sbjct: 306 ALENWGKRCGLNPVGWTQQGLFLMALGLGDRISALSYQQHPLSQLLKRREALHQLISPEG 365


>gi|289207339|ref|YP_003459405.1| hypothetical protein TK90_0153 [Thioalkalivibrio sp. K90mix]
 gi|288942970|gb|ADC70669.1| protein of unknown function DUF185 [Thioalkalivibrio sp. K90mix]
          Length = 398

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 92/354 (25%), Positives = 157/354 (44%), Gaps = 39/354 (11%)

Query: 24  YFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRL 82
           Y    +  P  GYY +     GA GDFVTAPE+S +FGE LA +L             +L
Sbjct: 42  YMHQALYAPGLGYYVNGARKLGAGGDFVTAPELSSLFGETLASWLAPLLRDE-LAGGGQL 100

Query: 83  VELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD-----KI 137
           +E G G G +  D+L  + +L           ++E S  L  +Q++ LA   +     ++
Sbjct: 101 LEFGAGSGRLAGDVLVTLRELG---VGWQCYKIIEVSPDLRAVQQEHLAERLEPEEYARV 157

Query: 138 NWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFN------- 190
            W  +L + P+    ++ANE  D+LP++ F   E    +  + +D    LV         
Sbjct: 158 EWLDALPEEPI-RGVVLANEVLDALPVELFRWREGQPWQMGVTVDGDGRLVLAEQSAPEP 216

Query: 191 IGD--HEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC-DGGTAIVIDYGYLQS- 246
           + D   E+++      D +       S  R  +   ++   AC + G A+++DYG+ ++ 
Sbjct: 217 LADVVRELQAVHGPWPDGY------TSEWRPAQAAWVASVAACLEQGVALLVDYGFPRAA 270

Query: 247 ------RVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
                   G  +   +    + PL  PG  DL++ VDF  ++  A    L + G   QG+
Sbjct: 271 YYAAERHQGTLVGYYRQQMMLDPLAQPGLMDLTASVDFTAVAEAADAAGLDVLGYAAQGE 330

Query: 301 FLEGLGIWQR--AFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSH 352
           FL G G+ QR  A     + ARK +      R+++   +   MGE F+++ +  
Sbjct: 331 FLLGAGLAQRFEARVGSGEDARKTMQAAQAVRMLTLPGE---MGERFQVMTLGR 381


>gi|297181970|gb|ADI18146.1| uncharacterized conserved protein [uncultured Verrucomicrobiales
           bacterium HF0200_39L05]
          Length = 378

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 96/367 (26%), Positives = 153/367 (41%), Gaps = 28/367 (7%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
           N L   I   I  +G M   ++  L +  PEFGYY    +P G  GDFVT+  +   FG+
Sbjct: 23  NPLAGMIRAKIDDDGPMPFARFMELALYHPEFGYYEKEASPVGRQGDFVTSVSVGAAFGQ 82

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +LA +    W +      V++VE G   G +  DIL  +       F+ L   + E S +
Sbjct: 83  LLA-YRFAKWLE-AIDGPVQVVEAGAHDGTLAGDILEWLAANDEPLFARLRYVITEPSAK 140

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQ--FVMTEHGIRERMI 179
               Q K+LA +  ++ W  SL  +      +  NE  D+ P+ +  +   E G  E  +
Sbjct: 141 RQSWQAKRLAKFDAQLEWRDSLTGITEIRGVIFCNELLDAFPVNRIGWSKAERGWFEWAV 200

Query: 180 DIDQHDSLVFNI--GDHEIKSNFLTCSDYFLGAI-----FENSPCRDREMQSISDRLACD 232
           D          I  G    +S         L  +      E SP  +   ++ +D+LA  
Sbjct: 201 DWRDGAFCWEPIDGGGAAWRSLLPAWPSALLDVLPDQYTTELSPQANEWWRAAADQLAV- 259

Query: 233 GGTAIVIDYGY------LQSRVGDTLQAVKGHTYVSP-LVNPGQADLSSHVDFQRLSSIA 285
            G  I +DYGY        ++   T++  +    V   L +PG+ DL++H +F       
Sbjct: 260 -GKLIALDYGYGPDDWPTANQPDGTVRGYRRQKLVDDVLTDPGEQDLTAHANFGLAKQSG 318

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELF 345
               L     T+Q +FL G      AF+ M Q+A        V++L + +     MG  F
Sbjct: 319 EAAGLQTELFTSQERFLNG------AFAEMLQSAPALGQALDVRQLQALT-HPAHMGRPF 371

Query: 346 KILVVSH 352
           ++LV S 
Sbjct: 372 RVLVQSR 378


>gi|207742028|ref|YP_002258420.1| hypothetical protein RSIPO_04965 [Ralstonia solanacearum IPO1609]
 gi|206593414|emb|CAQ60341.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 397

 Score = 99.4 bits (246), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 103/386 (26%), Positives = 165/386 (42%), Gaps = 44/386 (11%)

Query: 3   NKLIRKIVNLIKK-NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEIS 56
           ++L   IV+ I+  +G +  ++Y  L +  P  GYYS     FG      GDF+TAPE++
Sbjct: 19  DRLFSTIVHAIEAADGWIPFERYMELALYAPGLGYYSGGAAKFGRRVEDGGDFITAPELT 78

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIY 114
             FG  +A   I    Q   P    ++E G G G +  DIL  +  L  +PD + +    
Sbjct: 79  PFFGRTVA-HQIAQVLQALPPGQRHVLEFGAGTGRLAADILTELETLGMRPDSYGI---- 133

Query: 115 MVETSERLTLIQKKQLASYGDKI----NWYTSLADVPLGFT-FLVANEFFDSLPIKQFVM 169
            VE S  L   Q++ LA+ G  +     W+  L   P  FT  +V NE  D++P+  +  
Sbjct: 134 -VELSGELRQRQQQALAALGPDLAGLARWHDRL---PARFTGAMVGNEVLDAMPVSLWAR 189

Query: 170 TEHGIRERMIDIDQHDSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQS 224
                  R +  D    L ++       E+      L   + F+    E +    R   +
Sbjct: 190 RGGAWHRRGVAFDAEHGLRWSERAAAPAEVPPKLAALPGREDFITESHEAAEGFIRSTGA 249

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
             +R     G  ++IDYG      Y   R   TL    + H +  P   PG  D+++HVD
Sbjct: 250 ALER-----GLLLLIDYGFPAAEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVD 304

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSA 336
           F  ++  A    L + G  +Q +FL G G+ Q   +L      R     ++V++L+S   
Sbjct: 305 FSGIARAAHEAGLEVLGYASQARFLLGAGVGQLLMTLDPADPVRFLPAANAVQKLLS--- 361

Query: 337 DKKSMGELFKILVVSHEKVELMPFVN 362
            +  MGELFK + +       +P   
Sbjct: 362 -EAEMGELFKAIALGRGIDAALPLAG 386


>gi|220933515|ref|YP_002512414.1| protein of unknown function DUF185 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994825|gb|ACL71427.1| protein of unknown function DUF185 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 393

 Score = 99.4 bits (246), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 95/354 (26%), Positives = 158/354 (44%), Gaps = 36/354 (10%)

Query: 16  NGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQH 74
            G +   +Y  L +  P  GYY+   +  GA GDF TAPE S +F   LA  +    E+ 
Sbjct: 33  GGFLPFRRYMELALYAPGLGYYAAGSHKLGAGGDFTTAPETSPLFARCLARQVAQVLEEL 92

Query: 75  GFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKKQLA- 131
           G     +++E G G G + +++LR +  L   P+ + +L     E S  L   Q+  +A 
Sbjct: 93  G---GGQVLEFGAGTGALAVEMLRALAALDRLPEQYLIL-----ELSPDLRERQQAAVAD 144

Query: 132 ---SYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDID----- 182
              +   ++ W  +L   P GF   ++ NE  D++P++ F  T   + +R +  +     
Sbjct: 145 LPEALAARVCWLDALP--PRGFRGVMLGNEVLDAMPVEVFTWTGESVLQRGVAWEGGRFV 202

Query: 183 -QHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
                    +G    +    T S +  G   E SP     + S+++ LA   G  ++IDY
Sbjct: 203 WAERPAEPGLGAAVQRLQAETGSAWPPGYTSEYSPGLAPWVASLAEVLAA--GLILLIDY 260

Query: 242 GYLQS------RVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           GY ++      R   TL     H  +  P   PG ADL++HVDF  ++   +   L + G
Sbjct: 261 GYPRAEYYSPERSRGTLMGYYRHRALDDPFFLPGLADLTAHVDFTAVAEAGVGAGLDVLG 320

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
            TTQ  FL G G+ Q       +  R+ + L    R ++   +   MGE F+++
Sbjct: 321 YTTQAWFLIGAGLDQVFQEAASEDPREQLALAGQVRQLTLPGE---MGERFQVI 371


>gi|313200027|ref|YP_004038685.1| hypothetical protein MPQ_0260 [Methylovorus sp. MP688]
 gi|312439343|gb|ADQ83449.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 385

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 156/357 (43%), Gaps = 34/357 (9%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEMLAIF--- 66
           ++ +  G +   QY  L +  P  GYYS     FG  GDFVTAPE+S +F   LA+    
Sbjct: 26  HIAEAGGWLDFAQYMDLVLYAPSLGYYSAGAKKFGPAGDFVTAPELSPLFARTLAMQAAD 85

Query: 67  LICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTL 124
           ++ A       +   ++ELG G G +  D+L  + +L+  P  + +L I       +   
Sbjct: 86  ILSA-------TAGDVLELGAGSGRLAADLLLELDRLQQLPSQYRILEISAYLRQVQKDY 138

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMIDI-- 181
           +QK        ++ W  SL   P  F+ LV  NE  D+LP+        G+ +R + +  
Sbjct: 139 LQKVLPPHLMQRVEWLDSL---PEAFSGLVLGNEVLDALPVHIVHQQADGLLQRGVGLAP 195

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
           D     V    D  I++ F    +  L   +    C        S       G  ++IDY
Sbjct: 196 DAELQWVDQPADALIQAAF---RETRLPESYTTEICMAAGGLIASLASMLQRGVVLLIDY 252

Query: 242 GYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           G+        Q + G  +   + H +  P + PG  D+++HVDF R++  A+   L + G
Sbjct: 253 GFPRHEYYHPQRQQGTLMCHYRHHAHTDPFLYPGLQDITAHVDFTRIAESAMQQGLAVMG 312

Query: 295 LTTQGKFLEGLGIWQRAFSLMKQ-TARKDILLDSVKRLVSTSADKKSMGELFKILVV 350
             +Q +FL   GI +    +     A    L  S ++L+S +     MGELFK++ V
Sbjct: 313 YASQAQFLINCGITECLVEVSPHDVAAYAPLASSAQKLLSPA----EMGELFKVIAV 365


>gi|40063245|gb|AAR38072.1| conserved hypothetical protein [uncultured marine bacterium 577]
          Length = 398

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 101/369 (27%), Positives = 159/369 (43%), Gaps = 52/369 (14%)

Query: 17  GQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHG 75
           G +  ++Y  L +  P  GYY S    FG  GDFVTAPE+S +FG  +A   +   E  G
Sbjct: 31  GWIPFERYMELAIYSPGMGYYCSGTTKFGCAGDFVTAPEVSSLFGRAIAQQAVQIIESVG 90

Query: 76  FPSCVRLVELGPGRGIMMLDI--LRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASY 133
             S   ++E G G G + LDI          P  + +L     E S  L   Q K  A +
Sbjct: 91  EDSS-DILEFGAGTGKLALDILLELENLNRLPRHYLIL-----EVSGELQEKQNKLFAKF 144

Query: 134 G----DKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLV 188
                 ++ W   L  +P  F  L+ ANE  D++P+      ++ + ER         +V
Sbjct: 145 APHLMSRVQW---LEQLPTKFKGLILANEVLDAMPVHLVARRDNDLFER--------GVV 193

Query: 189 FNIGDHEIKSNFLTCSDYFLGA---IFENSPCRDREMQSISD-RLACDG----------- 233
           +N    E     L   + F  A   I   SP        IS+  L+  G           
Sbjct: 194 WNGKRFEWSDRLLVEGELFRIAEEIIPLASPDNKNIEIYISEINLSARGFIRSIANILEK 253

Query: 234 GTAIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G  ++IDYG+        Q   G  +   + H +  P   PG  D++SHVDF  ++ +A 
Sbjct: 254 GAVVLIDYGFGRDEYYHEQRNRGTMMCHYRHHAHDDPFYFPGLQDITSHVDFTAITDVAA 313

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSADKKSMGELF 345
              L + G T+Q +FL   GI +    + ++ T+    + + +++LVS +     MGELF
Sbjct: 314 GEGLELLGYTSQAQFLINCGITEILSRIPVENTSDYLPMANQMQKLVSPA----EMGELF 369

Query: 346 KILVVSHEK 354
           K++ +  + 
Sbjct: 370 KVIALGKDN 378


>gi|297537480|ref|YP_003673249.1| hypothetical protein M301_0285 [Methylotenera sp. 301]
 gi|297256827|gb|ADI28672.1| protein of unknown function DUF185 [Methylotenera sp. 301]
          Length = 388

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 171/374 (45%), Gaps = 52/374 (13%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFG----AVGDFVTAPEISQIF 59
           LI+K +N   + G ++  ++  L +  P  GYYS     FG      GDFVTAP+IS +F
Sbjct: 21  LIQKTIN--AQKGWISFAEFMHLALYAPGLGYYSAGSQKFGDSKKGGGDFVTAPQISPLF 78

Query: 60  GEMLAIFLICAWE-QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV-E 117
            + ++  +    +  HG      ++ELG G G +  DIL  + +L     SV + Y + E
Sbjct: 79  AQTISNQIAQVLDITHG-----NILELGAGTGKLAADILLTMAELG----SVPAKYFILE 129

Query: 118 TSERLTLIQKKQLAS-----YGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTE 171
            S+ L  +Q + L S        ++ W T L   P  F   ++ NE  D++P+    +  
Sbjct: 130 VSDHLRQVQLETLQSKLPQNLVQRVEWLTEL---PSNFNGVIIGNEVLDAIPVHMVNVKN 186

