>TIGR01924 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 This entry describes the anti-sigma B factor also known as serine-protein kinase RsbW. Sigma B controls the general stress regulon in B subtilis and is activated by cell stresses such as stationary phase and heat shock. RsbW binds to sigma B and prevents formation of the transcription complex at the promoter . RsbV (anti-anti-sigma factor) binds to RsbW to inhibit association with sigma B, however RsbW can phosphorylate RsbV, causing disassociation of the RsbV/RsbW complex . Low ATP level or environmental stress causes the dephosphorylation of RsbV .; GO: 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0016989 sigma factor antagonist activity, 0006468 protein amino acid phosphorylation, 0045892 negative regulation of transcription DNA-dependent.

Probab=93.31 E-value=0.11 Score=30.36 Aligned_cols=80 Identities=23% Similarity=0.341 Sum_probs=61.4 Q ss_pred HHHHHHHHHHHHHHCCCC---C-CEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHCCCCEEECCCCCCCCCCCCCHHH Q ss_conf 999999999888871889---7-879999998049949999997889789888664237718734787666788860689 Q gi|254780413|r 704 VKQIALNILSNAIHFTPS---G-GQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLP 779 (820) Q Consensus 704 l~Qvl~NLl~NAik~t~~---g-g~v~v~~~~~~~~~v~i~V~DtG~GI~~~~~~~iFepF~~~~~~~~~~~~GtGLGLa 779 (820) T Consensus 44 ~KIAVSEA~TN~V~HAYke~~nvG~~~i~F~iyED-klev~vsD~G~SFD~d~~k~~lGPyd~~~~i~~L~e--GGLGLF 120 (161) T TIGR01924 44 LKIAVSEACTNAVKHAYKEEENVGEISIEFEIYED-KLEVIVSDEGDSFDLDTKKQELGPYDKSEDIDQLRE--GGLGLF 120 (161) T ss_pred HHHHHHHHHCCCEEEEECCCCCEEEEEEEEEEEEE-EEEEEEECCCCCCCHHHHHHHCCCCCCCCCHHHHHC--CCCHHH T ss_conf 67766555303311223089836789988878875-789998207864111002532589795787543201--771366 Q ss_pred HHHHHHH Q ss_conf 9999999 Q gi|254780413|r 780 LAKAMVD 786 (820) Q Consensus 780 i~k~iVe 786 (820) T Consensus 121 LietLMD 127 (161) T TIGR01924 121 LIETLMD 127 (161) T ss_pred HHHCCCC T ss_conf 4510376

HHsearch alignment for GI: 254780413 and conserved domain: TIGR01924