>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase. They subsequently transfer the phosphoryl group to the Asp acceptor residue of a response regulator protein. Two-component signalling systems, consisting of a histidine protein kinase that senses a signal input and a response regulator that mediates the output, are ancient and evolutionarily conserved signaling mechanisms in prokaryotes and eukaryotes.

Probab=99.07 E-value=4.4e-10 Score=91.81 Aligned_cols=64 Identities=42% Similarity=0.666 Sum_probs=57.9 Q ss_pred HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999852345317489999999999731268778889999999999989999999999999866 Q gi|254780413|r 583 SHKSDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISK 649 (820) Q Consensus 583 ~~k~~fla~vsHElrtPL~~I~g~~~~l~~~~~~~~~~~~~~~~l~~i~~~~~~l~~li~dlLd~sr 649 (820) T Consensus 2 ~~~~~~~a~iaHelrtPL~~i~~~~~~l~~~~~~---~~~~~~~~~~i~~~~~~l~~lv~~~l~~~~ 65 (65) T cd00082 2 QAKGEFLANVSHELRTPLTAIRGALELLEEELLD---DEEQREYLERIREEAERLLRLINDLLDLSR 65 (65) T ss_pred CHHHHHHHHHHHHHCCHHHHHHCCHHHHHHCCCC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 3599999987298704888886014898856688---699999999999999999999999998609

HHsearch alignment for GI: 254780413 and conserved domain: cd00082