Query: 172 HGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFL--GAIFENSPCRDREMQSISDRL 229
            GI E  I ++  +  V+        S     S   L  G + E  P     + S++  L
Sbjct: 187 DGIYEHGIVVEDGE-FVWQDKISSEPSMLDAVSKLNLPEGYVTEICPAASGLITSLAHSL 245

Query: 230 ACDGGTAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLS 282
               G  ++IDYG+        Q   G  +   + + +  PL+N G  D+++HVDF  ++
Sbjct: 246 --QQGIILMIDYGFAAREYYHPQRNQGTLMCHYQHYAHSDPLINIGLQDITAHVDFTSIA 303

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-----LLDSVKRLVSTSAD 337
              + + L ++G  +Q +FL   GI      LM Q +  D+     L  + ++L+S +  
Sbjct: 304 HAGVNHGLALSGFCSQAQFLMNCGI----LELMSQVSPHDMARYAPLAAAAQKLLSPA-- 357

Query: 338 KKSMGELFKILVVS 351
              MG+LFK++  S
Sbjct: 358 --EMGDLFKVVAFS 369


>gi|294341578|emb|CAZ89995.1| conserved hypothetical protein [Thiomonas sp. 3As]
          Length = 397

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/323 (30%), Positives = 147/323 (45%), Gaps = 33/323 (10%)

Query: 4   KLIRKI-VNLIKKNGQMTVDQYFALCVADPEFGYYS----TCNPFGAVGDFVTAPEISQI 58
           +L+ +I   L    G +  D Y    +  P  GYY+        FG+  DFVTAPE+S +
Sbjct: 8   QLLAQIRAALHAGGGWLPFDAYMQQALYAPGLGYYTGQAGQFGDFGSDSDFVTAPELSPL 67

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIYMV 116
           FG  LA  +    +Q    +   +VE G G G +   IL  +  L   P  +++     V
Sbjct: 68  FGRTLAAQVAQVLQQGDLHT---VVEFGAGSGRLAAQILGELDHLGCAPRHYAI-----V 119

Query: 117 ETSERLTLIQKKQLASYG----DKINWYTSLADVPLGF-TFLVANEFFDSLPIKQFVMTE 171
           E S  L   Q + L S      D++ W+T+L   P  F    ++NE  D++P+K     E
Sbjct: 120 EVSGALKHRQMQTLRSAVPHLFDRVQWWTAL---PETFEAVAISNEVLDAMPVKLLHRHE 176

Query: 172 HGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC 231
            G  ER +   + D LVF      +           +G + E  P     +++++DRLA 
Sbjct: 177 GGWMERGV-AQEGDDLVFADRATALLPPAPEAHALPIGTVTEIHPQALAFVRTLADRLAR 235

Query: 232 DGGTAIVIDYGYLQ------SRVGDTLQAVKGHTYVSP-LVNPGQADLSSHVDFQRLSSI 284
             G A+ IDYG+ Q       R   TLQA   H  +   L+ PG AD+++HVDF  ++  
Sbjct: 236 --GAALFIDYGFPQREYYHPQRHMGTLQAHYRHRVLDDVLLWPGLADITAHVDFTAIALA 293

Query: 285 AILYKLYINGLTTQGKFLEGLGI 307
           A    L + G T+Q  FL   G+
Sbjct: 294 AQDAGLDVLGYTSQASFLMNCGL 316


>gi|83745953|ref|ZP_00943009.1| Hypothetical cytosolic protein [Ralstonia solanacearum UW551]
 gi|83727347|gb|EAP74469.1| Hypothetical cytosolic protein [Ralstonia solanacearum UW551]
          Length = 491

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 103/386 (26%), Positives = 165/386 (42%), Gaps = 44/386 (11%)

Query: 3   NKLIRKIVNLIKK-NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEIS 56
           ++L   IV+ I+  +G +  ++Y  L +  P  GYYS     FG      GDF+TAPE++
Sbjct: 113 DRLFSTIVHAIEAADGWIPFERYMELALYAPGLGYYSGGAAKFGRRVEDGGDFITAPELT 172

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIY 114
             FG  +A   I    Q   P    ++E G G G +  DIL  +  L  +PD + +    
Sbjct: 173 PFFGRTVA-HQIAQVLQALPPGQRHVLEFGAGTGRLAADILTELETLGMRPDSYGI---- 227

Query: 115 MVETSERLTLIQKKQLASYGDKI----NWYTSLADVPLGFT-FLVANEFFDSLPIKQFVM 169
            VE S  L   Q++ LA+ G  +     W+  L   P  FT  +V NE  D++P+  +  
Sbjct: 228 -VELSGELRQRQQQALAALGPDLAGLARWHDRL---PARFTGAMVGNEVLDAMPVSLWAR 283

Query: 170 TEHGIRERMIDIDQHDSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQS 224
                  R +  D    L ++       E+      L   + F+    E +    R   +
Sbjct: 284 RGGAWHRRGVAFDAEHGLRWSERAAAPAEVPPKLAALPGREDFITESHEAAEGFIRSTGA 343

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
             +R     G  ++IDYG      Y   R   TL    + H +  P   PG  D+++HVD
Sbjct: 344 ALER-----GLLLLIDYGFPAAEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVD 398

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSA 336
           F  ++  A    L + G  +Q +FL G G+ Q   +L      R     ++V++L+S   
Sbjct: 399 FSGIARAAHEAGLEVLGYASQARFLLGAGVGQLLMTLDPADPVRFLPAANAVQKLLS--- 455

Query: 337 DKKSMGELFKILVVSHEKVELMPFVN 362
            +  MGELFK + +       +P   
Sbjct: 456 -EAEMGELFKAIALGRGIDAALPLAG 480


>gi|189423454|ref|YP_001950631.1| hypothetical protein Glov_0383 [Geobacter lovleyi SZ]
 gi|189419713|gb|ACD94111.1| protein of unknown function DUF185 [Geobacter lovleyi SZ]
          Length = 378

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 161/372 (43%), Gaps = 48/372 (12%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFL 67
           I + I+  G++T   Y A C+ +P  GYY S     G  GDF T+  +   FG ++A  +
Sbjct: 10  IADRIRAAGRITFADYMAACLYEPGLGYYTSPGRKVGTEGDFYTSITVHATFGRVIAREI 69

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              W     P+   LVE G G G +  DI+  + + +PD ++   + +VE    L   Q 
Sbjct: 70  AAMWRSMDCPADFTLVEAGAGHGRLACDIMDFLAEQQPDCYAATKLVLVEQEPTLAEAQA 129

Query: 128 KQLASYGDKINWYTSLADVPLGFTF---LVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
             LA++  +++W  S A++P GF F   L +NE  D++P+ + +M+  G++E  + +D  
Sbjct: 130 ALLANHAARLSWL-SPAELP-GFRFSGVLYSNELLDAMPVHRVLMSPQGLKEIYVTLD-- 185

Query: 185 DSLVFNIGDHEIKSNFLTCSDYFLGAIFEN-----SPCRDRE-----MQSISDRLAC-DG 233
                  GD     + L  S   L A  +       P ++ E     +    D   C   
Sbjct: 186 -------GDQFQDQSDLP-STPALAAYLDRFGIPLHPGQEAEVSLAGLAWFEDVAECLQQ 237

Query: 234 GTAIVIDYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G  + IDYG+        Q  +G  L   K     +P    GQ D+++H++F  L     
Sbjct: 238 GFILTIDYGWAKAELYSPQRNLGTLLCYYKHTVEDNPYQRLGQQDITTHINFSALIERGE 297

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-------LLDSVKRLVSTSADKK 339
              L       Q +FL   G+ +     ++Q    D+       L   +KRL+       
Sbjct: 298 ELGLKPLWFGEQSRFLLSAGVIEE----LEQIEASDLPEKDKLRLRLIIKRLIMPEG--- 350

Query: 340 SMGELFKILVVS 351
            MG+ F++LV S
Sbjct: 351 GMGDTFRVLVQS 362


>gi|300705454|ref|YP_003747057.1| hypothetical protein RCFBP_21301 [Ralstonia solanacearum CFBP2957]
 gi|299073118|emb|CBJ44476.1| conserved protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 420

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 102/386 (26%), Positives = 164/386 (42%), Gaps = 44/386 (11%)

Query: 3   NKLIRKIVNLIKK-NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEIS 56
           ++L   IV+ I+   G +  ++Y  L +  P  GYYS     FG      GDF+TAPE++
Sbjct: 42  DRLFSTIVHAIEAAGGWIPFERYMELALYAPGLGYYSGGAAKFGRRVEDGGDFITAPELT 101

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIY 114
             FG  +A   I    Q   P    ++E G G G +  DIL  +  L  +PD + +    
Sbjct: 102 PFFGRTVA-HQIAQVLQALPPGQRHVLEFGAGTGRLAADILTELETLGMRPDSYGI---- 156

Query: 115 MVETSERLTLIQKKQLASYGDKI----NWYTSLADVPLGFT-FLVANEFFDSLPIKQFVM 169
            VE S  L   Q++ LA+ G  +     W+  L   P  FT  ++ NE  D++P+  +  
Sbjct: 157 -VELSGELRQRQQQALAALGPDLAGLARWHDRL---PARFTGAMIGNEVLDAMPVSLWAR 212

Query: 170 TEHGIRERMIDIDQHDSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQS 224
                  R +  D    L ++       E+      L   + F+    E +    R   +
Sbjct: 213 RGGAWHRRGVAFDAEHGLRWSERAAAPAEVPPKLAALPGHEDFVTESHEAAEGFIRSTGA 272

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
             +R     G  ++IDYG      Y   R   TL    + H +  P   PG  D+++HVD
Sbjct: 273 ALER-----GLLLLIDYGFPAAEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVD 327

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSA 336
           F  ++  A    L + G  +Q +FL G G+ Q   +L      R     ++V++L+S   
Sbjct: 328 FSGIARAAHEAGLEVLGYASQARFLLGAGVGQLLMTLDPADPVRFLPAANAVQKLLS--- 384

Query: 337 DKKSMGELFKILVVSHEKVELMPFVN 362
            +  MGELFK + +       +P   
Sbjct: 385 -EAEMGELFKAIALGRGIDAALPLAG 409


>gi|15606056|ref|NP_213433.1| hypothetical protein aq_622 [Aquifex aeolicus VF5]
 gi|2983237|gb|AAC06834.1| hypothetical protein aq_622 [Aquifex aeolicus VF5]
          Length = 320

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 100/321 (31%), Positives = 148/321 (46%), Gaps = 30/321 (9%)

Query: 36  YYSTCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLD 95
           YYS+     A+ DF TAPE+ + FGE LA F      +   P+   LVELG GRG++  D
Sbjct: 17  YYSSQR---ALKDFFTAPELDRAFGEALAEFFSQHLSEFERPA---LVELGAGRGLLAYD 70

Query: 96  ILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVA 155
           IL       PD F+ L  Y+ E S  L   Q++ L ++ + + W   L  V  G  F  +
Sbjct: 71  ILNYYRANYPDLFNRLKYYIYEFSPYLISKQREVLKNFKN-VEWVEELPKVE-GIVF--S 126

Query: 156 NEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDY-FLGAIFEN 214
           NEFFD+LP+    + + G   + + +D+  S V+   ++E    FL   +Y  L  I E 
Sbjct: 127 NEFFDALPVH---IVKGG---KELYVDEKGSEVWLSLENEKVKEFLRRMNYENLNQIVEV 180

Query: 215 S-PCRDREMQSISDRLACDGGTAIVIDYGYLQSRVGD----TLQAVKGHTYVSP-LVNPG 268
              C D  ++ IS+ L    G   VIDYGY    +      T+ A K H  V   L   G
Sbjct: 181 CLDCIDM-LKKISESLV--EGYHFVIDYGYTSEEITKYPEGTVVAYKEHKVVKDFLKEAG 237

Query: 269 QADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSV 328
            AD+++HV+F  L      + L      +Q  FL  +  +      +          +SV
Sbjct: 238 NADITAHVNFSALMEYGRDFGLETILFQSQRDFLMHIPTFLNELEKLSWEESA----ESV 293

Query: 329 KRLVSTSADKKSMGELFKILV 349
           +RL        SMG+ FK+L+
Sbjct: 294 ERLSRLKTMLISMGDRFKVLL 314


>gi|189218955|ref|YP_001939596.1| hypothetical protein Minf_0943 [Methylacidiphilum infernorum V4]
 gi|189185813|gb|ACD82998.1| Uncharacterized conserved protein [Methylacidiphilum infernorum V4]
          Length = 392

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 160/373 (42%), Gaps = 29/373 (7%)

Query: 1   MENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYS--TCNPFGAVGDFVTAPEISQI 58
           +E+ L++++  LI + G +  D Y ++    P+FGYYS  T    G  GDF T+  +  +
Sbjct: 7   VESPLLKELFYLIDQKGPIPFDAYMSMHQGHPQFGYYSRGTQKKIGKNGDFFTSVSVGSL 66

Query: 59  FGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVET 118
           FGE LA      W+Q      + ++E G G G +  DI+  + K +P     LS   +E 
Sbjct: 67  FGECLARQCCEVWKQLEMNGSLWILEAGAGGGELACDIVDWLDKNEPGLSKNLSYLFLEP 126

Query: 119 -----SERLTLIQKKQLASYGDKINWYTSLADVPL--GFTFLVANEFFDSLPIKQFVMTE 171
                 E+   IQK+   ++  + +W+    D+P       L+ANEF DSLP K+     
Sbjct: 127 FAENQEEQRKEIQKRMGKTH--RFHWFLGWEDLPTLSSPVILIANEFLDSLPFKRITFRH 184

Query: 172 HGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC 231
               E+ +  ++ + L F   D  I    L   D               E+ + + +   
Sbjct: 185 GQWMEQYLYSNKENKLCFV--DLPITKGSL-LEDLVHKIALPEIDGYTTEIHTEAWKWIF 241

Query: 232 DGGTAI------VIDYG------YLQSRVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDF 278
             GT +      +IDYG      +   R   TL+  K H   S PL+ PG +D+++H++F
Sbjct: 242 QAGTKLDSSLFFIIDYGLSEGEYFAPWRSKGTLRCYKDHKVFSDPLLFPGISDITAHLNF 301

