HHsearch alignment for GI: 254780414 and conserved domain: CHL00188

>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional.
Probab=99.87  E-value=3.8e-21  Score=171.35  Aligned_cols=175  Identities=19%  Similarity=0.285  Sum_probs=116.4

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCH---HHHHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-388-9999-99975376---89808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPK---EILESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~---~I~~~~iP   81 (520)
T Consensus         2 ~~I~Iid~g~GNi~Sv~~al~~~g~~~~ii~---~~~~i~--~~d~lILPGVGsf~~~m~~L~~~~l~~~i~~~~~~g~p   76 (210)
T CHL00188          2 MKIGIIDYSMGNLHSVSRAIQQAGQQPCIIN---SESELA--QVHALVLPGVGSFDLAMKKLEKKGLITPIKKWIAEGNP   76 (210)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEC---CHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             7799995884789999999998699879979---999996--48968988867389999988630516999999976998


Q ss_pred             EEEECHHHHHHHHH-----------CCCEEEECC------CCCCCEEEEEECCCC------CCCCCCCCCCCCEEEEEEC
Q ss_conf             89977899998997-----------096999869------866103667523886------2227872665533686002
Q gi|254780414|r   82 LLGICYGQQIMCQS-----------LGGKTKNSQ------SREFGRAFIEIKKNC------SLLKGMWEKGSKQQVWMSH  138 (520)
Q Consensus        82 ILGICyG~QlLa~~-----------~GG~V~~~~------~~EyG~~~I~i~~~~------~lf~gl~~~~~~~~VwmSH  138 (520)
T Consensus        77 iLGICLGmQlLf~~seEg~~~GLgli~G~v~k~~~~~~~kvPh~GWn~i~~~~~~~~~~~~~~~~~~~~~~---~~YFvH  153 (210)
T CHL00188         77 FIGICLGLHLLFETSEEGKEEGLGIYKGQVKRLKHSPVKVIPHMGWNRLECQNSECQNSEWVNWKAWPLNP---WAYFVH  153 (210)
T ss_pred             EEEEEHHEEEEEHHCCCCCCCCCCEECCEEEECCCCCCCCCCCCCHHHEECCCCCCCCCCCCHHHCCCCCC---CEEEEE
T ss_conf             69984210221022115676773456668999378866467320542324457643344451121577677---079974


Q ss_pred             CCHHHCCCCC-CCEEECCCCC---CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHH
Q ss_conf             2011012444-2112323983---1788986350011246521222152025779987550
Q gi|254780414|r  139 GDQVEHIPEG-FEVIASSDST---PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHH  195 (520)
Q Consensus       139 ~D~V~~lP~g-f~viA~S~~~---~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~  195 (520)
T Consensus       154 SY~~~--~~~~~~~~~~~~yg~~~~~a~v~--k~Ni~G~QFHPEKS-~~~Gl~lL~nFl~~  209 (210)
T CHL00188        154 SYGVM--PKSQACATTTTFYGKQQMVAAIE--YDNIFAMQFHPEKS-GEFGLWLLREFMKK  209 (210)
T ss_pred             EEEEC--CCCCCEEEEEEEECCEEEEEEEE--ECCEEEEECCCCCC-CHHHHHHHHHHHHC
T ss_conf             13552--79843799999639989999997--19999994880007-68799999999755