>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain. PAS domains appear in archaea, bacteria and eukaryotes. Several PAS-domain proteins are known to detect their signal by way of an associated cofactor. Haeme, flavin, and a 4-hydroxycinnamyl chromophore are used in different proteins. The PAS domain was named after three proteins that it occurs in: Per- period circadian protein Arnt- Ah receptor nuclear translocator protein Sim- single-minded protein. PAS domains are often associated with PAC domains IPR001610 from INTERPRO. It appears that these domains are directly linked, and that together they form the conserved 3D PAS fold. The division between the PAS and PAC domains is caused by major differences in sequences in the region connecting these two motifs . In human PAS kinase, this region has been shown to be very flexible, and adopts different conformations depending on the bound ligand . Probably the most surprising identification of a PAS domain was that in EAG-like K^+-channels . ; GO: 0004871 signal transducer activity, 0007165 signal transduction.

Probab=98.73 E-value=1.2e-07 Score=73.88 Aligned_cols=108 Identities=15% Similarity=0.182 Sum_probs=82.8 Q ss_pred EEEEECCCCCEEEECHHHHHHHCCCHHHHCCCCHHHHHCCCCCCCHHH-HHHHHHCCC-CCCCEEEE---ECCCCCCCEE Q ss_conf 599997999099966789966289978974996888204016882389-999986379-61671688---6147988379 Q gi|254780413|r 85 FTWNIDAHGYLKEISEELPKTIGNYAFKMIGMRLCDVSDILHIDPNNH-IGDLLKRQN-TWYGKTTL---WPIEGTNLYV 159 (820) Q Consensus 85 fvw~~D~eGr~~~vn~~~~~~~G~~~~e~iGr~~~e~~~~~~~~p~~~-i~~~l~~~~-~~~~~~~~---~~~~g~~~~~ 159 (820) T Consensus 17 ~~~~~d~~g~~~~~n~~~~~~~Gy~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~--~ 94 (130) T TIGR00229 17 AIIVVDLEGNILYVNPAFEELFGYSAEELLGRNVLELIPEEDREELRERIERLLETGEREPVSEERRVLGRRKDGSE--I 94 (130) T ss_pred CEEEEECCCCEEEECHHHHHHHCCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCCCE--E T ss_conf 26887057615750325777617875895387510002764146899999876326754320123466644378968--8 Q ss_pred EEEEEEEEEECCCCCEEEEEEEEEEEECCCHHHHHHH Q ss_conf 9998630015688736305566898522103779999 Q gi|254780413|r 160 PIDLAALPIYSRNREFSGFRGFGIVHVNRVDNDPRAL 196 (820) Q Consensus 160 ~v~ls~~Pv~d~~g~~~G~rG~gv~r~~~~~~~~~~~ 196 (820) T Consensus 95 ~~~~~~~~~~~~~g~~~~~~--~~~~d~t~~~~~~~~ 129 (130) T TIGR00229 95 WVEVSVSPIRDSNGGVLGVL--GIVRDITERKEAEEA 129 (130) T ss_pred EEEEECCCCCCCCCCEEEEE--EEEECHHHHHHHHHC T ss_conf 99873010000137703677--665211478998850

HHsearch alignment for GI: 254780413 and conserved domain: TIGR00229