Query: 279 QRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADK 338
             +   A    +   G   Q  F   +G   +  S+      KD   +S  R     +  
Sbjct: 302 SLVVKAAEESGMEAIGWLDQHHFF--MGWLDQMHSMDPLFLLKDPRRESWIRKFFMLSHP 359

Query: 339 KSMGELFKILVVS 351
             MG+ FK L++S
Sbjct: 360 LFMGKNFKFLLLS 372


>gi|17544874|ref|NP_518276.1| hypothetical protein RSc0155 [Ralstonia solanacearum GMI1000]
 gi|17427163|emb|CAD13683.1| hypothetical protein of unknown function duf185 [Ralstonia
           solanacearum GMI1000]
          Length = 397

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/386 (26%), Positives = 164/386 (42%), Gaps = 44/386 (11%)

Query: 3   NKLIRKIVNLIKK-NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEIS 56
           ++L   IV  ++   G +  ++Y  L +  P  GYYS     FG      GDF+TAPE++
Sbjct: 19  DRLFSTIVRAVEAAGGWLPFERYMELALYAPGLGYYSGGAAKFGRRVEDGGDFITAPELT 78

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIY 114
             FG  +A   I    Q   P    ++E G G G +  DIL  +  L  +PD + +    
Sbjct: 79  PFFGRTVA-HQIAQVLQTLPPGQRHVLEFGAGTGRLAADILTELETLGMRPDSYGI---- 133

Query: 115 MVETSERLTLIQKKQLASYGDKI----NWYTSLADVPLGFT-FLVANEFFDSLPIKQFVM 169
            VE S  L   Q++ LA+ G  +     W+ +L   P  FT  +V NE  D++P+  +  
Sbjct: 134 -VELSGELRQRQQQALAALGPDLAGLARWHDAL---PARFTGVMVGNEVLDAMPVSLWAR 189

Query: 170 TEHGIRERMIDIDQHDSL-----VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS 224
                  R +  D    L     V +  D   K   L   D F+    E +    R   +
Sbjct: 190 RGGVWHRRGVAFDADHGLRWSERVADPADVPPKLAALPGRDDFVTEAHEAAEGFIRSAGA 249

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
             +R     G  +++DYG      Y   R   TL    + H +  P   PG  D+++HVD
Sbjct: 250 ALER-----GLLLLLDYGFPAGEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVD 304

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSA 336
           F  ++  A    L + G  +Q +FL G G+ Q   +L      R     ++V++L+S   
Sbjct: 305 FSGIALAAREAGLEVLGYASQARFLLGAGVGQLLMTLDPADPVRFLPAANAVQKLLS--- 361

Query: 337 DKKSMGELFKILVVSHEKVELMPFVN 362
            +  MGELFK + +       +P   
Sbjct: 362 -EAEMGELFKAIALGRGLDAALPLAG 386


>gi|114331493|ref|YP_747715.1| hypothetical protein Neut_1505 [Nitrosomonas eutropha C91]
 gi|114308507|gb|ABI59750.1| protein of unknown function DUF185 [Nitrosomonas eutropha C91]
          Length = 391

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 95/358 (26%), Positives = 159/358 (44%), Gaps = 40/358 (11%)

Query: 17  GQMTVDQYFALCVADPEFGYYSTCNPFGAVG-DFVTAPEISQIFGEMLA--IFLICAWEQ 73
           G ++   Y  + +  PE GYYS          DFVT+PEIS +FG+ LA  +  +     
Sbjct: 30  GWISFADYMDIVLYTPEAGYYSGGAAKFGAAGDFVTSPEISPLFGQTLARQVAQVLRSVN 89

Query: 74  HGFPSCVRLVELGPGRG--IMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLA 131
           HG      ++E G G G   + L +     +  P+++++L +   +  +R   I K+++ 
Sbjct: 90  HG-----SILEFGAGSGKLAVDLLLALEALESLPEYYNILDL-SADLQQRQQAIIKQRIP 143

Query: 132 SYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI----------DI 181
               ++ W T+L D   G  F  ANE  D++P+   V     I ER +          D 
Sbjct: 144 HLAARVQWLTALPDQFKGLIF--ANEVLDAMPVHLVVWKNGNIAERGVIWKDYELAWQDQ 201

Query: 182 DQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDY 241
              +  + N+      S+  +    ++  I   S      + S++  L    G  +++DY
Sbjct: 202 PLTEGELLNVARQLPPSDQPSFPHPYISEI---SLANRHFIHSLASIL--QQGAILLVDY 256

Query: 242 GYLQSRV-------GDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYING 294
           G+ QS         G  +   + H +  PL  PG  D++SHVDF  +S IA+   L + G
Sbjct: 257 GFGQSEYYHPQRHQGTLMCHYRHHAHDDPLFLPGLQDITSHVDFSAISRIALDSGLQLAG 316

Query: 295 LTTQGKFLEGLGIWQ-RAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVS 351
            TTQ  FL   GI    A +   Q      L+   + L+S +     MGELFK+++++
Sbjct: 317 YTTQAHFLINCGITDLLAHTPADQPGIYLPLVSQAQCLISPA----EMGELFKVMILN 370


>gi|148244557|ref|YP_001219251.1| hypothetical protein COSY_0408 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326384|dbj|BAF61527.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 373

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/366 (28%), Positives = 167/366 (45%), Gaps = 36/366 (9%)

Query: 12  LIKKNGQMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFLICA 70
           +I+  G +  D++  L +  P  GYY S    F   GDF+TAPE S +FG  LA    CA
Sbjct: 20  IIQNAGPIGFDEFMNLALYYPALGYYRSGLEKFSKNGDFITAPETSDLFGFCLAN--QCA 77

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKK 128
              +G      ++E G G GI+   IL  + +LK  P  + +L +   E   R      K
Sbjct: 78  QVLNG---TNDILEFGSGSGILATQILFELGRLKKLPQKYYILEL-SGELKHRQAETISK 133

Query: 129 QLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSL 187
            L    D+I W   L ++P  F+  ++ANE  D++P K+ +       E  + ID H++ 
Sbjct: 134 VLPELIDRIVW---LDELPSDFSGVVIANEVLDAMPAKRVIYKNKQFYE--LGIDHHENE 188

Query: 188 VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSIS--DRL--ACDGGTAIVIDYG- 242
            F     +  S +          + E+    +  + +I+  D L  A +    ++IDYG 
Sbjct: 189 FFW---RKFDSPYQNDKILLPNNVIEDYRT-EINLHAIAWIDSLYNATNKALVLLIDYGM 244

Query: 243 -----YLQSRVGDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
                +   R+  TL+    H    +P +N G+ D+++ V+F  ++  A +    +NG  
Sbjct: 245 SRDEYFHPQRLDGTLRCYYHHKASENPFLNIGKQDITTSVNFSDIADQASISGFKVNGYA 304

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILVVSHE-KV 355
           TQ  FL  LGI         +  R + L   +K+LV  S     MGE FK+L +S +  V
Sbjct: 305 TQALFLISLGISDYLLKQKDKNKRMN-LAQQIKQLVLPSV----MGESFKVLALSKKLSV 359

Query: 356 ELMPFV 361
            L+ FV
Sbjct: 360 RLIGFV 365


>gi|67921448|ref|ZP_00514966.1| Protein of unknown function DUF185 [Crocosphaera watsonii WH 8501]
 gi|67856560|gb|EAM51801.1| Protein of unknown function DUF185 [Crocosphaera watsonii WH 8501]
          Length = 377

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 99/343 (28%), Positives = 152/343 (44%), Gaps = 47/343 (13%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEMLAIFLICAWEQH 74
           N  +T   Y  L +  P+ GYYS+     G+ GDF T+  +   FGE+LA       EQ 
Sbjct: 14  NNCITFADYMDLVLYHPQKGYYSSAQIDIGSQGDFFTSSSLGSDFGELLA-------EQF 66

Query: 75  GFPSCV-------RLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              S V        LVE+G G G +  DIL       PDF+  +   +VE S+ L   QK
Sbjct: 67  KEMSAVLNSSDSFTLVEVGAGTGSLAADILHYFKIQYPDFYQNIKYIIVEESQGLIAEQK 126

Query: 128 KQLASYGDKINWYTSLADVP----LGFTFLVANEFFDSLPIKQFVMTEHGIRERMI--DI 181
            +L  + + + W  S  D+     +G  F  +NE  D+ P+ Q V+ +  ++E  +  + 
Sbjct: 127 HKLQEF-EIVTW-KSWQDITDNSIVGCIF--SNELIDAFPVHQIVVEDQTVKEIYLTWEN 182

Query: 182 DQHDSLVFNIGDHEIKSNF------LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           +Q   ++ N     +   F      LT  DY      E +      +Q +++++    G 
Sbjct: 183 NQIKEIIDNTSSPRLLEYFQLVDIDLTRDDYPENYRTEVNLKALDWLQVVTNKIK--KGY 240

Query: 236 AIVIDYGYLQS------RVGDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSIAILY 288
            + IDYGY  S      R   TL     H +  +P VN G+ D+++HV+F  L     L 
Sbjct: 241 LLTIDYGYSASKYYHPQRYQGTLNCYYQHRHHHNPYVNLGEQDITTHVNFTALEKQGNLL 300

Query: 289 KLYINGLTTQGKFLEGLGIWQR-------AFSLMKQTARKDIL 324
            L   GLT QG FL  LG+  R        ++L +   R+D L
Sbjct: 301 GLETVGLTQQGLFLMALGLGDRLSELSNGNYTLPEILKRRDAL 343


>gi|195329890|ref|XP_002031643.1| GM23933 [Drosophila sechellia]
 gi|194120586|gb|EDW42629.1| GM23933 [Drosophila sechellia]
          Length = 169

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 67/106 (63%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGE 61
           +  L +++   I   G + V +Y    + +P+ GYY   + FG  GDF+T+PEISQIFGE
Sbjct: 39  DGSLAKQLRAKILSTGPIPVAEYMREVLTNPQAGYYMNRDVFGREGDFITSPEISQIFGE 98

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDF 107
           ++ I+L+  W + G PS   LVELGPGRG +  D+L+V+ K K ++
Sbjct: 99  LVEIWLVSEWRKMGCPSPFLLVELGPGRGTLARDVLKVLTKFKQEY 144


>gi|153873329|ref|ZP_02001946.1| protein containing DUF185 [Beggiatoa sp. PS]
 gi|152070205|gb|EDN68054.1| protein containing DUF185 [Beggiatoa sp. PS]
          Length = 406

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 113/397 (28%), Positives = 178/397 (44%), Gaps = 68/397 (17%)

Query: 3   NKLIRKIVNLIKKNGQ-MTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFG 60
            +LI KI  L+  NG+ +   ++    +  P  GYYS   +  G  GDF+TAPEIS +F 
Sbjct: 16  QQLINKI--LLAMNGEAIPFVKFMEQALYAPGLGYYSAGIHKLGEKGDFITAPEISPLFS 73

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYM-VE 117
             +A    C      F S V ++E G G G M  +IL+ + +L   P  + +L +   ++
Sbjct: 74  HCVAK--QCQQILASFESGV-ILEFGAGSGKMAAEILKELERLDCLPTEYFILEVSADLQ 130

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
             ++ TL  + Q+    ++I W   L   P+    L ANE  D++P+++F + ++ I E 
Sbjct: 131 KYQQETL--QAQVPHLFNRIQWLERLPSQPISGVIL-ANEVLDAMPVRRFRLDDNEISEF 187

Query: 178 MIDIDQHDSLVFNIGDHE-----IKSNFLTCSDYFLGAIFENSPCRDREM---------- 222
            +  +  DS + N G  E      K NF   S +     ++  P RD  +          
Sbjct: 188 FVGSE--DSKI-NFGLQEELSKDSKINFGLQSPF----SWQILPSRDESLRMLVEKLRPT 240

Query: 223 -----------------QSISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGH 258
                            QS+SD LA   G  ++IDYG      Y   R   TL    + H
Sbjct: 241 LPIGYVSEINLALPAWIQSVSDILAA--GMVLLIDYGFPRREYYHPQRTQGTLMCHYRHH 298

Query: 259 TYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQT 318
            +  PL+  G  D+++HVDF  ++  A+   L + G TTQ  FL   G+    FS +   
Sbjct: 299 AHDDPLILVGLQDITAHVDFTAVAEAAVAADLEVAGYTTQANFLLASGL-PEFFSTLDPD 357

Query: 319 ARKDIL--LDSVKRLVSTSADKKSMGELFKILVVSHE 353
             K  L     VK+L   S     MGELFK++ ++ +
Sbjct: 358 DTKTYLQYTQQVKKLTLPS----EMGELFKVMALTRD 390


>gi|151555952|gb|AAI49743.1| LOC504290 protein [Bos taurus]
          Length = 256

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 117/244 (47%), Gaps = 31/244 (12%)

Query: 128 KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH--D 185
           K +   G  ++WY  L DVP  ++F +A+EFFD LP+ +F  T HG RE ++DID    D
Sbjct: 2   KGVTKSGIPVSWYRDLQDVPKEYSFYLAHEFFDVLPVHKFQKTPHGWREVLVDIDPQVSD 61

Query: 186 SLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDR---------EMQSISDRLACDGGTA 236
            L F +           C+    GA  +N   RD           +Q +S R++  GG A
Sbjct: 62  KLRFVLA---------PCATP-AGAFIQNDETRDHVEVCPEAGVVIQELSQRISLTGGAA 111

Query: 237 IVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
           ++ DYG+  ++  DT +   G+     L  PG ADL++ VDF  L  ++   K+   G  
Sbjct: 112 LIADYGHDGTKT-DTFRGFCGYRLHDVLTAPGTADLTADVDFSYLRRMS-QGKVASLGPV 169

Query: 297 TQGKFLEGLGIWQRAFSLMKQT---ARKDILLDSVKRLVSTSADKKSMGELFKIL-VVSH 352
            Q  FL  +GI  R   L+ +T   + +  LL     L+    +   MGE F  L +V H
Sbjct: 170 EQQTFLRNMGIDVRLKILLDKTDDPSLRQQLLQGYNMLM----NPMKMGERFNFLALVPH 225

Query: 353 EKVE 356
           +++ 
Sbjct: 226 QRLH 229


>gi|170077325|ref|YP_001733963.1| hypothetical protein SYNPCC7002_A0702 [Synechococcus sp. PCC 7002]
 gi|169884994|gb|ACA98707.1| Protein of unknown function COG1565 [Synechococcus sp. PCC 7002]
          Length = 389

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 148/316 (46%), Gaps = 23/316 (7%)

Query: 18  QMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           ++T  ++  L +  P  GYYS+     GA GDF TA  +   FGE+LA  L+   +  G 
Sbjct: 22  RLTFAEFMELALYHPTVGYYSSGKVAIGAQGDFFTATSLGPDFGELLAEQLLQMKQILG- 80

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGD- 135
            S  ++VE+G G+G +  DIL  + +  P     +  Y++E S  L   Q+++LA +   
Sbjct: 81  RSPFQIVEMGAGKGDLAKDILFYLQQHYPKELEEIEYYIIEKSPALRQQQQEKLAGFSYC 140

Query: 136 KINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGD 193
           KI W  ++ L +  +   F ++NE  D+ P+    +    ++E  +  +   + +  + D
Sbjct: 141 KIQWCDWSELLENSIQGCF-ISNELLDAFPVHLVTVNAGKLQEVYVQYNPAQNALEEVND 199

Query: 194 H----EIKSNF----LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG--- 242
                EI++ F    +  S+Y  G   E +      ++ +  +L    G  + IDYG   
Sbjct: 200 SLSTPEIQAYFDHLNIDFSNYPDGYRTEVNLGMLSWLEQLQTKLKT--GYILTIDYGHPA 257

Query: 243 ---YLQSRVGDTLQAVKGHT-YVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
              Y   R   TLQ    H  + +P  N G+ DL++HVDF  L +      L   GLT Q
Sbjct: 258 AKYYHPQRSQGTLQCYFQHRRHDNPYTNLGEQDLTAHVDFTSLQNHGESLGLATLGLTQQ 317

Query: 299 GKFLEGLGIWQRAFSL 314
           G FL  LG+  R  +L
Sbjct: 318 GLFLMALGLGDRLNAL 333


>gi|148242522|ref|YP_001227679.1| hypothetical protein SynRCC307_1423 [Synechococcus sp. RCC307]
 gi|147850832|emb|CAK28326.1| Conserved hypothetical protein [Synechococcus sp. RCC307]
          Length = 394

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 86/321 (26%), Positives = 137/321 (42%), Gaps = 27/321 (8%)

Query: 31  DPEFGYYSTCN-PFGAVGDFVTAPEISQIFGEMLA-IFLICAWEQHGFPSCVRLVELGPG 88
           DP +GYY +    FG+ GDFVTAP    +F E+LA  F  C          + L+E GPG
Sbjct: 39  DPAYGYYGSGQVRFGSGGDFVTAPSQGPVFAELLARQFRPCLDALAAESGPLTLIEWGPG 98

Query: 89  RGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKINWYTS--LADV 146
            G +M D++  I    P +   L + +VE+S  L   Q++ LA     ++W +   LA  
Sbjct: 99  DGQLMRDLIAGIGAESPAWLDRLELVLVESSPALQARQRQTLAGSAVPVHWCSPQQLAAE 158

Query: 147 PLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGD-------HEIKSN 199
           P     +VA+E  D+LP+++F +      E ++ +D      + +G         +++  
Sbjct: 159 PR-RGLIVAHELLDALPVQRFGLQNGNWHEWLVGLDGQQQPCWEVGAGLAPAVLEQLEQL 217

Query: 200 FLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQ 253
            L          + +  C          R     G  + IDY       Y  SR G TL 
Sbjct: 218 GLPPGGGGRPDGWSSEWCPALGPWLEQARACLRQGWLLAIDYAMPASRYYAPSRDGGTLL 277

Query: 254 AVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQR-- 310
           A +   T    L +PG+ DL++HV    +  +A        G   QG+ L  LG+ Q   
Sbjct: 278 ACREQRTSTELLRDPGRMDLTAHVCTTLVEQLAAAAGWRWQGAALQGEVLLQLGLAQEIT 337

Query: 311 ------AFSLMKQTARKDILL 325
                   +L  + +R++ LL
Sbjct: 338 ALSEPGPLALADRLSRREQLL 358


>gi|188590994|ref|YP_001795594.1| hypothetical protein RALTA_A0199 [Cupriavidus taiwanensis LMG
           19424]
 gi|170937888|emb|CAP62872.1| conserved hypothetical protein, DUF185; putative exported protein
           [Cupriavidus taiwanensis LMG 19424]
          Length = 403

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 161/378 (42%), Gaps = 74/378 (19%)

Query: 16  NGQMTVDQYFALCVADPEFGYYSTCNP-FGAVG----DFVTAPEISQIFGEMLAIFLICA 70
            G +  D+Y AL +  P  GYYS  +  FG       DF+TAPE+S  F   LA      
Sbjct: 33  GGWIGFDRYMALALYAPGLGYYSGGSAKFGRDARDGSDFITAPELSPFFARTLARQFAPL 92

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERLTLIQKK 128
             Q G P   RL+E G G G +  D+L  + +    PD +++     VE S  L   Q+ 
Sbjct: 93  LAQ-GLP---RLLEFGAGTGRLAADLLLGLEQEGQLPDTYAI-----VELSGELRARQQD 143

Query: 129 QLASYG----DKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRER------ 177
            LA       +++ W  +L   P  F   +V NE  D++P++ +        ER      
Sbjct: 144 TLARRAPHLAERVTWLDTL---PAAFEGVIVGNEVLDAMPVQLYARRGGSWHERGVARAA 200

Query: 178 ----------------MIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE 221
                           +   D  ++L    G+H++ +     ++ F              
Sbjct: 201 VPPEGGAPAFRFEDRALAAADVPEALRAIPGEHDLVTETHAEAEGF-------------- 246

Query: 222 MQSISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSS 274
            +++   LA   G A  IDYG      Y   R G TL    + H +  P + PG  D+++
Sbjct: 247 TRAVGAMLAR--GAAFFIDYGFPGGEYYHPQRAGGTLMCHYRHHAHPDPFLYPGLQDITA 304

Query: 275 HVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL-LDSVKRLVS 333
           HV+F  ++  A+   L + G  +Q +FL   GI     +L    AR  +   ++V++L+S
Sbjct: 305 HVNFSGIAHAAVESGLTVAGFASQARFLMNAGITDLLMALDPSDARTFLPQANAVQKLLS 364

Query: 334 TSADKKSMGELFKILVVS 351
               +  MGELFK++ ++
Sbjct: 365 ----EAEMGELFKVIALT 378


>gi|73539930|ref|YP_294450.1| hypothetical protein Reut_A0224 [Ralstonia eutropha JMP134]
 gi|72117343|gb|AAZ59606.1| Protein of unknown function DUF185 [Ralstonia eutropha JMP134]
          Length = 400

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 97/364 (26%), Positives = 165/364 (45%), Gaps = 45/364 (12%)

Query: 16  NGQMTVDQYFALCVADPEFGYYST-CNPFGA----VGDFVTAPEISQIFGEMLAIFLICA 70
            G +  D+Y +L +  P  GYYS     FG       DF+TAPE+S  F   LA      
Sbjct: 33  GGWIGFDRYMSLALYAPGLGYYSGGAAKFGRDVRDGSDFITAPELSPFFARTLARQFAPL 92

Query: 71  WEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIY-MVETSERLTLIQK 127
             Q G P   R++E G G G +  D+L  + +    PD + ++ +   +   ++ TL Q+
Sbjct: 93  LAQ-GLP---RMLEFGAGTGRLAADLLLALEQEGQLPDTYGIVELSGELRARQQDTLAQR 148

Query: 128 -KQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMT-----EHGIRERMIDI 181
             QLA    ++ W  +L +   G   +V NE  D++P++ F  T     E G+   +   
Sbjct: 149 APQLAP---RVQWLDTLPEHFEGI--VVGNEVLDAMPVRLFARTAGRWHERGVARSVAGD 203

Query: 182 DQHDSLVFNIGDHEIKSNFLT------CSDYFLGAIFENSPCRDREMQSISDRLACDGGT 235
           D   +  F   D ++ +  +         D+ +  + E     D   +++   LA   G 
Sbjct: 204 DSTAAHAFTFEDRQLPAQAIPEVLHAIPGDHDI--VTETHAEADGFARAVGAMLAR--GA 259

Query: 236 AIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY 288
           A  IDYG      Y   R G TL    + H++  P   PG  D+++HV+F  ++  A+  
Sbjct: 260 AFFIDYGFPAGEYYHPQRTGGTLMCHYRHHSHPDPFFYPGLQDITAHVNFSSIAHAAVDA 319

Query: 289 KLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVSTSADKKSMGELFKI 347
            L ++G  +Q +FL   GI     +L     R  +   ++V++L+S    +  MGELFK+
Sbjct: 320 GLSVSGFASQARFLMNAGITDLLMTLDPSDTRAFLPAANAVQKLLS----EAEMGELFKV 375

Query: 348 LVVS 351
           + ++
Sbjct: 376 VALT 379


>gi|22297960|ref|NP_681207.1| hypothetical protein tlr0417 [Thermosynechococcus elongatus BP-1]
 gi|22294138|dbj|BAC07969.1| tlr0417 [Thermosynechococcus elongatus BP-1]
          Length = 385

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 91/376 (24%), Positives = 160/376 (42%), Gaps = 28/376 (7%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCN-PFGAVGDFVTAPEISQIFGE 61
            +L+  +   I+  G ++  ++ AL +  P++GYY+      G  GDF+T+  +++ F E
Sbjct: 5   TQLLAALQERIRAAGAISFCEFMALALYAPQWGYYNRPQLQIGRRGDFITSSSLTRDFAE 64

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +L    +  W     P    L+E+G G G     +L       PDFF+ L   + E S  
Sbjct: 65  LLTEAFVQMWHALERPQRFTLLEMGAGEGQFAEGVLGYSQATYPDFFAALEYQIQEPSPS 124

Query: 122 LTLIQKKQLASYGDKINW--YTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
           L   Q+++LA +GD++ W    +  +  +G  F  +NE  D+ P+ +        +E  +
Sbjct: 125 LRERQRQRLAPWGDRLRWRDLDTACEPIVGCIF--SNELVDAFPVHRLQWQGDNWQEIYV 182

Query: 180 DIDQHDSLVFNIG---DHEIKSNFLTC------SDYFLGAIFENSPCRDREMQSISDRLA 230
            ++   +    +G   D  I   F T         Y  G   E +      ++ +S+ L 
Sbjct: 183 SLNAQGAFQEVLGPLSDDRIHEYFATVGIDPQQQGYSDGYRTEVNLNLIPWLKDLSEHL- 241

Query: 231 CDGGTAIVIDYGYLQ------SRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSS 283
              G  + IDYGY        +R   TLQ    H  + +P    G+ D+++HVD   L+ 
Sbjct: 242 -KRGFVLTIDYGYPAQQYYHPARCEGTLQCYYQHRCHNNPYCFVGEQDITAHVDVTALTC 300

Query: 284 IAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSA--DKKSM 341
               + L    +T Q  FL  LG+  R   L+ Q      LL ++ R  +     D   +
Sbjct: 301 YGEQFGLATLYVTRQSLFLMALGLGDR---LVAQQQSNGNLLQALNRHQALHQLIDPLGL 357

Query: 342 GELFKILVVSHEKVEL 357
           G  + +L     ++ L
Sbjct: 358 GGFYVVLQGKQARLNL 373


>gi|171464271|ref|YP_001798384.1| protein of unknown function DUF185 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193809|gb|ACB44770.1| protein of unknown function DUF185 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 395

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 99/377 (26%), Positives = 174/377 (46%), Gaps = 35/377 (9%)

Query: 5   LIRKIVNLI-KKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGEM 62
           L  KI + I  + G +   +Y  + + +P  GYYS   +  GA GDF TAPE+S +FG  
Sbjct: 16  LKAKIASQIASQGGWLPFSRYMEMALYEPGMGYYSAGAHKLGAGGDFTTAPELSPLFGAT 75

Query: 63  LAIFLICAWE---QHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY-MVET 118
           +   L+   E   + G     +++E G G G +   IL  +     D   VL  Y ++E 
Sbjct: 76  ICSTLLPVLEGLKEKGL--STQILEFGAGTGKLATSILTRLN----DLGFVLDRYDIIEI 129

Query: 119 SERLTLIQKKQLASYGDKINWYTS---LADVPLGFT-FLVANEFFDSLPIKQFVMTEHGI 174
           S  L   Q++++ +  +++N  T    L ++P  F   ++ANE  D++P    V+ ++G 
Sbjct: 130 SPDLAQRQQEKIKNTVEQLNLKTQCNWLTELPKNFNGVILANEVIDAIPC-DVVIFKNGF 188

Query: 175 RERMIDIDQHDSLVFNIG---DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLAC 231
                   ++D+L +  G   + ++    L  S++  G + E     +  MQ ++  L  
Sbjct: 189 WYWHGVAIENDNLTWKAGSPVEQKLLPQSLLSSNFSEGYVTELHTPANAWMQQVAKHL-- 246

Query: 232 DGGTAIVIDYG------YLQSRVGDTLQAVKGHTYVS-PLVNPGQADLSSHVDFQRLSSI 284
           D G  +  DYG      Y   R+  TL A   H  +  P   PG  D+++HV++ +++  
Sbjct: 247 DAGLFLTFDYGFPENEYYHPQRLEGTLMAHHRHHAIQDPFHFPGLCDVTTHVEWSQIARS 306

Query: 285 AILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILL--DSVKRLVSTSADKKSMG 342
            +   +    LT Q  +L   GI   A  +   +  +  L   +S+++L+S    +  MG
Sbjct: 307 TLTENVDDVYLTNQAAYLLDAGIGDIALEIGDPSDPETFLPISNSLQKLLS----EAEMG 362

Query: 343 ELFKILVVSHEKVELMP 359
           ELFK+   S     L+P
Sbjct: 363 ELFKVFTFSKSLDSLLP 379


>gi|239813984|ref|YP_002942894.1| hypothetical protein Vapar_0977 [Variovorax paradoxus S110]
 gi|239800561|gb|ACS17628.1| protein of unknown function DUF185 [Variovorax paradoxus S110]
          Length = 360

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 166/365 (45%), Gaps = 40/365 (10%)

Query: 14  KKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAV----GDFVTAPEISQIFGEMLAIFLI 68
           +  G +  D++ AL +  P  GYY+  +  FG +     DFVTAPE++ +FG+ LA  + 
Sbjct: 13  RAGGWIGFDRFMALALYAPGLGYYANSSAKFGHMPSSGSDFVTAPELTPMFGQALAAQVA 72

Query: 69  CAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK 128
            A E+ G  +   + E G G G + + +L  + ++       +   +V+ S  L   Q++
Sbjct: 73  EALEKTGTDT---VWEFGAGTGALAVQLLHALDEIGR---GDVRYRIVDLSGTLRERQQQ 126

Query: 129 QLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID-QHDSL 187
            LA Y D++ W   L +   G   +V NE  D++P++          ER +  + + D  
Sbjct: 127 ALARYTDRVEWLGELPEAMQGV--VVGNEVLDAMPVQLLARVGGQWFERGVVRNVRADGW 184

Query: 188 VFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVIDYG----- 242
            +   +  ++  F    ++    + E  P  +  + +++DRL    G A  IDYG     
Sbjct: 185 AWADRETALRPPFEVPGEHDY--LTEIHPQAEAFVATLADRLKS--GAAFFIDYGFPERE 240

Query: 243 -YLQSRVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQGK 300
            Y   R   T+   + H     PL + G  D+++HV+F  ++       L + G T+Q +
Sbjct: 241 YYHPQRHMGTVMCHRAHQADGDPLSDVGYKDITAHVNFTGIALAGQEAGLEVLGYTSQAR 300

Query: 301 FLEGLGIWQRAFSLMKQ--TARKDILLDSVKRLVSTSADKKSMGELFKILVVS-HEKVEL 357
           FL   G+ +R    M Q  TA + +      RLV     +  MGELFK++  +  E  E 
Sbjct: 301 FLLNCGLLER----MGQGSTAERGM----AARLVH----EHEMGELFKVVGFAVGEGWEA 348

Query: 358 MPFVN 362
           M F  
Sbjct: 349 MGFAE 353


>gi|241661669|ref|YP_002980029.1| hypothetical protein Rpic12D_0045 [Ralstonia pickettii 12D]
 gi|240863696|gb|ACS61357.1| protein of unknown function DUF185 [Ralstonia pickettii 12D]
          Length = 397

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 162/373 (43%), Gaps = 45/373 (12%)

Query: 16  NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEISQIFGEMLAIFLICA 70
            G +  D+Y  L +  P  GYYS     FG      GDFVTAPE++  FG  +A  +   
Sbjct: 33  GGWLPFDRYMELALYAPGLGYYSGGAAKFGRRVEDGGDFVTAPELTPFFGRTVAHQIAQV 92

Query: 71  WEQHGFPSCVRLV-ELGPGRGIMMLDILRVICKL--KPDFFSVLSIYMVETSERLTLIQK 127
            +    P   R V E G G G +  DIL  +  L  +PD + +     VE S  L   Q+
Sbjct: 93  LQ--ALPEGQRHVLEFGAGTGKLAADILTELDALGARPDSYGI-----VELSGELRQRQQ 145

Query: 128 KQLASYGDKI----NWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           ++L + G ++     W+ +L   P  FT  ++ NE  D++P+  +        +R + +D
Sbjct: 146 ERLTALGPQLAALARWHDTL---PAPFTGVMIGNEVLDAMPVSLWARRGGVWHQRGVMLD 202

Query: 183 QHDSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
             + L +    +   E+ +    L  +D F+    E +    R   +  +R     G  +
Sbjct: 203 ADNGLQWEDRLVSPSEVPAKLAALPGTDDFVTESHEAAEGFIRSAGAALER-----GLLL 257

Query: 238 VIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
           +IDYG      Y   R   TL    + H +  P   PG  D+++HVDF  ++       L
Sbjct: 258 LIDYGFPAAEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVDFSGIAQAGQEAGL 317

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVSTSADKKSMGELFKILV 349
            + G T+Q +FL   G+ +    L      + +   ++V++L+S    +  MGELFK + 
Sbjct: 318 ELLGYTSQARFLLSAGVGELLMRLDPSDPMQFLPAANAVQKLLS----EAEMGELFKAIA 373

Query: 350 VSHEKVELMPFVN 362
           +       +P   
Sbjct: 374 LGKGIDAALPLAG 386


>gi|91785574|ref|YP_560780.1| hypothetical protein Bxe_A0203 [Burkholderia xenovorans LB400]
 gi|91689528|gb|ABE32728.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 396

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/372 (25%), Positives = 163/372 (43%), Gaps = 40/372 (10%)

Query: 3   NKLIRKI-VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGD----FVTAPEIS 56
             L+ +I   L    G +  D+Y    +  P  GYYS     FG  GD    FVTAPE+S
Sbjct: 23  EALVAQIRAELEAAGGWLPFDRYMERALYAPGLGYYSGGARKFGLRGDDGSDFVTAPELS 82

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDF--FSVLSIY 114
            +F   LA  +  A +  G      ++E G G G +   +L  +     +F  +S++ + 
Sbjct: 83  PLFAATLARPIAEALQASG---TRNVMEFGAGTGKLAAGLLHALDASGAEFDSYSIVDL- 138

Query: 115 MVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI 174
             E  ER +      + +   K+ W  +L +   G   ++ NE  D++P++ F  T    
Sbjct: 139 SGELRERQSETIGAAVPALAAKVRWLDALPERFEGV--VIGNEVLDAMPVRLFAFTGGAW 196

Query: 175 RERMIDIDQHDSLVFN------IGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDR 228
            ER + + + ++  F+        D  + S   T  + ++    E +    R + ++  R
Sbjct: 197 HERGV-VWRDEAFAFDGQPVSAAADLALLSEIETAGEDYVTETHEAARAFTRTICTMLVR 255

Query: 229 LACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRL 281
                G A  IDYG      Y   R   TL     H  +V P + PG  D+++HV+F  +
Sbjct: 256 -----GAAFFIDYGFPRHEYYHAQRAQGTLMCHYRHRAHVDPFLYPGLQDITAHVEFTGI 310

Query: 282 SSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVSTSADKK 339
           +   +     + G T+Q +FL   GI + A + +     K  L   ++V++L+S    + 
Sbjct: 311 AEAGVETGADLLGFTSQARFLLNAGITE-ALAEIDPADPKQYLPAANAVQKLLS----EA 365

Query: 340 SMGELFKILVVS 351
            MGELFK++  S
Sbjct: 366 EMGELFKVIAFS 377


>gi|319791727|ref|YP_004153367.1| hypothetical protein Varpa_1038 [Variovorax paradoxus EPS]
 gi|315594190|gb|ADU35256.1| protein of unknown function DUF185 [Variovorax paradoxus EPS]
          Length = 370

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 165/359 (45%), Gaps = 37/359 (10%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYS-TCNPFGAV----GDFVTAPEISQ 57
           + LI + V   +  G +  D++ AL +  P  GYY+ T   FG +     DFVTAPE++ 
Sbjct: 14  DHLIARSVE--RAGGWIGFDRFMALALYAPGLGYYANTSAKFGHMPSSGSDFVTAPELTP 71

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
           +FG+ LA  +  A E+ G  +   + E G G G + + +L  + ++     S +   +V+
Sbjct: 72  MFGQTLAAQVAEALEKTGTDT---VWEFGAGSGALAVQLLHALDEMG---RSDVRYRIVD 125

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
            S  L   Q++ L  Y  ++ W   L +   G   +V NE  D++P++          ER
Sbjct: 126 LSGTLRERQQQALVRYAGRVEWLGELPESMQGV--VVGNEVLDAMPVQLLARVNGQWFER 183

Query: 178 -MIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
            ++    +D   +     E++       ++    + E  P     + +++DRL  + G A
Sbjct: 184 GVVRNAGNDGWTWADRPTELRPPVEVPGEHDY--LTEIHPQAQAFIATLADRL--EKGAA 239

Query: 237 IVIDYGYLQS------RVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQRLSSIAILYK 289
            +IDYG+ +S      R   T+   + H     PL + G  D+++HVDF  ++       
Sbjct: 240 FLIDYGFPESEYYHPQRHMGTVMCHRAHQADGDPLADVGYKDITAHVDFTGIAVAGQEAG 299

Query: 290 LYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
           L + G T+Q +FL   G+  R    M+Q    +  +    RL+     +  MGELFK++
Sbjct: 300 LEVLGYTSQARFLLNCGLLAR----MEQGTVAERAM--AARLIH----EHEMGELFKVV 348


>gi|257091912|ref|YP_003165553.1| hypothetical protein CAP2UW1_0267 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044436|gb|ACV33624.1| protein of unknown function DUF185 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 394

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/370 (25%), Positives = 159/370 (42%), Gaps = 54/370 (14%)

Query: 10  VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEI----SQIFGEMLA 64
             +   +G +  D++ +L +  P  GYYS   + FG  GDFVTAPEI    +Q  G   A
Sbjct: 32  TEIAAGDGWIGFDRFMSLALYAPGMGYYSGGAHKFGPAGDFVTAPEICPAFAQTLGAQAA 91

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVETSERL 122
             L+         S  R++E+G G G    D+L  + +    PD +++L +   E   R 
Sbjct: 92  QILVL--------SAPRIIEVGAGTGEFAADLLLELERRGALPDSYAILDLSG-ELRARQ 142

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLV-ANEFFDSLPIKQFVMTEHGIRERMIDI 181
                ++      ++ W   L  +P  F  LV ANE  D++P    +     I ER + +
Sbjct: 143 QATLARRTPHLLPRVRW---LERLPERFDGLVLANEVLDAMPAHLVLWGPTHIAERGVGV 199

Query: 182 DQHDSLVFN--------IGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDG 233
           D+    V+         +G  ++ +     +  +L  I   +P    E   I  +     
Sbjct: 200 DE-GRFVWRDRPASGPLLGRAKVLAGECEIAPGYLSEISLTAPAWITEWAGILGQ----- 253

Query: 234 GTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G  ++IDYG      Y   R   TL     H ++  P   PG  D+++HVDF  +     
Sbjct: 254 GALLLIDYGFPRHEYYHPQRSAGTLMCHYRHRSHTDPFYLPGLQDITTHVDFTGIVEAGC 313

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-----LLDSVKRLVSTSADKKSM 341
              L + G TTQ  FL   G+ +    ++ +T   D      L ++V++LVS +     M
Sbjct: 314 QAGLELLGYTTQSSFLFNCGLTE----ILSRTPVGDALRYLPLANAVQKLVSPA----EM 365

Query: 342 GELFKILVVS 351
           GE+FK++ + 
Sbjct: 366 GEIFKVIALG 375


>gi|187927158|ref|YP_001897645.1| hypothetical protein Rpic_0048 [Ralstonia pickettii 12J]
 gi|309780141|ref|ZP_07674892.1| hypothetical protein HMPREF1004_01491 [Ralstonia sp. 5_7_47FAA]
 gi|187724048|gb|ACD25213.1| protein of unknown function DUF185 [Ralstonia pickettii 12J]
 gi|308920844|gb|EFP66490.1| hypothetical protein HMPREF1004_01491 [Ralstonia sp. 5_7_47FAA]
          Length = 397

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 160/362 (44%), Gaps = 45/362 (12%)

Query: 16  NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEISQIFGEMLAIFLICA 70
            G ++ D+Y  L +  P  GYYS     FG      GDF+TAPE++  FG  +A  L   
Sbjct: 33  GGWLSFDRYMELALYAPGLGYYSGGAAKFGRRVEDGGDFITAPELTPFFGRTVAHQLAQV 92

Query: 71  WEQHGFPSCVRLV-ELGPGRGIMMLDILRVICKL--KPDFFSVLSIYMVETSERLTLIQK 127
            +    P   R V E G G G +  DIL  +  L  +PD + +     VE S  L   Q+
Sbjct: 93  LQ--ALPEGQRHVLEFGAGTGKLAADILIELDALSVRPDSYGI-----VELSGELRQRQQ 145

Query: 128 KQLASYGDKIN----WYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
           ++L + G  +     W+ +L   P  FT  ++ NE  D++P+  +        +R + +D
Sbjct: 146 ERLTALGPDLGALAQWHDTL---PAPFTGVMIGNEVLDAMPVSLWARRGGMWHQRGVMLD 202

Query: 183 QHDSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAI 237
               L +    +   E+ +    L  +D F+    E +    R   +  +R     G  +
Sbjct: 203 AEHGLQWEDRLVDPSEVPAKLAALPGTDDFVTESHEAAEGFIRSTGAALER-----GLLL 257

Query: 238 VIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKL 290
           +IDYG      Y   R   TL    + H +  P   PG  D+++HVDF  ++       L
Sbjct: 258 LIDYGFPAAEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVDFSGIAQAGQEAGL 317

Query: 291 YINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVSTSADKKSMGELFKILV 349
            + G T+Q +FL   G+ +   +L      + +   ++V++L+S    +  MGELFK + 
Sbjct: 318 ELLGYTSQARFLLSAGVGELLMTLDPSDPMQFLPAANAVQKLLS----EAEMGELFKAIA 373

Query: 350 VS 351
           + 
Sbjct: 374 LG 375


>gi|330818521|ref|YP_004362226.1| hypothetical protein bgla_1g36670 [Burkholderia gladioli BSR3]
 gi|327370914|gb|AEA62270.1| hypothetical protein bgla_1g36670 [Burkholderia gladioli BSR3]
          Length = 400

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 101/370 (27%), Positives = 155/370 (41%), Gaps = 51/370 (13%)

Query: 10  VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGD----FVTAPEISQIFGEMLA 64
             +    G +   ++    +  P  GYYS     FG  GD    FVTAPE+S +F + LA
Sbjct: 31  AEIAASGGWVPFSRFMERALYAPGLGYYSGGARKFGRRGDDGSDFVTAPELSPLFAQTLA 90

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRG--IMMLDILRVICKLKPDFFSVLSIYMVETSERL 122
             L  A E  G     RL+E G G G     L          P+ + +     VE S  L
Sbjct: 91  RPLAEALEASG---TRRLMEFGAGTGKLAAGLLAALDALGAPPERYEI-----VELSGEL 142

Query: 123 TLIQKKQLAS-----YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
              Q+  LA+        +++W  +L +   G   +V NE  D++P++  +  E G RER
Sbjct: 143 RERQRATLAAELPAPLASRVHWLDALPERFEGV--VVGNEVLDAMPVRLVLRGETGWRER 200

Query: 178 MIDIDQHDSLVFNIGDHEIKSN----------FLTCSDYFLGAIFENSPCRDREMQSISD 227
            + +D   + VF   D  +  +           L   + +L  I E +    R       
Sbjct: 201 GVAVDAARAFVFE--DRPLPESAGESALAALDALELPEGYLTEIHEAA----RAFTGTVC 254

Query: 228 RLACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQR 280
           R+   G  A  IDYG      Y   R   TL     H  +  P V PG  D+++HV+F  
Sbjct: 255 RMLARG-AAFFIDYGFPAGEYYHPQRAEGTLMCHYRHRAHGDPFVWPGLQDITAHVEFSG 313

Query: 281 LSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSADKK 339
           +   A+     + G T+QG+FL   GI +    +     AR     ++V++L++ S    
Sbjct: 314 IHEAAVAAGAELLGYTSQGRFLLNAGITEVLADIDPADGARFLPAANAVQKLIAES---- 369

Query: 340 SMGELFKILV 349
            MGELFK++ 
Sbjct: 370 EMGELFKVIA 379


>gi|311030842|ref|ZP_07708932.1| hypothetical protein Bm3-1_09906 [Bacillus sp. m3-13]
          Length = 380

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 146/360 (40%), Gaps = 41/360 (11%)

Query: 18  QMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGF 76
           ++   +Y    +  P  GYY    N  G  GDF+T+  +  ++G++ A  L+  + +   
Sbjct: 22  KLNFAEYMMTVLYHPSEGYYMKPKNKVGTKGDFITSSNVHTVYGKLFAKLLVKYFNETDI 81

Query: 77  PSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDK 136
           P  +  +E+G G G     +L     L P  +  LS  MVETS     +QK  +      
Sbjct: 82  PPVI--IEIGGGNGRFAKHLLEEFKLLDPLLYRRLSYVMVETSSYHIHLQKTTIPD-SVP 138

Query: 137 INWYTSLADVPLGFT--FLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIGDH 194
           +N++ SL DVP  F    L +NE FD+LP+     T   ++E  + I +         D 
Sbjct: 139 VNYFISLEDVPDRFRKGVLFSNELFDALPVHVIEYTNGTLKEVFVTIGE---------DR 189

Query: 195 EIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACD-----------GGTAIVIDYGY 243
            +    L   +  + A    +     E Q +   LA              GT I +DYGY
Sbjct: 190 NLSERSLPLDNEEIQAYISKNKLIFSEGQRMEIPLAMMHYANILGEWLLAGTIITVDYGY 249

Query: 244 LQSRVGD------TLQAVKGHTYVS-PLVNPGQADLSSHVDFQRLSSIAILYKLYINGLT 296
             S +        +L+    H  V  PL  P + DL+SH+    L +    +K    G  
Sbjct: 250 RFSELASQDLLEGSLRGYHQHQLVKDPLKYPAEMDLTSHIHLDALEASFDDWKFSHVGTM 309

Query: 297 TQGKFLEGLGIWQRAFSLMKQTARKDILLDSVK--RLVSTSADKKSMGELFKILVVSHEK 354
            QG+FL   GI       +++    D   +  K  R + T     S    F++L+  HEK
Sbjct: 310 RQGEFLVEAGI----LEYLQENQDPDPFSEKSKQNRAIRTLIMDSSWSHSFQVLI--HEK 363


>gi|297171519|gb|ADI22518.1| uncharacterized conserved protein [uncultured verrucomicrobium
           HF0500_08N17]
          Length = 378

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 149/367 (40%), Gaps = 28/367 (7%)

Query: 3   NKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
           N L   I   I   G M   ++  L +  PEFGYY       G  GDFVT+  +   FG+
Sbjct: 23  NPLAGMIRAEIDDGGPMPFARFMELALYHPEFGYYEKEAGQVGPQGDFVTSVSVGAAFGQ 82

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSER 121
           +LA +    W +      V++VE G   G +  DIL  +       F+ L   + E S +
Sbjct: 83  LLA-YRFAEWLE-AIDGPVQVVEAGAHDGTLAGDILEWLAANDEPLFARLRYVIAEPSAK 140

Query: 122 LTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQ--FVMTEHGIRERMI 179
               Q K+LA +  ++ W  SLA  P     +  NE  D+ P+ +  +   E G  E  +
Sbjct: 141 RRSWQAKRLAKFDTQLEWRDSLAGAPKIPGIIFCNELLDAFPVNRIGWSKAERGWFEWAV 200

Query: 180 DIDQHDSLVFNI--GDHEIKSNFLTCSDYFLGAI-----FENSPCRDREMQSISDRLACD 232
           D          I  G    +S         L  +      E SP  +   ++ +D+LA  
Sbjct: 201 DWRDGAFCWEPIDGGGAAWRSLLPAWPSALLDVLPDQYTTELSPQANAWWRAAADQLAV- 259

Query: 233 GGTAIVIDYGY------LQSRVGDTLQAVKGHTYVSP-LVNPGQADLSSHVDFQRLSSIA 285
            G  I +DYG+        ++   T +  +    V   L +PG+ DL++H +F       
Sbjct: 260 -GKLIALDYGHGPDDWPAANQPDGTARGYRCQRLVDDVLTDPGKQDLTAHANFGLAKQSG 318

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELF 345
               L     T+Q +FL G       F+ M Q+A        V++L + +     MG  F
Sbjct: 319 EAAGLQTELFTSQERFLNG------TFAEMLQSAPALGQAMDVRQLQALT-HPAHMGRPF 371

Query: 346 KILVVSH 352
           ++LV S 
Sbjct: 372 RVLVQSR 378


>gi|292490198|ref|YP_003525637.1| hypothetical protein Nhal_0029 [Nitrosococcus halophilus Nc4]
 gi|291578793|gb|ADE13250.1| protein of unknown function DUF185 [Nitrosococcus halophilus Nc4]
          Length = 395

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 102/367 (27%), Positives = 165/367 (44%), Gaps = 31/367 (8%)

Query: 3   NKLIRKIVNLIKKNG-QMTVDQYFALCVADPEFGYY-STCNPFGAVGDFVTAPEISQIFG 60
            KL   I   I++NG Q++  ++  L +  P  GYY S  +  GA GDF+TAPE+S +F 
Sbjct: 23  QKLQSIIREDIEQNGGQISFARFMELALYKPGLGYYMSGLHKLGAAGDFITAPELSPLFA 82

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLK--PDFFSVLSIYMVET 118
             L+       E  G      ++E G G G M  D+L  + +    P+ + +L +   E 
Sbjct: 83  RCLSRQCQQVLELLG---SGEILEFGAGSGRMAADLLAELDRRGQLPERYFILEL-SAEL 138

Query: 119 SERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERM 178
            +R     ++Q+     K++W   L D   G   ++ANE  D++P+  F + +    ER 
Sbjct: 139 RQRQQQTLQQQVPHLAPKVSWLDRLPDNIQG--LVLANEVCDAMPVHCFQLEDEHSWERY 196

Query: 179 IDIDQHDSLVFNIG--DHEIKSNFLTCSDYFLGAIFENSPCRDREMQS----ISDRLACD 232
           +  +  DS V+  G   H      +T     L  +       +  M++    I+ RL   
Sbjct: 197 VGYEG-DSFVWKKGPLSHARLKERITEIRLLLKQVNRYESEVNLAMENWVAEIAHRL--Q 253

Query: 233 GGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIA 285
            G  ++IDYG      Y   R   TL     H  +  PL+ PG  D+++HVDF  L+   
Sbjct: 254 QGMLLIIDYGFPRQEYYHPDRTTGTLMCHYRHRAHPDPLILPGLQDITAHVDFTALAEAG 313

Query: 286 ILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVSTSADKKSMGEL 344
               L + G  +Q  FL   G+ + A + +       + + + +KRL   S     MGEL
Sbjct: 314 HNSGLRVAGYCSQTDFLLACGLDELAAAEIAAGGYHALEISNQIKRLTLPS----EMGEL 369

Query: 345 FKILVVS 351
           FKIL ++
Sbjct: 370 FKILALT 376


>gi|298492340|ref|YP_003722517.1| hypothetical protein Aazo_3886 ['Nostoc azollae' 0708]
 gi|298234258|gb|ADI65394.1| protein of unknown function DUF185 ['Nostoc azollae' 0708]
          Length = 394

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 157/358 (43%), Gaps = 39/358 (10%)

Query: 4   KLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAV------GDFVTAPEISQ 57
           + I K +N   ++ ++T  +Y  + +  P+ GYYS+     AV      GDF T+  +  
Sbjct: 9   QAIAKCINTSPQH-RITFAEYMDMALYHPKHGYYSS----DAVKIGFRGGDFFTSSSLGN 63

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVE 117
            FGE+LA+     W+    PS   LVE+G G+G +   IL  +    PDF + L   +VE
Sbjct: 64  DFGELLAVQFFQMWQILEQPSPFHLVEMGAGQGTLASHILNYLKLQHPDFLTALEYIIVE 123

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLADVP---LGFTFLVANEFFDSLPIKQFVMTEHGI 174
            S  L   Q+++L  +   + W       P   +G  F  +NE  D+ P+ QF++    +
Sbjct: 124 KSPSLRTQQQQRLQDF--SVRWCNLEEITPNSIVGCFF--SNELVDAFPVHQFILEAGEL 179

Query: 175 RE-RMIDIDQHDSLVFNIGDHEIKSNFLT---CSDYFLGAIFENSPCRDREMQSISDRLA 230
           RE  +  ++  ++   +    E+ +   T    + + L  I  N    +   +S  +  A
Sbjct: 180 REIYVTTLENGENTASDFSFIEVVAEVSTPKLVAHFDLVGIDLNPNVYEDGYRSEINLAA 239

Query: 231 CDG----------GTAIVIDYGYLQSRV------GDTLQAVKGHTYVS-PLVNPGQADLS 273
            D           G  + IDYGY  SR         TLQ    H Y   P +N G  D++
Sbjct: 240 LDWLGIVADCLQQGYVLTIDYGYPASRYYHPRRSQGTLQCYYHHRYHDHPYINIGGQDIT 299

Query: 274 SHVDFQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRL 331
           +HVDF  L +      L   G T QG FL  LG+ +R  +L  Q      LL+  + L
Sbjct: 300 AHVDFTALETWGKKCGLDAVGWTQQGLFLMALGLGERIAALSYQEQPISQLLNRREAL 357


>gi|296157397|ref|ZP_06840232.1| protein of unknown function DUF185 [Burkholderia sp. Ch1-1]
 gi|295892169|gb|EFG71952.1| protein of unknown function DUF185 [Burkholderia sp. Ch1-1]
          Length = 396

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 93/364 (25%), Positives = 159/364 (43%), Gaps = 39/364 (10%)

Query: 10  VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGD----FVTAPEISQIFGEMLA 64
             L    G +  D+Y    +  P  GYYS     FG  GD    FVTAPE+S +F   LA
Sbjct: 31  AELEAAGGWLPFDRYMERALYAPGLGYYSGGARKFGLRGDDGSDFVTAPELSPLFAATLA 90

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDF--FSVLSIYMVETSERL 122
             +  A +  G      ++E G G G +   +L  +  L  +F  +S++ +   E  ER 
Sbjct: 91  RPIAEALQASG---TRNVMEFGAGTGKLAAGLLDALDALGAEFDSYSIVDLSG-ELRERQ 146

Query: 123 TLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDID 182
               +  + +   K+ W  +L +   G   ++ NE  D++P++ F  T     ER + + 
Sbjct: 147 REAIEAAVPALAAKVRWLDALPERFEGV--VIGNEVLDAMPVRLFAFTGGAWHERGV-VW 203

Query: 183 QHDSLVFN------IGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
           + ++  F+        D  + S   T  + ++    E +    R + ++  R     G A
Sbjct: 204 RDEAFAFDDRPVSAAADLALLSEIDTAGEDYVTETHEAASAFTRTICTMLVR-----GAA 258

Query: 237 IVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAILYK 289
             IDYG      Y   R   TL     H  +  P + PG  D+++HV+F  ++   +   
Sbjct: 259 FFIDYGFPRHEYYHAQRAQGTLMCHYRHRAHGDPFLYPGLQDITAHVEFTGIAEAGVETG 318

Query: 290 LYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDIL--LDSVKRLVSTSADKKSMGELFKI 347
             + G T+Q +FL   GI + A + +     K  L   ++V++L+S    +  MGELFK+
Sbjct: 319 ADLLGFTSQARFLLNAGITE-ALAEIDPADTKQYLPAANAVQKLLS----EAEMGELFKV 373

Query: 348 LVVS 351
           +  S
Sbjct: 374 IAFS 377


>gi|299068282|emb|CBJ39503.1| conserved protein of unknown function [Ralstonia solanacearum
           CMR15]
          Length = 397

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 103/388 (26%), Positives = 164/388 (42%), Gaps = 48/388 (12%)

Query: 3   NKLIRKIVNLIKK-NGQMTVDQYFALCVADPEFGYYST-CNPFGAV----GDFVTAPEIS 56
           ++L   IV  ++   G +  ++Y  L +  P  GYYS     FG      GDF+TAPE++
Sbjct: 19  DRLFSTIVRAVESAGGWLPFERYMELALYAPGLGYYSGGAAKFGRRVEDGGDFITAPELT 78

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKL--KPDFFSVLSIY 114
             FG  +A   I    Q   P    ++E G G G +  DIL  +  L  +PD + +    
Sbjct: 79  PFFGRTVA-HQIAQVLQTLPPGQRHVLEFGAGTGRLAADILTELETLGMRPDSYGI---- 133

Query: 115 MVETSERLTLIQKKQLASYGDKIN----WYTSLADVPLGFT-FLVANEFFDSLPIKQFVM 169
            VE S  L   Q++ LA+ G  +     W+ +L   P  FT  +V NE  D++P+  +  
Sbjct: 134 -VELSGELRQRQQQALAALGPDLTGLARWHDAL---PARFTGVMVGNEVLDAMPVSLWAR 189

Query: 170 TEHGIRERMIDIDQHDSLVF-----NIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQS 224
                  R +  D    L +     +  +   K   L   D F+    E +    R   +
Sbjct: 190 RGGVWHRRGVAFDADQGLRWSERAADPAEVPPKLAALPGRDDFVTEAHEAAEGFIRSAGA 249

Query: 225 ISDRLACDGGTAIVIDYG------YLQSRVGDTLQA-VKGHTYVSPLVNPGQADLSSHVD 277
             +R     G  ++IDYG      Y   R   TL    + H +  P   PG  D+++HVD
Sbjct: 250 ALER-----GLLLLIDYGFPAGEYYHAHRANGTLMCHYRQHAHDDPFWLPGLQDITAHVD 304

Query: 278 FQRLSSIAILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILL---DSVKRLVST 334
           F  ++  A    L + G  +Q +FL   G+ Q   +L    A     L   ++V++L+S 
Sbjct: 305 FSGIALAARETGLEVLGYASQARFLLSAGVGQLLMTL--DPADPVCFLPAANAVQKLLS- 361

Query: 335 SADKKSMGELFKILVVSHEKVELMPFVN 362
              +  MGELFK + +       +P   
Sbjct: 362 ---EAEMGELFKAIALGRGLDAALPLAG 386


>gi|187925703|ref|YP_001897345.1| hypothetical protein Bphyt_3733 [Burkholderia phytofirmans PsJN]
 gi|187716897|gb|ACD18121.1| protein of unknown function DUF185 [Burkholderia phytofirmans PsJN]
          Length = 396

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 96/370 (25%), Positives = 156/370 (42%), Gaps = 36/370 (9%)

Query: 3   NKLIRKI-VNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGD----FVTAPEIS 56
             L+ +I   L    G +  D+Y    +  P  GYYS     FG  GD    FVTAPE+S
Sbjct: 23  EALVAQIRAELDTAGGWLPFDRYMERALYAPGLGYYSGGARKFGLRGDDGSDFVTAPELS 82

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDF--FSVLSIY 114
            +F   LA  +  A +  G      ++E G G G +   +L  +  L  +F  +S++ + 
Sbjct: 83  PLFAATLARPVAEALQASG---TRDVMEFGAGTGKLAAGVLNALDGLGAEFDSYSIVDLS 139

Query: 115 MVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMT---- 170
             E  ER     +    +   K+ W  +L +   G   ++ NE  D++P++ F       
Sbjct: 140 G-ELRERQRETIEAAAPTLAAKVRWLDALPERFEGV--VIGNEVLDAMPVRLFAFNGGAW 196

Query: 171 -EHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
            E G+  R       D  V    D  + S   T  + ++    E +    R + ++  R 
Sbjct: 197 LERGVVWRNGAFAFDDRPVSAAADLALLSEIETAGEAYVTETHEAASAFTRTICTMLAR- 255

Query: 230 ACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLS 282
               G A  IDYG      Y   R   TL     H  +  P + PG  D+++HV+F  ++
Sbjct: 256 ----GAAFFIDYGFPRHEYYHAQRAQGTLMCHYRHRAHGDPFLYPGLQDITAHVEFTGIA 311

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSL-MKQTARKDILLDSVKRLVSTSADKKSM 341
              +     + G T+Q +FL   GI      +    TAR     ++V++L+S    +  M
Sbjct: 312 EAGVETGADLLGFTSQARFLLNAGITDVLSEIDPADTARYLPAANAVQKLLS----EAEM 367

Query: 342 GELFKILVVS 351
           GELFK++  S
Sbjct: 368 GELFKVIAFS 377


>gi|319789159|ref|YP_004150792.1| protein of unknown function DUF185 [Thermovibrio ammonificans HB-1]
 gi|317113661|gb|ADU96151.1| protein of unknown function DUF185 [Thermovibrio ammonificans HB-1]
          Length = 314

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 144/317 (45%), Gaps = 60/317 (18%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVG-DFVTAPEISQIFGEMLAIFL 67
           IV LI++ G +  D++  LC+  PEFGYY+        G DF TAPE++ +FG++LA  +
Sbjct: 6   IVELIEREGPLRFDRFVELCLYHPEFGYYTRVRTLPVPGQDFFTAPELTPVFGKVLARHI 65

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
                +   P  +R++ELG G+G +  D+L    +L+P              E   L++K
Sbjct: 66  GEVARREKLP--LRILELGGGKGFLAKDLLE---ELRP--------------EEYLLLEK 106

Query: 128 KQLASYGDKINWYTSLADVPLGFT-FLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDS 186
             +   G  +   TSL ++  GF  F+V+NEFFD+ P ++ V+   G+    + ID  +S
Sbjct: 107 GPMNLKG--VKGLTSLEELEGGFEGFVVSNEFFDAFPFRR-VLPRRGLE---VFIDGKES 160

Query: 187 LVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE------------MQSISDRLA-CDG 233
            +F           L     F G     SPC   E            ++ ++ +L+ C  
Sbjct: 161 RLFE--------TLLP----FEGEA--GSPCEGFEGEYPLFSSWRPFLEELAGKLSRC-- 204

Query: 234 GTAIVIDYGYLQSRVG--DTLQAVKGHTYVSP-LVNPGQADLSSHVDFQRLSSIAILYKL 290
              +  DYG   + +    T +A  GH      L  PG+ DL++ VDF  LS I      
Sbjct: 205 -YFVTFDYGGRCTELSGRQTFKAFSGHALADDWLERPGEVDLTALVDFDYLSKILGELGF 263

Query: 291 YINGLTTQGKFLEGLGI 307
               L  Q +FL   GI
Sbjct: 264 ENLELCPQSEFLLSWGI 280


>gi|258514907|ref|YP_003191129.1| hypothetical protein Dtox_1649 [Desulfotomaculum acetoxidans DSM
           771]
 gi|257778612|gb|ACV62506.1| protein of unknown function DUF185 [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 386

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 95/380 (25%), Positives = 168/380 (44%), Gaps = 44/380 (11%)

Query: 9   IVNLIKKNGQMTVDQYFALCVADPEFGYYSTC-NPFGAVGDFVTAPEISQIFGEMLAIFL 67
           I + I+  G +T  ++  + +  PE GYY++     G  GD+ T+ ++  +F  M+A   
Sbjct: 11  IKSFIELEGPVTFARFMEMALYYPELGYYASVREKIGRKGDYYTSSDVHALFAGMIARQA 70

Query: 68  ICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQK 127
              W   G P   + +E G G+G +  D L  + +  PD ++ L+ ++++ S      Q+
Sbjct: 71  AQMWAILGHPPVWQFIEYGAGKGKLAYDFLNQLQQQYPDCYAALTYWIIDVSPDFREKQQ 130

Query: 128 KQLASYG---DKINWYTSLADV-------PLGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
             L+       K++W  S A +         G  F  +NE  D+ P+ +  M E G++E 
Sbjct: 131 AILSGLNLPPGKVSWADSPAQILELQGNRITGCIF--SNELIDAFPVHRVRMREDGLKE- 187

Query: 178 MIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDRE-----MQSISDRLAC- 231
            I +D  D+    + +  +    L   DYF          +  E     ++ + ++  C 
Sbjct: 188 -IYVDYRDNRFVEV-EGLLSEKLL--QDYFAKQRVALKTGQTAEVNLAAIKWLKNQAECL 243

Query: 232 DGGTAIVIDYG------YLQSRVGDTLQAVKGHTYV-SPLVNPGQADLSSHVDFQRLSSI 284
           + G  I IDYG      Y ++R   TL+  + HT    P    G+ D++++V+F  L   
Sbjct: 244 EKGYIITIDYGLTSDNLYNRARFDGTLRCFRRHTLNDDPYQYIGEQDITANVNFSALEIW 303

Query: 285 AILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKK----- 339
                L + GL TQ  FL   GI      ++K +   D    + K+L +T A K+     
Sbjct: 304 GKEAGLNMAGLVTQSDFLLNAGI----LDILKTS---DDYSFNEKKLHTTLAIKQLIMPE 356

Query: 340 SMGELFKILVVSHEKVELMP 359
            MG  FK+L + H+ +   P
Sbjct: 357 GMGRYFKVL-IQHKGLPAEP 375


>gi|226313453|ref|YP_002773347.1| hypothetical protein BBR47_38660 [Brevibacillus brevis NBRC 100599]
 gi|226096401|dbj|BAH44843.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 363

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/351 (24%), Positives = 148/351 (42%), Gaps = 31/351 (8%)

Query: 19  MTVDQYFALCVADPEFGYYSTCNP-FGAVGDFVTAPEISQIFGEMLAIFLICAWEQHGFP 77
           +T  ++  L +     GYY    P  G  GDF T+  +  +F E +A  ++  WE+    
Sbjct: 17  ITFARFMELALYHDTHGYYMVEQPKVGKAGDFYTSASVHPVFAETIADAVLALWEEADIT 76

Query: 78  SCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKKQLASYGDKI 137
           S V LVE+G G G +   +L  I   KP+ +  L++ ++E S     +Q++ L  +    
Sbjct: 77  SPV-LVEIGGGTGAVCRHMLERIRACKPEIYKELTVILIEASPYHRKMQQEALQWHEGPK 135

Query: 138 NWYTSLADVPL-----GFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQHDSLVFNIG 192
            WY+S+ +        G  F  +NE+ D+ P+      + G +E  + + + D L   +G
Sbjct: 136 RWYSSVNEAAKQEKIEGVIF--SNEWLDAFPVHIVEKNKSGWQEVWVRVGE-DGLEECLG 192

Query: 193 DHEIKSNFLTCSDYFLGAIFENSPCRDR-----EMQSISDRLAC--DGGTAIVIDYGYLQ 245
           +             +L  +    P   R      M+  +  ++C    G  I IDYG LQ
Sbjct: 193 E------MTPALGEYLRGLNLKLPIGMRIEINLAMEQAAQDVSCLLKKGFVITIDYGDLQ 246

Query: 246 ------SRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYINGLTTQ 298
                 SR   TL     H  + +P +N G+ DL++HV+F           L   G   Q
Sbjct: 247 EELYHPSRKNGTLMCYHRHQAHTNPYLNIGEQDLTTHVNFSAWKEYGEKAGLQEIGYMRQ 306

Query: 299 GKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKILV 349
            +FL   G+  +A + M +     + +    R +    D   +G  F ++V
Sbjct: 307 DRFLMRNGLLHKAVAHMDRDPFTSVAMKR-NRAIQQLIDPAGLGGRFWVMV 356


>gi|320582809|gb|EFW97026.1| hypothetical protein HPODL_1736 [Pichia angusta DL-1]
          Length = 329

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 142/306 (46%), Gaps = 44/306 (14%)

Query: 81  RLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMVETSERLTLIQKK------------ 128
           R++E GPG+G MM  +  V  +   D  + + I MVE S+ L   Q K            
Sbjct: 24  RVIEFGPGKGSMMRGLAMVFKQYIID--NPVEIVMVEKSDILIREQHKLLCKSQKLEQVD 81

Query: 129 -----QLASYGDKINWYTS-LADVPLG---FTFLVANEFFDSLPIKQFVMTEHGIRERMI 179
                 +  +G  I W  + L ++ L      F+VA+EFFD+LPI +++ T+HG RE ++
Sbjct: 82  DYNFESITEWGQPITWQKNDLVELDLDSKYMNFVVAHEFFDALPIDRYIKTKHGWREYLV 141

Query: 180 DIDQHDS-----LVFNIGDHEIKSNFLTCSD-----YFLGAIFENSPCRDREMQSISDRL 229
           D+ + ++         +  H    +F+  ++       +GA  E S          +  +
Sbjct: 142 DVREPEAGRPGKFGLVVAPHATPGSFIPATNERYNKLAVGANVEISADAHMYASQFAKII 201

Query: 230 -ACDGGTAIVIDYGYLQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILY 288
            + D G A++IDYG   +   ++L+ +K H +V P   PG+ DLS  VDF  LS +    
Sbjct: 202 NSGDVGGALIIDYGPKDTIPINSLRGIKDHKFVDPFSEPGKIDLSVDVDFLGLSRLFESQ 261

Query: 289 KLYINGLTTQGKFLEGLGIWQ----RAFSLMKQTARKDILLDSVKRLVSTSADKKSMGEL 344
            L    + TQ +FL   G+       AFS+ +Q  R + L    +RL  T +  + MG  
Sbjct: 262 GLKTM-IETQSQFLNSSGLPSILGGLAFSMKEQQQRFETLY---QRL--TGSAPQDMGRA 315

Query: 345 FKILVV 350
           +K L V
Sbjct: 316 YKALQV 321


>gi|107023909|ref|YP_622236.1| hypothetical protein Bcen_2363 [Burkholderia cenocepacia AU 1054]
 gi|116690995|ref|YP_836618.1| hypothetical protein Bcen2424_2977 [Burkholderia cenocepacia
           HI2424]
 gi|105894098|gb|ABF77263.1| protein of unknown function DUF185 [Burkholderia cenocepacia AU
           1054]
 gi|116649084|gb|ABK09725.1| protein of unknown function DUF185 [Burkholderia cenocepacia
           HI2424]
          Length = 396

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 91/360 (25%), Positives = 160/360 (44%), Gaps = 33/360 (9%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGD----FVTAPEISQIFGEMLAI 65
            +    G ++ D++    +  P  GYYS     FG   D    FVTAPE+S +F + LA 
Sbjct: 32  EIAAAGGWLSFDRFMERALYAPGLGYYSGGARKFGRRADDGSDFVTAPELSPLFAQTLAQ 91

Query: 66  FLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIYMV-ETSERLTL 124
            +  A    G     R++E G G G +   +L  +  L  +    L + +  E  ER   
Sbjct: 92  PVAEALAASG---TRRVMEFGAGTGKLAAGLLAALDALGAELDEYLIVDLSGELRERQRD 148

Query: 125 IQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRERMIDIDQH 184
             +  + +   K+ W  +L +   G   +V NE  D++P++ F   +   RER + +D  
Sbjct: 149 TIEAAVPALAAKVRWLDALPERFDGV--VVGNEVLDAMPVRLFAKADGAWRERGVALDAR 206

Query: 185 DSLVFN---IGDHEIKSNF--LTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTAIVI 239
            + VF+   +G   + +    L   D ++    E +    R + ++  R     G  ++I
Sbjct: 207 HAFVFDDRPVGAAGLPAVLAPLDVGDGYVTETHEAALAFTRTVCTMLGR-----GAVLLI 261

Query: 240 DYGYL-------QSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYKLYI 292
           DYG+        Q   G  +   + H +  P V PG  DL++HV+F  +   A+   + +
Sbjct: 262 DYGFPAHEYYHPQRDRGTLMCHYRHHAHDDPFVYPGLQDLTAHVEFTGIYEAAVATGVDL 321

Query: 293 NGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVSTSADKKSMGELFKILVVS 351
            G T+Q +FL   GI     ++     R  +   ++V++L+S    +  MGELFK++  S
Sbjct: 322 LGYTSQARFLLNAGITDALAAIDPSDVRAFLPAANAVQKLIS----EAEMGELFKVIAFS 377


>gi|300112772|ref|YP_003759347.1| hypothetical protein Nwat_0035 [Nitrosococcus watsonii C-113]
 gi|299538709|gb|ADJ27026.1| protein of unknown function DUF185 [Nitrosococcus watsonii C-113]
          Length = 393

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 163/366 (44%), Gaps = 33/366 (9%)

Query: 7   RKIVNLIK-----KNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFG 60
           +K+ NLI+       GQ+   ++  L +  P  GYY T     G  GDF+TAPE+S +F 
Sbjct: 21  QKLENLIQTAIEQAGGQIPFARFMELALYAPGLGYYMTGLRKLGTSGDFITAPELSPLFA 80

Query: 61  EMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVI--CKLKPDFFSVLSIYM-VE 117
             +A      +E  G  +   ++E G G G +  D+L  +      P+ + +L +   + 
Sbjct: 81  RCIARQCQQIFEMLGTGN---ILEFGAGSGRLAADLLSELNLSGHLPERYFILELSADLR 137

Query: 118 TSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRER 177
             ++ TL Q+  L +   ++NW   L D   G   ++ANE  D++P   F +      ER
Sbjct: 138 HRQQETLYQRVPLLA--PRVNWLDRLPDSIDGL--VIANEVCDAMPAHCFQLENRHDWER 193

Query: 178 MIDIDQHDSLVFNIG--DHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLA--CDG 233
            +  ++ D  V+  G   H +  + +      L  +       +  M+  +  +A     
Sbjct: 194 YVGYEK-DKFVWKKGPLSHSLLKDRIAKIRLLLKHVNNYESEINLAMEGWTTEVAHRLQK 252

Query: 234 GTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLSSIAI 286
           G  ++IDYG      Y   RV  TL     H  + +PL+  G  D+++HVDF  L+    
Sbjct: 253 GMLLIIDYGFPRHEYYHPERVMGTLMCHYRHQAHPNPLILTGLQDITTHVDFTALAEAGY 312

Query: 287 LYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDI-LLDSVKRLVSTSADKKSMGELF 345
              L + G  TQ  FL   G+ + A + +    ++ +     +KRLV  S     MGELF
Sbjct: 313 SSGLRVAGYCTQADFLLACGLDKLAAAEIAAGGKQALETSQQIKRLVLPS----EMGELF 368

Query: 346 KILVVS 351
           K L ++
Sbjct: 369 KALALT 374


>gi|307731309|ref|YP_003908533.1| hypothetical protein BC1003_3296 [Burkholderia sp. CCGE1003]
 gi|307585844|gb|ADN59242.1| protein of unknown function DUF185 [Burkholderia sp. CCGE1003]
          Length = 396

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 98/371 (26%), Positives = 155/371 (41%), Gaps = 37/371 (9%)

Query: 2   ENKLIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYST-CNPFGAVGD----FVTAPEIS 56
           E  + R    L +  G M  D+Y    +  P  GYYS     FG  GD    FVTAPE+S
Sbjct: 23  EALVARIRAELQEAGGWMPFDRYMERALYAPGLGYYSGGARKFGLRGDDGSDFVTAPELS 82

Query: 57  QIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDF--FSVLSIY 114
            +F   LA  +  A +  G      ++E G G G +   +L+ +  L   F  +S++ + 
Sbjct: 83  PLFAATLARPVAEALQASG---TREVMEFGAGTGKLAAGVLKALAALGVAFDSYSIVDLS 139

Query: 115 MVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGI 174
             E  ER     +        K+ W  +L +   G   ++ NE  D++P++ F       
Sbjct: 140 G-ELRERQRETIEAATPELAAKVRWLDALPERFEGV--VIGNEVLDAMPVRLFAWANGAW 196

Query: 175 RERMI-----DIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRL 229
            ER +          D  V    D    S   T    ++  + + +    R + ++  R 
Sbjct: 197 HERGVVWRDGRFAFEDRPVTAPADLARLSEIDTAGADYIAEMHDAACAFTRTICTMLAR- 255

Query: 230 ACDGGTAIVIDYG------YLQSRVGDTLQAVKGH-TYVSPLVNPGQADLSSHVDFQRLS 282
               G A  IDYG      Y   R   TL     H  +  P V PG  D+++HV+F  ++
Sbjct: 256 ----GAAFFIDYGFPRHEYYHAQRAEGTLMCHYRHRAHGDPFVYPGLQDITAHVEFTGIA 311

Query: 283 SIAILYKLYINGLTTQGKFLEGLGIWQRAFSLM--KQTARKDILLDSVKRLVSTSADKKS 340
              +     + G T+Q +FL   GI   A S +    TAR     ++V++L+S    +  
Sbjct: 312 EAGVETGADLLGFTSQARFLLNAGI-TDALSEIDPADTARFLRAANAVQKLLS----EAE 366

Query: 341 MGELFKILVVS 351
           MGELFK++  S
Sbjct: 367 MGELFKVIAFS 377


>gi|298369648|ref|ZP_06980965.1| hypothetical protein HMPREF9016_02089 [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282205|gb|EFI23693.1| hypothetical protein HMPREF9016_02089 [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 383

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 100/370 (27%), Positives = 164/370 (44%), Gaps = 49/370 (13%)

Query: 4   KLIRKIVNLIKKNGQ-MTVDQYFALCVADPEFGYYST-CNPFGAVGDFVTAPEISQIFGE 61
           +L R I + I  NG  +   ++  L +  P+FGYY+   +  GA GDF+TAP +S +FG+
Sbjct: 18  QLCRLISDEISDNGNWIPFSRFMELALYAPDFGYYTGGSHKIGAGGDFITAPVLSPLFGK 77

Query: 62  MLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLS-IYMVETSE 120
            L   L     Q    +   + E G G G + + +L+       +F   LS  Y+VE S 
Sbjct: 78  TLFAQLSVLLPQ----TAGNIYEFGAGTGDLAVSLLQ-------NFSDGLSHYYIVELSP 126

Query: 121 RLTLIQKKQLAS-----YGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIR 175
            L   Q+  +++        KI    +L D   G   ++ NE  D++P++  ++ + G  
Sbjct: 127 ELAERQRAMISNSLPPETARKIIHLDTLPDEFDGI--VIGNEVLDAMPVE--LVRKEGGN 182

Query: 176 ERMIDIDQHDSLVFNIGDHEIKSNFL-TCSDYFLGA---IFENSPCRDREMQSISDRLAC 231
            + I +   +     +         L +  +YF  A     E  P +   + +++ +L  
Sbjct: 183 FQQIGVSIKNGEFVQVPKTLATPTLLRSAENYFPDAEPYTSELHPAQHAFVHTVASKLRR 242

Query: 232 DGGTAIVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSI 284
            G   I IDYG+        Q  +G  +   + HT   P   PG  DL++HV+F  ++  
Sbjct: 243 GG--MIFIDYGFDAAQYYHPQRHMGTLIGHYRHHTVHDPFFLPGLTDLTAHVNFTDIAQA 300

Query: 285 AILYKLYINGLTTQGKFLEGLGIWQRAFSLMKQTARKD-----ILLDSVKRLVSTSADKK 339
           A    L + G TTQ  FL  LGI      L+ QT   D         +V++LV    +  
Sbjct: 301 ATDAGLDLIGYTTQANFLLNLGIT----DLLAQTGHPDTAAYLTAAAAVQQLV----NPH 352

Query: 340 SMGELFKILV 349
            MGELFK++ 
Sbjct: 353 EMGELFKVIA 362


>gi|260222285|emb|CBA31696.1| hypothetical protein Csp_D28410 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 383

 Score = 93.2 bits (230), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 166/374 (44%), Gaps = 55/374 (14%)

Query: 4   KLIRKIVNLIKK-NGQMTVDQYFALCVADPEFGYYSTCN------PFGAVG--------- 47
            L R I + I+K  G +  D + AL +  P +GYY+  +      P G VG         
Sbjct: 20  NLTRIIADAIEKAGGWIGFDTFMALALYAPGWGYYANGSTKFGQMPQGLVGEAGVEGAGS 79

Query: 48  DFVTAPEISQIFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDF 107
           DFVTAPEIS +FG+ LA  +    E  G      L E G G G + L +L  +       
Sbjct: 80  DFVTAPEISPLFGQALARQVAQVLEATG---TDELWEFGAGTGALALQLLDALGD----- 131

Query: 108 FSVLSIYMVETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQF 167
             V S  +V+ S+ L   Q+++LA +  K+ W ++L     G   +V NE  D++P++  
Sbjct: 132 -RVRSYTIVDLSDSLKARQRERLAGHAGKVQWVSALPAHMRG--VVVGNEVLDAMPVQLL 188

Query: 168 VMTEHGIRERMIDIDQHDSLVFNIGDHEIKSNFLTCSDY-FLGAIFENSPCRDREMQSIS 226
                   ER + + Q   LV+      ++       ++ +L  I        R   +++
Sbjct: 189 ARVAGAWHERGVALAQ-GQLVWADKPSTLRPPVDIDGEHDYLTEIHAQGEAFVR---TLA 244

Query: 227 DRLACDGGTAIVIDYGYLQS------RVGDTLQAVKGHTY-VSPLVNPGQADLSSHVDFQ 279
           D L    G A ++DYG+ +S      R G T+   + H     PL + G  D+++HV+F 
Sbjct: 245 DHLQL--GAAFLLDYGFPESEYYHVQRSGGTVMCHRAHRADADPLSDVGLKDITAHVNFT 302

Query: 280 RLSSIAILYKLYINGLTTQGKFLEGLGIWQ--RAFSLMKQTARKDILLDSVKRLVSTSAD 337
            ++  A    L + G T Q  FL   G+ +  ++  L  + A + +L++           
Sbjct: 303 GVAVAAQDAGLDVLGYTNQAHFLMNCGLVEAMQSQPLQARVAAQKLLME----------- 351

Query: 338 KKSMGELFKILVVS 351
              MGELFK++ + 
Sbjct: 352 -HEMGELFKVVALG 364


>gi|119620805|gb|EAX00400.1| hypothetical protein PRO1853, isoform CRA_a [Homo sapiens]
          Length = 196

 Score = 93.2 bits (230), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 5   LIRKIVNLIKKNGQMTVDQYFALCVADPEFGYYSTCNPFGAVGDFVTAPEISQIFGEMLA 64
           ++R ++  IK  G +TV +Y    + +P  GYY   +  G  GDF+T+PEISQIFGE+L 
Sbjct: 43  MLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYYVYRDMLGEKGDFITSPEISQIFGELLG 102

Query: 65  IFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSV-LSIYMVETS 119
           I+ I  W   G  +  +LVELGPGRG ++ DILRV  +L     +  +S+++VE +
Sbjct: 103 IWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQLGSVLKNCDISVHLVEGT 158


>gi|89899622|ref|YP_522093.1| hypothetical protein Rfer_0812 [Rhodoferax ferrireducens T118]
 gi|89344359|gb|ABD68562.1| protein of unknown function DUF185 [Rhodoferax ferrireducens T118]
          Length = 375

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 84/359 (23%), Positives = 157/359 (43%), Gaps = 44/359 (12%)

Query: 11  NLIKKNGQMTVDQYFALCVADPEFGYYSTCNP-FGAV------------GDFVTAPEISQ 57
            +    G +  D++ AL +  P  GYY+  +  FGA+             DFVTAPE++ 
Sbjct: 18  TITHHGGWIGFDEFMALALYTPGLGYYANNSAKFGALPYARQAGVTVAGSDFVTAPEMTP 77

Query: 58  IFGEMLAIFLICAWEQHGFPSCVRLVELGPGRGIMMLDILRVICKLKPDFFSVLSIY-MV 116
           +FG+ LA  +  A +         + E G G G + L +L  +          L+ Y +V
Sbjct: 78  LFGQTLAAQVAQALQ---VTQTHEVWEFGAGSGALALQVLEALAAQG----QALTRYSIV 130

Query: 117 ETSERLTLIQKKQLASYGDKINWYTSLADVPLGFTFLVANEFFDSLPIKQFVMTEHGIRE 176
           + S  L   Q+  L  +GD + W   L D   G   ++ NE  D++P+K     +    E
Sbjct: 131 DLSGSLRERQQATLEKFGDTVQWVNELPDTLQGV--VIGNEVLDAMPVKLLARVKGVWFE 188

Query: 177 RMIDIDQHDSLVFNIGDHEIKSNFLTCSDYFLGAIFENSPCRDREMQSISDRLACDGGTA 236
           R + +     L++     +++       ++    + E  P  +  +++++D+L+   G A
Sbjct: 189 RGVALGAASELIWQDRPTDLRPPLAIDGEHDY--LTEIHPQGESFIRTLADKLSA--GAA 244

Query: 237 IVIDYGY-------LQSRVGDTLQAVKGHTYVSPLVNPGQADLSSHVDFQRLSSIAILYK 289
             IDYG+        Q  +G  +      +   PL + G  D+++HV+F  ++    +  
Sbjct: 245 FFIDYGFPEHEYYHAQRHMGTVMCHRSHQSDTDPLTDVGLKDITAHVNFTGIALACQMED 304

Query: 290 LYINGLTTQGKFLEGLGIWQRAFSLMKQTARKDILLDSVKRLVSTSADKKSMGELFKIL 348
             + G  TQ +FL   G+  R   +   T ++ +     ++L+     +  MGELFK++
Sbjct: 305 WGVLGYCTQARFLINCGLVSR---MENATLQERV---RAQKLIM----EHEMGELFKVI 353


>gi|34499588|ref